Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000028444 (Cntfr)
Chromosomal location
Chr 4: 41604532 - 41644123 (-)
Description
ciliary neurotrophic factor receptor Gene [Source:MGI (curated);Acc:Cntfr-002]
RefSeq_dna
NM_016673 
RefSeq_peptide
NP_057882.1 NP_001129528.1 
UniGene
Mm.425178 
MGI
MGI:99605 
Uniprot/SWISSPROT
O88507 
Uniprot/SPTREMBL
A2AMR7 Q9D586 A2AMR5 Q3UVR2 
Human Ortholog
ENSG00000122756 (CNTFR)
Omim not available
UniTrap UNI33453
Vector Insertion
Chr 4: 41642342 - 41644075
Public Clones IST12937C1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29546
Vector Insertion
Chr 4: 41633828 - 41642475
Public Clones M122H05 (ggtc) IST14245D9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17203
Vector Insertion
Chr 4: 41622137 - 41633828
Public Clones IST14125C3 (tigm) IST10129E7 (tigm) IST14568C4 (tigm)
Private Clones OST447603 (lexicon) OST433962 (lexicon) OST302325 (lexicon) OST262547 (lexicon)
OST259385 (lexicon) OST241051 (lexicon) OST239362 (lexicon) OST97893 (lexicon)
OST97837 (lexicon) OST67710 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18073
Vector Insertion
Chr 4: 41618109 - 41622051
Public Clones (sanger)
Private Clones OST430883 (lexicon) OST310980 (lexicon) OST285794 (lexicon) OST252592 (lexicon)
OST218024 (lexicon) OST136084 (lexicon) OST79917 (lexicon) OST78472 (lexicon)
OST65518 (lexicon)
Severity of mutation (?) Insertion after 25% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12002
Vector Insertion
Chr 4: 41616861 - 41617874
Public Clones G056F02 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 29% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000064443
Sequence
GCGGCGGCTCCAGCCGGCGCGGCGCGGGGTTCGGCAGTGGGATCCGGCCGCAGTGCTCGCTCCGCGCTCCTGCCTCGCTCCCCGCCTGCAGCGGCCGAAG

GGCGCGGCGCGGAGCCCGGGTGGCCCGAGGGCGCG - UNI29546 - - UNI33453 - AACCCTGCCCCGTCACATCATCCCAGGAAGACTTTGGT

CTGGAGAGGAGGATAATATTGATGTGTGTGGAGAACAGCTGGTGGTAACGAG - UNI17203 - - UNI29546 - ATGGCTGCTTCTGTCCCATGG

GCCTGCTGTGCTGTGCTTGCCGCTGCCGCCGCCGCTGTCTACACGCAGAAACACAGTCCACAGG - UNI18073 - AGGCACCCCACGTGCAGTATGA

GCGTCTGGGCGCAGATGTGACGCTGCCGTGTGGGACAGCGAGCTGGGACGCAGCTGTGACATGGAGGGTAAACGGGACAGATCTGGCCCCTGACCTGCTC

AACGGCTCTCAGCTGATACTGCGAAGCTTAGAACTGGGCCACAGTGGCCTATACGCCTGTTTCCACCGTGACTCCTGGCACCTGCGCCACCAAGTCCTTC

TACATGTGGGTT - UNI12002 - TGGCTGGGCTTCAGTCTCCCTAGACTCAGATCCAAGATGTGAATCTAAAGACAAGCTGTTTAGTTTTCAACTGA

TGGAAACCTCGAGGAGTGGCGAGGAGACACAGAGGAGGGAAGTTAAGTTGTTAATAAAATAAAAAATGAGTAGTTAGCAGG
Translation
 - UNI29546 - - UNI33453 -  - UNI17203 - - UNI29546 - MAASVPWACCAVLAAAAAAVYTQKHSPQE - UNI18073 - EAP

HVQYERLGADVTLPCGTASWDAAVTWRVNGTDLAPDLLNGSQLILRSLELGHSGLYACFHRDSWHLRHQVLLHVGL - UNI12002 - LAGLQSP
Transcript ENSMUST00000084701
Sequence
GCGCGCGTGCCCGCGCCTGCGTGTGTTCCCATCACCAACGCTCCGTATTTCGTCGCCCTTCCTGCATTCCTTCCCGCAGCCGACTAGTTAGGGTCTGTAT

CCTGGGGAGCTGAG - UNI29546 - - UNI33453 - AACCCTGCCCCGTCACATCATCCCAGGAAGACTTTGGTCTGGAGAGGAGGATAATATTG

ATGTGTGTGGAGAACAGCTGGTGGTAACGAG - UNI17203 - - UNI29546 - ATGGCTGCTTCTGTCCCATGGGCCTGCTGTGCTGTGCTTGCC

GCTGCCGCCGCCGCTGTCTACACGCAGAAACACAGTCCACAGG - UNI18073 - AGGCACCCCACGTGCAGTATGAGCGTCTGGGCGCAGATGTGAC

GCTGCCGTGTGGGACAGCGAGCTGGGACGCAGCTGTGACATGGAGGGTAAACGGGACAGATCTGGCCCCTGACCTGCTCAACGGCTCTCAGCTGATACTG

CGAAGCTTAGAACTGGGCCACAGTGGCCTATACGCCTGTTTCCACCGTGACTCCTGGCACCTGCGCCACCAAGTCCTTCTACATGTGGGTT - UNI120

02 - TGGCTGGGCTTCAGTCTCCCTAGACTCAGATCCAAGATGTGAATCTAAAGACAAGCTGTTTAGTTTTCAACTGATGGAAACCTCGAGGAGTGGCG

AGGAGACACAGAGGAGGGAAGTTAAGTTGTTAATAAAATAAAAAATGAGTAGTTAGCAGG
Translation
 - UNI29546 - - UNI33453 -  - UNI17203 - - UNI29546 - MAASVPWACCAVLAAAAAAVYTQKHSPQE - UNI18073 - EAP

HVQYERLGADVTLPCGTASWDAAVTWRVNGTDLAPDLLNGSQLILRSLELGHSGLYACFHRDSWHLRHQVLLHVGL - UNI12002 - LAGLQSP
Transcript ENSMUST00000102961
Sequence
GCGGCTCCAGCCGGCGCGGCGCGGGGTTCGGCAGTGGGATCCGGCCGCAGTGCTCGCTCCGCGCTCCTGCCTCGCTCCCCGCCTGCAGCGGCCGAAGGGC

GCGGCGCGGAGCCCGGGTGGCCCGAGGGCGCG - UNI29546 - - UNI33453 - AACCCTGCCCCGTCACATCATCCCAGGAAGACTTTGGTCTG

GAGAGGAGGATAATATTGATGTGTGTGGAGAACAGCTGGTGGTAACGAG - UNI17203 - - UNI29546 - ATGGCTGCTTCTGTCCCATGGGCC

TGCTGTGCTGTGCTTGCCGCTGCCGCCGCCGCTGTCTACACGCAGAAACACAGTCCACAGG - UNI18073 - AGGCACCCCACGTGCAGTATGAGCG

TCTGGGCGCAGATGTGACGCTGCCGTGTGGGACAGCGAGCTGGGACGCAGCTGTGACATGGAGGGTAAACGGGACAGATCTGGCCCCTGACCTGCTCAAC

GGCTCTCAGCTGATACTGCGAAGCTTAGAACTGGGCCACAGTGGCCTATACGCCTGTTTCCACCGTGACTCCTGGCACCTGCGCCACCAAGTCCTTCTAC

ATGTGGGTT - UNI12002 - TGCCGCCGCGGGAGCCTGTGCTCAGCTGCCGCTCCAACACTTACCCCAAGGGCTTCTACTGCAGCTGGCACCTGCCC

ACCCCCACCTACATCCCCAATACCTTCAATGTGACTGTGCT GCATGGCTCCAAAATTATGGTCTGTGAGAAGGACCCAGCCCTCAAGAACCGCTGCCAC

ATTCGGTACATGCACCTGTTCTCAACCATCAAGTACAAGGTCTCCATAAGTGTCAGCAACGCCTTGGGTCACAACACTACGGCCATCACCTTTGACGAAT

TCACCATTG TGAAGCCTGATCCTCCAGAAAACGTGGTGGCCCGGCCAGTGCCCAGCAACCCCCGTCGGCTGGAGGTGACATGGCAGACACCCTCAACTT

GGCCCGACCCTGAATCCTTTCCTCTCAAGTTCTTCCTGCGCTACCGGCCTCTCATCCTGGACCAATGGCAGCAT GTGGAGCTCTCGGATGGCACAGCAC

ACACCATCACAGATGCCTACGCAGGGAAGGAATACATCATCCAGGTGGCAGCCAAGGACAATGAGATTGGGACATGGAGTGACTGGAGCGTGGCTGCTCA

CGCCACACCCTGGACTGAGGAACCTCGGCATCTCACAACAGAAGCCCAGGCCCCCG AGACCACGACCAGCACCACCAGCTCATTGGCACCCCCACCCAC

CACGAAGATCTGTGACCCTGGGGAGCTTGGCAGCGGCGGAGGACCCTCCATACTCTTCTTGACCAGTGTCCCAGTCACTCTGGTCCTGGCTGCCGCTGCT

GCCACAGCCAACAATCTCCTGATCTG AGCCCTGCATCCCACGAGGACATGCCAGAGCGCCTGCGGAGGAGCAGGAGGCCGGAGCTGAGCCTGCAGACCC

CGGTTTCTATTTTGCACACGGGCAGGAGGACCTTTTGCATTCTCTTCAGACACAATTTGTAGAGACCCCGGCAGGCCCGGGCCTGCCTTCCGTCCCCCCA

GCCTCATCTCACCAAGCCGGCCCTCCTTTCCATCCAGAGAGGAGGACCATGCAGCTAACCCACCCACCAAAGACCCCTCTCATCTTTCCCCCCTCGGGCT

GGACCCTCCAACGCCAGCGACTCCCAGGAGCCCTTGGGGGACCTGAGGGGAGCCCCCACCCCACATCCACAGTTTTCTCCTCCTGCCCCAGCCTCCTGTC

TGTCCCAGGGTCTTTGTTGCCACCATCAGATTATAAGCTCCTGACACTGGGGGGGCCCAGCCATCCCCCTCCCCCCGGTGCCCACACTTTTCAGTCCTTC

CACCTTTGCCCCTGTTTTGTACGATCCTCCATTGGCCCTTTCCTACCCCCCAGTATTTAATGTCCTGTCAGTCCCTTCTAGTCTGACTCAATGGTAACTT

GCTGTATTTGAATTTTTTATAGATGTATATACATGGGAGGGAGGGGTAGGGAGTTCTCATTAAACGTCACCATTTCATG
Translation
 - UNI29546 - - UNI33453 -  - UNI17203 - - UNI29546 - MAASVPWACCAVLAAAAAAVYTQKHSPQE - UNI18073 - EAP

HVQYERLGADVTLPCGTASWDAAVTWRVNGTDLAPDLLNGSQLILRSLELGHSGLYACFHRDSWHLRHQVLLHVGL - UNI12002 - LPPREPVLSC

RSNTYPKGFYCSWHLPTPTYIPNTFNVTVL LHGSKIMVCEKDPALKNRCHIRYMHLFSTIKYKVSISVSNALGHNTTAITFDEFTIV VKPDPPENVVA

RPVPSNPRRLEVTWQTPSTWPDPESFPLKFFLRYRPLILDQWQH VELSDGTAHTITDAYAGKEYIIQVAAKDNEIGTWSDWSVAAHATPWTEEPRHLTT

EAQAPE ETTTSTTSSLAPPPTTKICDPGELGSGGGPSILFLTSVPVTLVLAAAAATANNLLI I
Transcript ENSMUST00000102962
Sequence
TCGTCGCCCTTCCTGCATTCCTTCCCGCAGCCGACTAGTTAGGGTCTGTATCCTGGGGAGCTGAG - UNI29546 - - UNI33453 - AACCCTGC

CCCGTCACATCATCCCAGGAAGACTTTGGTCTGGAGAGGAGGATAATATTGATGTGTGTGGAGAACAGCTGGTGGTAACGAG - UNI17203 - - UN

I29546 - ATGGCTGCTTCTGTCCCATGGGCCTGCTGTGCTGTGCTTGCCGCTGCCGCCGCCGCTGTCTACACGCAGAAACACAGTCCACAGG - UNI

18073 - AGGCACCCCACGTGCAGTATGAGCGTCTGGGCGCAGATGTGACGCTGCCGTGTGGGACAGCGAGCTGGGACGCAGCTGTGACATGGAGGGTA

AACGGGACAGATCTGGCCCCTGACCTGCTCAACGGCTCTCAGCTGATACTGCGAAGCTTAGAACTGGGCCACAGTGGCCTATACGCCTGTTTCCACCGTG

ACTCCTGGCACCTGCGCCACCAAGTCCTTCTACATGTGGGTT - UNI12002 - TGCCGCCGCGGGAGCCTGTGCTCAGCTGCCGCTCCAACACTTAC

CCCAAGGGCTTCTACTGCAGCTGGCACCTGCCCACCCCCACCTACATCCCCAATACCTTCAATGTGACTGTGCT GCATGGCTCCAAAATTATGGTCTGT

GAGAAGGACCCAGCCCTCAAGAACCGCTGCCACATTCGGTACATGCACCTGTTCTCAACCATCAAGTACAAGGTCTCCATAAGTGTCAGCAACGCCTTGG

GTCACAACACTACGGCCATCACCTTTGACGAATTCACCATTG TGAAGCCTGATCCTCCAGAAAACGTGGTGGCCCGGCCAGTGCCCAGCAACCCCCGTC

GGCTGGAGGTGACATGGCAGACACCCTCAACTTGGCCCGACCCTGAATCCTTTCCTCTCAAGTTCTTCCTGCGCTACCGGCCTCTCATCCTGGACCAATG

GCAGCAT GTGGAGCTCTCGGATGGCACAGCACACACCATCACAGATGCCTACGCAGGGAAGGAATACATCATCCAGGTGGCAGCCAAGGACAATGAGAT

TGGGACATGGAGTGACTGGAGCGTGGCTGCTCACGCCACACCCTGGACTGAGGAACCTCGGCATCTCACAACAGAAGCCCAGGCCCCCG AGACCACGAC

CAGCACCACCAGCTCATTGGCACCCCCACCCACCACGAAGATCTGTGACCCTGGGGAGCTTGGCAGCGGCGGAGGACCCTCCATACTCTTCTTGACCAGT

GTCCCAGTCACTCTGGTCCTGGCTGCCGCTGCTGCCACAGCCAACAATCTCCTGATCTG AGCCCTGCATCCCACGAGGACATGCCAGAGCGCCTGCGGA

GGAGCAGGAGGCCGGAGCTGAGCCTGCAGACCCCGGTTTCTATTTTGCACACGGGCAGGAGGACCTTTTGCATTCTCTTCAGACACAATTTGTAGAGACC

CCGGCAGGCCCGGGCCTGCCTTCCGTCCCCCCAGCCTCATCTCACCAAGCCGGCCCTCCTTTCCATCCAGAGAGGAGGACCATGCAGCTAACCCACCCAC

CAAAGACCCCTCTCATCTTTCCCCCCTCGGGCTGGACCCTCCAACGCCAGCGACTCCCAGGAGCCCTTGGGGGACCTGAGGGGAGCCCCCACCCCACATC

CACAGTTTTCTCCTCCTGCCCCAGCCTCCTGTCTGTCCCAGGGTCTTTGTTGCCACCATCAGATTATAAGCTCCTGACACTGGGGGGGCCCAGCCATCCC

CCTCCCCCCGGTGCCCACACTTTTCAGTCCTTCCACCTTTGCCCCTGTTTTGTACGATCCTCCATTGGCCCTTTCCTACCCCCCAGTATTTAATGTCCTG

TCAGTCCCTTCTAGTCTGACTCAATGGTAACTTGCTGTATTTGAATTTTTTATAGATGTATATACATGGGAGGGAGGGGTAGGGAGTTCTCATTAAACGT

CACCATTTCATG
Translation
 - UNI29546 - - UNI33453 -  - UNI17203 - - UNI29546 - MAASVPWACCAVLAAAAAAVYTQKHSPQE - UNI18073 - EAP

HVQYERLGADVTLPCGTASWDAAVTWRVNGTDLAPDLLNGSQLILRSLELGHSGLYACFHRDSWHLRHQVLLHVGL - UNI12002 - LPPREPVLSC

RSNTYPKGFYCSWHLPTPTYIPNTFNVTVL LHGSKIMVCEKDPALKNRCHIRYMHLFSTIKYKVSISVSNALGHNTTAITFDEFTIV VKPDPPENVVA

RPVPSNPRRLEVTWQTPSTWPDPESFPLKFFLRYRPLILDQWQH VELSDGTAHTITDAYAGKEYIIQVAAKDNEIGTWSDWSVAAHATPWTEEPRHLTT

EAQAPE ETTTSTTSSLAPPPTTKICDPGELGSGGGPSILFLTSVPVTLVLAAAAATANNLLI I

For any suggestions or comments, please send an email to unitrap@crg.es