Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000028465 (Tln1)
Chromosomal location
Chr 4: 43544393 - 43575127 (-)
Description
talin 1 Gene [Source:MGI (curated);Acc:Tln1-001]
RefSeq_dna
NM_011602 
RefSeq_peptide
NP_035732.1 
UniGene
Mm.208601 
MGI
MGI:1099832 
Uniprot/SWISSPROT
P26039 
Uniprot/SPTREMBL
A2AIM7 A2AIM6 A2AIM2 A2AIM8 Q0V930 Q3TBC3 Q3UHS6 Q80TM2 Q8C9Z8 
Human Ortholog
ENSG00000137076 (TLN1)
Omim not available
UniTrap UNI15182
Vector Insertion
Chr 4: 43569492 - 43575128
Public Clones (sanger) D015D08 (ggtc) E039D04 (ggtc) E079G07 (ggtc) PST11600-NR (escells)
IST14579G2 (tigm) IST13666H4 (tigm) IST10867D3 (tigm) IST10867D3HMF2 (tigm)
IST14431F4 (tigm) IST14778E3 (tigm) IST14648C10 (tigm) IST14669F11 (tigm)
IST14505E1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16919
Vector Insertion
Chr 4: 43569492 - 43569656
Public Clones not available
Private Clones OST452305 (lexicon) OST448298 (lexicon) OST406600 (lexicon) OST314818 (lexicon)
OST281341 (lexicon) OST222812 (lexicon) OST178619 (lexicon) OST37794 (lexicon)
OST33128 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24446
Vector Insertion
Chr 4: 43569259 - 43569492
Public Clones not available
Private Clones OST220267 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22822
Vector Insertion
Chr 4: 43568726 - 43568857
Public Clones not available
Private Clones OST283951 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6068
Vector Insertion
Chr 4: 43547451 - 43547638
Public Clones YHD140 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 85% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000102947
Sequence
GGGACGTTTCCAGGACGGAAGTGGCCGAGAGTGTGTCGAAGGGAGGGCGAGGCCGGAGCCCCAAAAGCGACCGGGAGAAGGAGCGGGTAGCGGGCCCAGG

GCGGGGCGCAGAGCCGGGCAGCGCAG - UNI15182 - - UNI16919 - GTATCGCCAGGCCGAAGAGCAGAAGCTGCCACCATGGTTGCGCTTTC

GCTGAAGATTAGCATTGGGAATGTGGTGAAGACGATGCAATTTGAGCCATCTACCATGGTGTACGACGCCTGCCGCATGATTCGTGAGCGGATCCCAGAG

GCCCTGGCTGGCCCTC - UNI15182 - - UNI16919 - - UNI24446 - CCAACGACTTTGGGCTCTTTCTGTCAGATGATGACCCCAAAAAA

GGCATCTGGCTAGAGGCTGGGAAAGCTTTGGACTACTACATGCTCCGAAATGGG - UNI22822 - GACACCATGGAGTACAGAAAAAAGCAGAGACC

CCTGAAGATCCGGATGTTAGACGGAACGGTGAAGACTATCATGGTGGATGACTCCAAGACCGTCACAGACATGCTCATGACCATTTGTGCCCGAATTG -

 UNI22822 - GTATCACCAACCATGATGAGTATTCACTGGTTCGAGAGCTGATGGAAGAAAAGAAAGATGAGGGGACAGGGACCCTGAGAAAAGACAA

GACCCTACTGCGAGATGAAAAGAAGATGGAGAAGCTAAAGCAGAAGTTGCACACAGACGATGAGT TGAACTGGCTGGACCATGGGCGGACACTGAGGGA

ACAGGGAGTGGAAGAGCATGAGACGTTGCTGCTGCGGAGAAAGTTCTTCTACTCAGACCAGAATGTGGATTCCCGAGACCCTGTACAGCTGAACCTTCTC

TATGTGCAG GCACGAGATGACATCCTGAATGGCTCCCATCCTGTCTCCTTTGACAAGGCCTGTGAATTTGCAGGCTTCCAGTGCCAGATCCAGTTTGGA

CCTCACAATGAACAGAAGCACAAGGCTGGCTTCCTTGA CCTGAAGGACTTCCTGCCCAAGGAGTATGTGAAGCAGAAGGGAGAGCGTAAGATCTTTCAG

 GCACACAAGAATTGTGGGCAGATGAGTGAAATTGAGGCCAAGGTACGCTACGTGAAGCTGGCCCGTTCCCTCAAGACTTACGGTGTCTCCTTCTTCCTA

GTCAAG GAAAAGATGAAGGGGAAGAATAAACTGGTGCCCAGGCTGTTGGGCATCACTAAGGAGTGTGTGATGCGTGTGGATGAGAAGACCAAGGAGGTG

ATTCAGGAATGGAGCCTCACCAACATCAAACGCTGGGCTGCCTCTCCCAAGAGCTTTACTCTG GACTTTGGAGACTATCAGGATGGCTACTACTCAGTA

CAGACGACAGAAGGCGAGCAGATCGCACAGCTCATTGCTGGCTACATAGATATCATCCTTAAGAAG ACTTCAGCCCAGCAGGCGCTCACTGGAACCATT

AACTCCAGCATGCAGGCTGTGCAGGCTGCCCAGGCCACTCTGGATGACTTTGAGACTCTACCCCCTCTTGGCCAGGATGCT GCCTCCAAAGCTTGGCGT

AAGAACAAGATGGATGAATCAAAGCATGAGATCCACTCCCAGGTAGATGCCATCACAGCTGGCACTGCCTCTGTGGTAAACCTGACAGCAG GAGATCCT

GCAGAGACAGACTATACAGCAGTGGGCTGTGCAGTCACCACCATCTCTTCCAACCTGACGGAGATGTCCCGTGGGGTGAAGCTATTGGCTGCCCTGCTGG

AGGATGAAGGCGGCAATGGCCGGCCCCTTCTGCAAGCAGCAAAGGGCCTTGCAGGGGCTGTGTCGGAACTGCTTCGCAGTGCTCAGCCCGCCAGCGCTGA

G CCCCGTCAGAACCTGCTGCAGGCAGCCGGGAACGTGGGCCAGGCCAGTGGGGAGCTGTTGCAGCAAATTGGGGAAAGTGACACTGACCCCCACTTCCA

G GATGTTCTAATGCAGCTAGCAAAG GCCCACGCCACCGGAGCTGGGCCTGCCGGTCGGTATGACCAAGCCACTGATACCATCCTCACCGTCACTGAAA

ACATCTTCAGCTCCATGGGTGATGCTG GGGAGATGGTGCGCCAGGCCCGCATCCTGGCCCAAGCCACCTCAGACCTGGTCAATGCTATCAAGGCCGATG

CTGAGGGGGAGAGTGATCTGGAGAACTCTAGAAAGCTCCTGAGTGCTGCCAAGATCCTCGCTGATGCCACCGCCAAGATGGTGGAGGCGGCCAAG GGAG

CAGCCGCCCACCCTGACAGTGAGGAACAGCAGCAGCGACTGCGTGAAGCAGCTGAGGGGCTTCGCATGGCCACCAATGCAGCTGCGCAGAACGCCATCAA

GAAGAAGTTGGTGCAGCGCCTGGAG CATGCAGCCAAGCAAGCTGCAGCCTCTGCAACACAGACCATTGCTGCAGCCCAACATGCAGCCTCTGCCCCCAA

GGCCTCTGCGGGCCCCCAGCCCCTACTGGTGCAGAGCTGTAAG GCCGTGGCAGAGCAGATTCCGTTGCTGGTGCAGGGTGTCCGAGGAAGTCAAGCTCA

GCCTGACAGCCCTAGTGCTCAGCTCGCCCTCATTGCTGCCAGCCAGAGCTTCCTGCAG CCAGGTGGGAAGATGGTGGCAGCGGCAAAAGCCTCAGTGCC

AACAATTCAGGACCAGGCTTCAGCAATGCAGCTGAGTCAGTGCGCAAAGAACCTAGGCACTGCCCTGGCCGAGCTGCGCACTGCTGCTCAGAAG GCTCA

GGAGGCATGTGGACCTTTGGAGATGGATTCTGCACTGAGTGTTGTACAAAATCTAGAGAAAGACCTACAGGAAATAAAAGCAGCAGCTCGAGATGGCAAG

CTTAAGCCCTTACCCGGGGAAACA ATGGAGAAGTGTACCCAAGATCTTGGCAACAGCACCAAAGCGGTGAGCTCTGCCATCGCCAAGCTGCTGGGGGAG

ATTGCCCAGGGCAATGAGAACTATGCAG GTATTGCAGCTCGGGATGTAGCTGGTGGACTAAGGTCACTAGCCCAGGCTGCGCGGGGTGTGGCTGCGCTG

ACATCAGATCCTGCAGTGCAGGCCATTGTGCTTGACACAGCCAGCGACGTTCTGGACAAGGCCAGCAGCCTCATTGAAGAGGCAAAAAAAGCATCTGGAC

ACCCAGGGGACCCAGAAAGCCAGCAAAGGCTTGCTCAG GTAGCTAAAGCAGTGACCCAAGCCCTGAACCGCTGTGTCAGCTGCCTGCCTGGCCAAAGAG

ACGTGGATAATGCCCTACGAGCCGTTGGAGATGCCAGCAAGCGACTCCTGAGTGACTCG CTTCCTCCAAGCACGGGGACATTTCAAGAAGCACAGAGCC

GATTGAATGAAGCTGCAGCTGGGTTAAATCAGGCCGCCACAGAACTGGTGCAAGCCTCCCGAGGAACTCCTCAGGACCTGGCTCGGGCCTCCGGCCGATT

TGGACAGGACTTCAGCACCTTCCTGGAAGCTGGTGTGGAGATGGCCGGACAGGCCCCG AGCCAGGAGGACCGAGCCCAGGTGGTGTCCAACCTGAAGGG

CATATCCATGTCTTCAAGCAAACTTCTCCTTGCCGCTAAGGCCTTGTCCACAGACCCTGCTTCTCCCAACCTCAAGAGTCAGCTGGCTGCGGCTGCCCG 

GGCAGTGACGGACAGCATCAACCAGCTCATCACCATGTGCACCCAGCAGGCACCTGGCCAGAAGGAGTGTGACAATGCACTTCGGCAGCTAGAG ACAGT

CCGAGAACTCCTGGAGAATCCAGTCCAGCCCATCAACGACATGTCCTACTTCGGTTGCTTGGACAGTGTCATGGAGAACTCCAAG GTCCTAGGTGAGGC

CATGACTGGCATCTCCCAAAATGCCAAGAATGGAAATCTGCCGGAGTTTGGAGATGCCATTGCCACAGCCTCCAAGGCTCTCTGTGGCTTCACGGAGGCA

GCCGCACAG GCAGCATATCTAGTTGGTGTCTCTGACCCCAACAGCCAAGCTGGACAGCAAGGACTGGTGGAACCCACACAGTTTGCCCGTGCAAACCAG

GCAATTCAGATGGCCTGTCAGAGTCTGGGGGAGCCTGGCTGTACCCAGGCCCAG GTGTTATCTGCAGCCACTATTGTAGCCAAACACACATCTGCATTG

TGTAACAGCTGTCGCCTGGCTTCCGCTAGGACTGCCAATCCCACTGCCAAGCGCCAGTTTGTACAGTCAGCCAAGGAGGTGGCCAACAGTACAGCCAATC

TTGTCAAGACCATCAAG GCACTAGATGGGGACTTCACAGAAGAGAACCGTGCCCAGTGCCGAGCAGCCACAGCCCCTCTGCTGGAAGCTGTGGATAACC

TGAGTGCCTTTGCCTCCAACCCTGAGTTCTCCAGCGTCCCTGCCCAGATCAGCCCTGAG GGCAGAGCAGCCATGGAGCCCATTGTAATCTCTGCTAAGA

CAATGTTGGAGAGTGCTGGAGGGCTCATCCAGACAGCTCGGGCGTTAGCAGTCAATCCCCGAGACCCCCCACGTTGGTCTGTGCTAGCTGGCCACTCTCG

GACTGTCTCAGATTCCATCAAGAAACTTATTACAAGCATGAG GGACAAAGCCCCAGGGCAGCTGGAGTGTGAGACAGCCATTGCGGCTCTGAACAGCTG

CTTGCGGGACCTAGATCAGGCTTCGCTTGCCGCTGTCAGCCAGCAGCTTGCTCCCCGTGAAGGAATCTCTCAAGAG GCTTTGCACACCCAGATGCTCAC

TGCAGTGCAAGAAATTTCTCATCTCATTGAGCCGCTGGCCAGCGCTGCTCGGGCTGAAGCCTCCCAGCTGGGACACAAG GTGTCCCAAATGGCCCAGTA

CTTTGAACCACTCACCCTGGCTGCAGTGGGTGCTGCGTCTAAGACCCTGAGCCACCCACAGCAGATGGCACTTCTGGACCAGACTAAAACGTTGGCAGAG

TCTGCCTTGCAGTTGCTATATACTGCCAAGGAGGCTGGTGGTAACCCCAAG CAAGCAGCACACACCCAGGAAGCCCTGGAGGAGGCTGTGCAGATGATG

ACAGAGGCCGTAGAAGACCTGACGACGACCCTCAACGAAGCAGCCAGTGCTGCAGGAGTCGTTGGCGGCATGGTGGACTCTATCACTCAGGCCATCAACC

AG CTAGATGAAGGACCTATGGGTGACCCAGAAGGCTCATTCGTAGATTACCAGACAACCATGGTGAGGACAGCCAAGGCCATTGCTGTCACTGTTCAGG

AGATG GTAACCAAGTCAAACACCAGCCCTGAAGAGCTAGGCCCTCTTGCCAACCAGCTGACCAGTGACTATGGCCGACTGGCCTCACAAGCCAAGCCTG

CAGCTGTGGCTGCTGAAAATGAAGAG ATAGGCGCTCACATCAAACACCGAGTACAGGAGCTGGGCCATGGCTGCTCTGCTCTGGTCACCAAGGCAGGTG

CCTTGCAGTGTAGCCCCAGTGATGTCTACACCAAGAAGGAGCTCATAGAGTGTGCCCGCAGAGTGTCAGAGAAG GTCTCCCATGTTCTGGCTGCACTCC

AGGCTGGGAATCGTGGTACCCAGGCCTGCATTACAGCAGCCAGTGCTGTGTCTGGTATCATTGCTGACCTCGACACCACCATCATGTTCGCTACTGCTGG

CACACTTAACCGTGAGGGTGCTGAAACTTTTGCTGACCACCG GGAGGGTATCTTAAAGACAGCAAAGGTTCTTGTGGAGGACACCAAGGTCCTAGTGCA

GAATGCAGCTGGGAGCCAGGAGAAGTTGGCACAAGCCGCCCAGTCCTCCGTGGCCACCATTACCCGCCTCGCTGATGTGGTCAAGCTCGGTGCAGCCAGC

CTAGGAGCCGAAGACCCTGAAACTCAG GTGGTGCTGATCAATGCAGTAAAGGACGTAGCCAAGGCCCTGGGTGACCTCATCAGCGCTACGAAGGCTGCA

GCGGGCAAAGTTGGGGATGACCCTGCAGTGTGGCAGCTCAAGAACTCTGCCAAG GTGATGGTGACCAATGTGACATCATTGCTCAAGACAGTGAAGGCT

GTGGAAGATGAGGCCACCAAAGGCACACGGGCCCTAGAGGCAACCACAGAGCACATACGTCAGGAACTGGCG - UNI6068 - GTCTTCTGTTCCCCA

GAGCCACCTGCCAAGACCTCTACCCCTGAAGACTTCATCCGAATGACCAAGGGTATTACTATGGCAACAGCCAAAGCCGTTGCTGCTGGCAATTCCTGTC

GACAGGAAGATGTCATTGCCACAGCCAATCTGAGCCGACGGGCTATTGCGGACATGCTTCGGGCTTGCAAG - UNI6068 - GAAGCAGCTTTCCACC

CAGAAGTGGCGCCTGATGTACGGCTCCGAGCCCTGCACTATGGCCGGGAGTGTGCCAATGGTTACCTGGAACTGCTGGACCACGTGCTGCTG ACCCTTC

AGAAGCCAAACCCAGACCTGAAGCAGCAGCTAACTGGACACTCAAAGCGGGTTGCTGGCTCTGTGACTGAGCTCATCCAGGCTGCTGAAGCCATGAAAG 

GAACAGAGTGGGTGGACCCAGAGGACCCTACTGTCATTGCTGAGAATGAACTCTTGGGAGCCGCAGCCGCCATCGAGGCTGCAGCCAAGAAGCTGGAGCA

GCTGAAGCCCAGGGCCAAACCCAAG GAGGCGGATGAGTCCTTGAACTTTGAGGAACAAATCCTAGAAGCTGCCAAGTCCATCGCTGCAGCCACCAGTGC

ACTGGTAAAGGCTGCGTCAGCAGCCCAGAGGGAGCTGGTGGCTCAAGGAAAG GTGGGCGCCATTCCAGCCAATGCACTGGATGATGGGCAGTGGTCGCA

GGGCCTCATTTCCGCT GCCCGTATGGTGGCTGCGGCCACCAACAATCTGTGTGAAGCAGCTAACGCAGCTGTCCAGGGCCATGCTAGCCAGGAGAAACT

CATTTCCTCAGCCAAGCAAGTAGCTGCCTCCACAGCTCAGCTCCTGGTAGCTTGCAAGGTCAAAGCAGATCAGGACTCTGAGGCAATGAAACGGCTCCAG

 GCTGCTGGCAATGCAGTGAAGAGGGCCTCAGATAACCTGGTAAAGGCGGCCCAGAAAGCTGCAGCCTTCGAAGACCAGGAGAATGAGACGGTGGTGGTG

AAGGAGAAAATGGTTGGGGGCATTGCCCAG ATTATCGCAGCACAGGAAGAGATGCTTCGGAAGGAACGAGAGCTGGAAGAGGCTCGGAAAAAGCTCGCC

CAGATCCGGCAGCAGCAGTACAAGTTCTTGCCTTCAGAGCTTCGAGACGAGCACTAAAAAAGCCCTGTGTATTTAATGCAGACCCAGCCCAGAGACTGTG

CCTGCCACTACCAAAGCCTTCTGGGCTGCTCAGGACCCAAGCTGCCCAACCCCAGCACTCCCCCAAAGTGCCTGCCAAACCCTGGGCCTGGCCCTGCCCA

GTCCCACTGCAAGCCGTGTCCTCTCCCTGACTCCCAAGTGCCTTTGCACCCTAGGGCCCCTAAGTGCCTGCCCCCCTCCAGAGTATTAACGCTCCAAGAG

TATTATTAATGCTGCCGTACCTCAGTTTGAACCTGCCAGGGCCCCAGCTGCTCCAGCCTGCCAGCAGCTTCCAGCCAGTCCCCACGGCCACGTCAGCTCA

ACTCATCCCTTTTTGATACTATATCCCCTACCCAGCTACCTATGGGGCTTGAGGGTTGTAAACCCAAACAGGTCAGACTCCAATAAAGGTGATTCT
Translation
 - UNI15182 - - UNI16919 -  - UNI15182 - - UNI16919 - - UNI24446 -  - UNI22822 -  - UNI22822 -      

MRVDEKTKEVIQEWSLTNIKRWAASPKSFTL DFGDYQDGYYSVQTTEGEQIAQLIAGYIDIILKK TSAQQALTGTINSSMQAVQAAQATLDDFETLPP

LGQDA ASKAWRKNKMDESKHEIHSQVDAITAGTASVVNLTAG GDPAETDYTAVGCAVTTISSNLTEMSRGVKLLAALLEDEGGNGRPLLQAAKGLAGA

VSELLRSAQPASAE PRQNLLQAAGNVGQASGELLQQIGESDTDPHFQ DVLMQLAK AHATGAGPAGRYDQATDTILTVTENIFSSMGDAG GEMVRQA

RILAQATSDLVNAIKADAEGESDLE                             - UNI6068 -  - UNI6068 -        
Transcript ENSMUST00000107901
Sequence
ACGGCTGTCACCCAGGCCCTCAATGAGCTGCTGCAGCACGTGAAGGCCCACGCCACCGGAGCTGGGCCTGCCGGTCGGTATGACCAAGCCACTGATACCA

TCCTCACCGTCACTGAAAACATCTTCAGCTCCATGGGTGATGCTG GGGAGATGGTGCGCCAGGCCCGCATCCTGGCCCAAGCCACCTCAGACCTGGTCA

ATGCTATCAAG GCCTCTGCGGGCCCCCAGCCCCTACTGGTGCAGAGCTGTAAG GCCGTGGCAGAGCAGATTCCGTTGCTGGTGCAGGGTGTCCGAGGA

AGTCAAGCTCAGCCTGACAGCCCTAGTGCTCAGCTCGCCCTCATTGCTGCCAGCCAGAGCTTCCTGCAG CCAGGTGGGAAGATGGTGGCAGCGGCAAAA

GCCTCAGTGCCAACAATTCAGGACCAGGCTTCAGCAATGCAGCTGAGTCAGTGCGCAAAGAACCTAGGCACTGCCCTGGCCGAGCTGCGCACTGCTGCTC

AGAAG GCTCAGGAGGCATGTGGACCTTTGGAGATGGATTCTGCACTGAGTGTTGTACAAAATCTAGAGAAAGACCTACAGGAAATAAAAGCAGCAGCTC

GAGATGGCAAGCTTAAGCCCTTACCCGGGGAAACA ATGGAGAAGTGTACCCAAGATCTTGGCAACAGCACCAAAGCGGTGAGCTCTGCCATCGCCAAGC

TGCTGGGGGAGATTGCCCAGGGCAATGAGAACTATGCAG GTATTGCAGCTCGGGATGTAGCTGGTGGACTAAGGTCACTAGCCCAGGCTGCGCGGGGTG

TGGCTGCGCTGACATCAGATCCTGCAGTGCAGGCCATTGTGCTTGACACAGCCAGCGACGTTCTGGACAAGGCCAGCAGCCTCATTGAAGAGGCAAAAAA

AGCATCTGGACACCCAGGGGACCCAG
Translation
TAVTQALNELLQHVKAHATGAGPAGRYDQATDTILTVTENIFSSMGDAG GEMVRQARILAQATSDLVNAIK ASAGPQPLLVQSCK AVAEQIPLLVQG

VRGSQAQPDSPSAQLALIAASQSFL    
Transcript ENSMUST00000030187
Sequence
GGGACGTTTCCAGGACGGAAGTGGCCGAGAGTGTGTCGAAGGGAGGGCGAGGCCGGAGCCCCAAAAGCGACCGGGAGAAGGAGCGGGTAGCGGGCCCAGG

GCGGGGCGCAGAGCCGGGCAGCGCAG - UNI15182 - - UNI16919 - GTATCGCCAGGCCGAAGAGCAGAAGCTGCCACCATGGTTGCGCTTTC

GCTGAAGATTAGCATTGGGAATGTGGTGAAGACGATGCAATTTGAGCCATCTACCATGGTGTACGACGCCTGCCGCATGATTCGTGAGCGGATCCCAGAG

GCCCTGGCTGGCCCTC - UNI15182 - - UNI16919 - - UNI24446 - CCAACGACTTTGGGCTCTTTCTGTCAGATGATGACCCCAAAAAA

GGCATCTGGCTAGAGGCTGGGAAAGCTTTGGACTACTACATGCTCCGAAATGGG - UNI22822 - GACACCATGGAGTACAGAAAAAAGCAGAGACC

CCTGAAGATCCGGATGTTAGACGGAACGGTGAAGACTATCATGGTGGATGACTCCAAGACCGTCACAGACATGCTCATGACCATTTGTGCCCGAATTG -

 UNI22822 - GTATCACCAACCATGATGAGTATTCACTGGTTCGAGAGCTGATGGAAGAAAAGAAAGATGAGGGGACAGGGACCCTGAGAAAAGACAA

GACCCTACTGCGAGATGAAAAGAAGATGGAGAAGCTAAAGCAGAAGTTGCACACAGACGATGAGT TGAACTGGCTGGACCATGGGCGGACACTGAGGGA

ACAGGGAGTGGAAGAGCATGAGACGTTGCTGCTGCGGAGAAAGTTCTTCTACTCAGACCAGAATGTGGATTCCCGAGACCCTGTACAGCTGAACCTTCTC

TATGTGCAG GCACGAGATGACATCCTGAATGGCTCCCATCCTGTCTCCTTTGACAAGGCCTGTGAATTTGCAGGCTTCCAGTGCCAGATCCAGTTTGGA

CCTCACAATGAACAGAAGCACAAGGCTGGCTTCCTTGA CCTGAAGGACTTCCTGCCCAAGGAGTATGTGAAGCAGAAGGGAGAGCGTAAGATCTTTCAG

 GCACACAAGAATTGTGGGCAGATGAGTGAAATTGAGGCCAAGGTACGCTACGTGAAGCTGGCCCGTTCCCTCAAGACTTACGGTGTCTCCTTCTTCCTA

GTCAAG GAAAAGATGAAGGGGAAGAATAAACTGGTGCCCAGGCTGTTGGGCATCACTAAGGAGTGTGTGATGCGTGTGGATGAGAAGACCAAGGAGGTG

ATTCAGGAATGGAGCCTCACCAACATCAAACGCTGGGCTGCCTCTCCCAAGAGCTTTACTCTG GACTTTGGAGACTATCAGGATGGCTACTACTCAGTA

CAGACGACAGAAGGCGAGCAGATCGCACAGCTCATTGCTGGCTACATAGATATCATCCTTAAGAAG AAAAAAAGCAAGGACCATTTTGGGCTGGAGGGA

GATGAAGAGTCTACTATGTTGGAGGACTCAGTGTCACCCAAAAA GTCAACAGTCCTTCAGCAGCAGTACAACCGAGTGGGGAAAGTGGAGCACGGCTCT

GTGGCTCTGCCAGCCATCATGCGCTCTGGAGCCTCTGGTCCTGAGAATTTCCAGGTGGGGAGCATGCCACCTGCCCAGCAGCAGATCACCAGTGGCCAGA

TGCACCGAGGACACATGCCACCTCTG ACTTCAGCCCAGCAGGCGCTCACTGGAACCATTAACTCCAGCATGCAGGCTGTGCAGGCTGCCCAGGCCACTC

TGGATGACTTTGAGACTCTACCCCCTCTTGGCCAGGATGCT GCCTCCAAAGCTTGGCGTAAGAACAAGATGGATGAATCAAAGCATGAGATCCACTCCC

AGGTAGATGCCATCACAGCTGGCACTGCCTCTGTGGTAAACCTGACAGCAG GAGATCCTGCAGAGACAGACTATACAGCAGTGGGCTGTGCAGTCACCA

CCATCTCTTCCAACCTGACGGAGATGTCCCGTGGGGTGAAGCTATTGGCTGCCCTGCTGGAGGATGAAGGCGGCAATGGCCGGCCCCTTCTGCAAGCAGC

AAAGGGCCTTGCAGGGGCTGTGTCGGAACTGCTTCGCAGTGCTCAGCCCGCCAGCGCTGAG CCCCGTCAGAACCTGCTGCAGGCAGCCGGGAACGTGGG

CCAGGCCAGTGGGGAGCTGTTGCAGCAAATTGGGGAAAGTGACACTGACCCCCACTTCCAG GATGTTCTAATGCAGCTAGCAAAGGCAGTGGCAAGTGC

TGCAGCCGCCCTGGTCCTCAAGGCCAAGAGTGTGGCCCAGCGCACAGAGGATTCCGGGCTTCAGACCCAAGTGATTGCTGCAGCTACGCAATGTGCTCTG

TCCACTTCCCAGCTGGTGGCCTGTACCAAG GTGGTAGCACCTACAATCAGCTCACCTGTGTGCCAAGAACAGCTAGTCGAGGCTGGGCGACTGGTGGCC

AAAGCTGTGGAGGGCTGTGTGTCTGCCTCGCAAGCAGCTACAGAAGATGGACAGCTGCTTCGAGGGGTAGGAGCAGCAGCCACGGCTGTCACCCAGGCCC

TCAATGAGCTGCTGCAGCACGTGAAGGCCCACGCCACCGGAGCTGGGCCTGCCGGTCGGTATGACCAAGCCACTGATACCATCCTCACCGTCACTGAAAA

CATCTTCAGCTCCATGGGTGATGCTG GGGAGATGGTGCGCCAGGCCCGCATCCTGGCCCAAGCCACCTCAGACCTGGTCAATGCTATCAAGGCCGATGC

TGAGGGGGAGAGTGATCTGGAGAACTCTAGAAAGCTCCTGAGTGCTGCCAAGATCCTCGCTGATGCCACCGCCAAGATGGTGGAGGCGGCCAAG GGAGC

AGCCGCCCACCCTGACAGTGAGGAACAGCAGCAGCGACTGCGTGAAGCAGCTGAGGGGCTTCGCATGGCCACCAATGCAGCTGCGCAGAACGCCATCAAG

AAGAAGTTGGTGCAGCGCCTGGAG CATGCAGCCAAGCAAGCTGCAGCCTCTGCAACACAGACCATTGCTGCAGCCCAACATGCAGCCTCTGCCCCCAAG

GCCTCTGCGGGCCCCCAGCCCCTACTGGTGCAGAGCTGTAAG GCCGTGGCAGAGCAGATTCCGTTGCTGGTGCAGGGTGTCCGAGGAAGTCAAGCTCAG

CCTGACAGCCCTAGTGCTCAGCTCGCCCTCATTGCTGCCAGCCAGAGCTTCCTGCAG CCAGGTGGGAAGATGGTGGCAGCGGCAAAAGCCTCAGTGCCA

ACAATTCAGGACCAGGCTTCAGCAATGCAGCTGAGTCAGTGCGCAAAGAACCTAGGCACTGCCCTGGCCGAGCTGCGCACTGCTGCTCAGAAG GCTCAG

GAGGCATGTGGACCTTTGGAGATGGATTCTGCACTGAGTGTTGTACAAAATCTAGAGAAAGACCTACAGGAAATAAAAGCAGCAGCTCGAGATGGCAAGC

TTAAGCCCTTACCCGGGGAAACA ATGGAGAAGTGTACCCAAGATCTTGGCAACAGCACCAAAGCGGTGAGCTCTGCCATCGCCAAGCTGCTGGGGGAGA

TTGCCCAGGGCAATGAGAACTATGCAG GTATTGCAGCTCGGGATGTAGCTGGTGGACTAAGGTCACTAGCCCAGGCTGCGCGGGGTGTGGCTGCGCTGA

CATCAGATCCTGCAGTGCAGGCCATTGTGCTTGACACAGCCAGCGACGTTCTGGACAAGGCCAGCAGCCTCATTGAAGAGGCAAAAAAAGCATCTGGACA

CCCAGGGGACCCAGAAAGCCAGCAAAGGCTTGCTCAG GTAGCTAAAGCAGTGACCCAAGCCCTGAACCGCTGTGTCAGCTGCCTGCCTGGCCAAAGAGA

CGTGGATAATGCCCTACGAGCCGTTGGAGATGCCAGCAAGCGACTCCTGAGTGACTCG CTTCCTCCAAGCACGGGGACATTTCAAGAAGCACAGAGCCG

ATTGAATGAAGCTGCAGCTGGGTTAAATCAGGCCGCCACAGAACTGGTGCAAGCCTCCCGAGGAACTCCTCAGGACCTGGCTCGGGCCTCCGGCCGATTT

GGACAGGACTTCAGCACCTTCCTGGAAGCTGGTGTGGAGATGGCCGGACAGGCCCCG AGCCAGGAGGACCGAGCCCAGGTGGTGTCCAACCTGAAGGGC

ATATCCATGTCTTCAAGCAAACTTCTCCTTGCCGCTAAGGCCTTGTCCACAGACCCTGCTTCTCCCAACCTCAAGAGTCAGCTGGCTGCGGCTGCCCG G

GCAGTGACGGACAGCATCAACCAGCTCATCACCATGTGCACCCAGCAGGCACCTGGCCAGAAGGAGTGTGACAATGCACTTCGGCAGCTAGAG ACAGTC

CGAGAACTCCTGGAGAATCCAGTCCAGCCCATCAACGACATGTCCTACTTCGGTTGCTTGGACAGTGTCATGGAGAACTCCAAG GTCCTAGGTGAGGCC

ATGACTGGCATCTCCCAAAATGCCAAGAATGGAAATCTGCCGGAGTTTGGAGATGCCATTGCCACAGCCTCCAAGGCTCTCTGTGGCTTCACGGAGGCAG

CCGCACAG GCAGCATATCTAGTTGGTGTCTCTGACCCCAACAGCCAAGCTGGACAGCAAGGACTGGTGGAACCCACACAGTTTGCCCGTGCAAACCAGG

CAATTCAGATGGCCTGTCAGAGTCTGGGGGAGCCTGGCTGTACCCAGGCCCAG GTGTTATCTGCAGCCACTATTGTAGCCAAACACACATCTGCATTGT

GTAACAGCTGTCGCCTGGCTTCCGCTAGGACTGCCAATCCCACTGCCAAGCGCCAGTTTGTACAGTCAGCCAAGGAGGTGGCCAACAGTACAGCCAATCT

TGTCAAGACCATCAAG GCACTAGATGGGGACTTCACAGAAGAGAACCGTGCCCAGTGCCGAGCAGCCACAGCCCCTCTGCTGGAAGCTGTGGATAACCT

GAGTGCCTTTGCCTCCAACCCTGAGTTCTCCAGCGTCCCTGCCCAGATCAGCCCTGAG GGCAGAGCAGCCATGGAGCCCATTGTAATCTCTGCTAAGAC

AATGTTGGAGAGTGCTGGAGGGCTCATCCAGACAGCTCGGGCGTTAGCAGTCAATCCCCGAGACCCCCCACGTTGGTCTGTGCTAGCTGGCCACTCTCGG

ACTGTCTCAGATTCCATCAAGAAACTTATTACAAGCATGAG GGACAAAGCCCCAGGGCAGCTGGAGTGTGAGACAGCCATTGCGGCTCTGAACAGCTGC

TTGCGGGACCTAGATCAGGCTTCGCTTGCCGCTGTCAGCCAGCAGCTTGCTCCCCGTGAAGGAATCTCTCAAGAG GCTTTGCACACCCAGATGCTCACT

GCAGTGCAAGAAATTTCTCATCTCATTGAGCCGCTGGCCAGCGCTGCTCGGGCTGAAGCCTCCCAGCTGGGACACAAG GTGTCCCAAATGGCCCAGTAC

TTTGAACCACTCACCCTGGCTGCAGTGGGTGCTGCGTCTAAGACCCTGAGCCACCCACAGCAGATGGCACTTCTGGACCAGACTAAAACGTTGGCAGAGT

CTGCCTTGCAGTTGCTATATACTGCCAAGGAGGCTGGTGGTAACCCCAAG CAAGCAGCACACACCCAGGAAGCCCTGGAGGAGGCTGTGCAGATGATGA

CAGAGGCCGTAGAAGACCTGACGACGACCCTCAACGAAGCAGCCAGTGCTGCAGGAGTCGTTGGCGGCATGGTGGACTCTATCACTCAGGCCATCAACCA

G CTAGATGAAGGACCTATGGGTGACCCAGAAGGCTCATTCGTAGATTACCAGACAACCATGGTGAGGACAGCCAAGGCCATTGCTGTCACTGTTCAGGA

GATG GTAACCAAGTCAAACACCAGCCCTGAAGAGCTAGGCCCTCTTGCCAACCAGCTGACCAGTGACTATGGCCGACTGGCCTCACAAGCCAAGCCTGC

AGCTGTGGCTGCTGAAAATGAAGAG ATAGGCGCTCACATCAAACACCGAGTACAGGAGCTGGGCCATGGCTGCTCTGCTCTGGTCACCAAGGCAGGTGC

CTTGCAGTGTAGCCCCAGTGATGTCTACACCAAGAAGGAGCTCATAGAGTGTGCCCGCAGAGTGTCAGAGAAG GTCTCCCATGTTCTGGCTGCACTCCA

GGCTGGGAATCGTGGTACCCAGGCCTGCATTACAGCAGCCAGTGCTGTGTCTGGTATCATTGCTGACCTCGACACCACCATCATGTTCGCTACTGCTGGC

ACACTTAACCGTGAGGGTGCTGAAACTTTTGCTGACCACCG GGAGGGTATCTTAAAGACAGCAAAGGTTCTTGTGGAGGACACCAAGGTCCTAGTGCAG

AATGCAGCTGGGAGCCAGGAGAAGTTGGCACAAGCCGCCCAGTCCTCCGTGGCCACCATTACCCGCCTCGCTGATGTGGTCAAGCTCGGTGCAGCCAGCC

TAGGAGCCGAAGACCCTGAAACTCAG GTGGTGCTGATCAATGCAGTAAAGGACGTAGCCAAGGCCCTGGGTGACCTCATCAGCGCTACGAAGGCTGCAG

CGGGCAAAGTTGGGGATGACCCTGCAGTGTGGCAGCTCAAGAACTCTGCCAAG GTGATGGTGACCAATGTGACATCATTGCTCAAGACAGTGAAGGCTG

TGGAAGATGAGGCCACCAAAGGCACACGGGCCCTAGAGGCAACCACAGAGCACATACGTCAGGAACTGGCG - UNI6068 - GTCTTCTGTTCCCCAG

AGCCACCTGCCAAGACCTCTACCCCTGAAGACTTCATCCGAATGACCAAGGGTATTACTATGGCAACAGCCAAAGCCGTTGCTGCTGGCAATTCCTGTCG

ACAGGAAGATGTCATTGCCACAGCCAATCTGAGCCGACGGGCTATTGCGGACATGCTTCGGGCTTGCAAG - UNI6068 - GAAGCAGCTTTCCACCC

AGAAGTGGCGCCTGATGTACGGCTCCGAGCCCTGCACTATGGCCGGGAGTGTGCCAATGGTTACCTGGAACTGCTGGACCACGTGCTGCTG ACCCTTCA

GAAGCCAAACCCAGACCTGAAGCAGCAGCTAACTGGACACTCAAAGCGGGTTGCTGGCTCTGTGACTGAGCTCATCCAGGCTGCTGAAGCCATGAAAG G

AACAGAGTGGGTGGACCCAGAGGACCCTACTGTCATTGCTGAGAATGAACTCTTGGGAGCCGCAGCCGCCATCGAGGCTGCAGCCAAGAAGCTGGAGCAG

CTGAAGCCCAGGGCCAAACCCAAG GAGGCGGATGAGTCCTTGAACTTTGAGGAACAAATCCTAGAAGCTGCCAAGTCCATCGCTGCAGCCACCAGTGCA

CTGGTAAAGGCTGCGTCAGCAGCCCAGAGGGAGCTGGTGGCTCAAGGAAAG GTGGGCGCCATTCCAGCCAATGCACTGGATGATGGGCAGTGGTCGCAG

GGCCTCATTTCCGCT GCCCGTATGGTGGCTGCGGCCACCAACAATCTGTGTGAAGCAGCTAACGCAGCTGTCCAGGGCCATGCTAGCCAGGAGAAACTC

ATTTCCTCAGCCAAGCAAGTAGCTGCCTCCACAGCTCAGCTCCTGGTAGCTTGCAAGGTCAAAGCAGATCAGGACTCTGAGGCAATGAAACGGCTCCAG 

GCTGCTGGCAATGCAGTGAAGAGGGCCTCAGATAACCTGGTAAAGGCGGCCCAGAAAGCTGCAGCCTTCGAAGACCAGGAGAATGAGACGGTGGTGGTGA

AGGAGAAAATGGTTGGGGGCATTGCCCAG ATTATCGCAGCACAGGAAGAGATGCTTCGGAAGGAACGAGAGCTGGAAGAGGCTCGGAAAAAGCTCGCCC

AGATCCGGCAGCAGCAGTACAAGTTCTTGCCTTCAGAGCTTCGAGACGAGCACTAAAAAAGCCCTGTGTATTTAATGCAGACCCAGCCCAGAGACTGTGC

CTGCCACTACCAAAGCCTTCTGGGCTGCTCAGGACCCAAGCTGCCCAACCCCAGCACTCCCCCAAAGTGCCTGCCAAACCCTGGGCCTGGCCCTGCCCAG

TCCCACTGCAAGCCGTGTCCTCTCCCTGACTCCCAAGTGCCTTTGCACCCTAGGGCCCCTAAGTGCCTGCCCCCCTCCAGAGTATTAACGCTCCAAGAGT

ATTATTAATGCTGCCGTACCTCAGTTTGAACCTGCCAGGGCCCCAGCTGCTCCAGCCTGCCAGCAGCTTCCAGCCAGTCCCCACGGCCACGTCAGCTCAA

CTCATCCCTTTTTGATACTATATCCCCTACCCAGCTACCTATGGGGCTTGAGGGTTGTAAACCCAAACAGGTCAGACTCCAATAAAGGTGATTCT
Translation
 - UNI15182 - - UNI16919 - MVALSLKISIGNVVKTMQFEPSTMVYDACRMIRERIPEALAGPP - UNI15182 - - UNI16919 - - 

UNI24446 - PNDFGLFLSDDDPKKGIWLEAGKALDYYMLRNG - UNI22822 - DTMEYRKKQRPLKIRMLDGTVKTIMVDDSKTVTDMLMTICAR

IG - UNI22822 - GITNHDEYSLVRELMEEKKDEGTGTLRKDKTLLRDEKKMEKLKQKLHTDDEL LNWLDHGRTLREQGVEEHETLLLRRKFFYSD

QNVDSRDPVQLNLLYVQ ARDDILNGSHPVSFDKACEFAGFQCQIQFGPHNEQKHKAGFLD DLKDFLPKEYVKQKGERKIFQ AHKNCGQMSEIEAKVR

YVKLARSLKTYGVSFFLVK EKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTL DFGDYQDGYYSVQTTEGEQIAQLIAGY

IDIILKK KKSKDHFGLEGDEESTMLEDSVSPKK KSTVLQQQYNRVGKVEHGSVALPAIMRSGASGPENFQVGSMPPAQQQITSGQMHRGHMPPL TSA

QQALTGTINSSMQAVQAAQATLDDFETLPPLGQDA ASKAWRKNKMDESKHEIHSQVDAITAGTASVVNLTAG GDPAETDYTAVGCAVTTISSNLTEMS

RGVKLLAALLEDEGGNGRPLLQAAKGLAGAVSELLRSAQPASAE PRQNLLQAAGNVGQASGELLQQIGESDTDPHFQ DVLMQLAKAVASAAAALVLKA

KSVAQRTEDSGLQTQVIAAATQCALSTSQLVACTK VVAPTISSPVCQEQLVEAGRLVAKAVEGCVSASQAATEDGQLLRGVGAAATAVTQALNELLQHV

KAHATGAGPAGRYDQATDTILTVTENIFSSMGDAG GEMVRQARILAQATSDLVNAIKADAEGESDLENSRKLLSAAKILADATAKMVEAAK GAAAHPD

SEEQQQRLREAAEGLRMATNAAAQNAIKKKLVQRLE HAAKQAAASATQTIAAAQHAASAPKASAGPQPLLVQSCK AVAEQIPLLVQGVRGSQAQPDSP

SAQLALIAASQSFLQ PGGKMVAAAKASVPTIQDQASAMQLSQCAKNLGTALAELRTAAQK AQEACGPLEMDSALSVVQNLEKDLQEIKAAARDGKLKP

LPGET MEKCTQDLGNSTKAVSSAIAKLLGEIAQGNENYAG GIAARDVAGGLRSLAQAARGVAALTSDPAVQAIVLDTASDVLDKASSLIEEAKKASGH

PGDPESQQRLAQ VAKAVTQALNRCVSCLPGQRDVDNALRAVGDASKRLLSDS LPPSTGTFQEAQSRLNEAAAGLNQAATELVQASRGTPQDLARASGR

FGQDFSTFLEAGVEMAGQAP SQEDRAQVVSNLKGISMSSSKLLLAAKALSTDPASPNLKSQLAAAAR RAVTDSINQLITMCTQQAPGQKECDNALRQL

E TVRELLENPVQPINDMSYFGCLDSVMENSK VLGEAMTGISQNAKNGNLPEFGDAIATASKALCGFTEAAAQ AAYLVGVSDPNSQAGQQGLVEPTQF

ARANQAIQMACQSLGEPGCTQAQ VLSAATIVAKHTSALCNSCRLASARTANPTAKRQFVQSAKEVANSTANLVKTIK ALDGDFTEENRAQCRAATAPL

LEAVDNLSAFASNPEFSSVPAQISPE GRAAMEPIVISAKTMLESAGGLIQTARALAVNPRDPPRWSVLAGHSRTVSDSIKKLITSMR RDKAPGQLECE

TAIAALNSCLRDLDQASLAAVSQQLAPREGISQE ALHTQMLTAVQEISHLIEPLASAARAEASQLGHK VSQMAQYFEPLTLAAVGAASKTLSHPQQMA

LLDQTKTLAESALQLLYTAKEAGGNPK QAAHTQEALEEAVQMMTEAVEDLTTTLNEAASAAGVVGGMVDSITQAINQ LDEGPMGDPEGSFVDYQTTMV

RTAKAIAVTVQEM VTKSNTSPEELGPLANQLTSDYGRLASQAKPAAVAAENEE IGAHIKHRVQELGHGCSALVTKAGALQCSPSDVYTKKELIECARR

VSEK VSHVLAALQAGNRGTQACITAASAVSGIIADLDTTIMFATAGTLNREGAETFADHR REGILKTAKVLVEDTKVLVQNAAGSQEKLAQAAQSSVA

TITRLADVVKLGAASLGAEDPETQ VVLINAVKDVAKALGDLISATKAAAGKVGDDPAVWQLKNSAK VMVTNVTSLLKTVKAVEDEATKGTRALEATTE

HIRQELA - UNI6068 - VFCSPEPPAKTSTPEDFIRMTKGITMATAKAVAAGNSCRQEDVIATANLSRRAIADMLRACK - UNI6068 - EAAFH

PEVAPDVRLRALHYGRECANGYLELLDHVLL TLQKPNPDLKQQLTGHSKRVAGSVTELIQAAEAMKG GTEWVDPEDPTVIAENELLGAAAAIEAAAKK

LEQLKPRAKPK EADESLNFEEQILEAAKSIAAATSALVKAASAAQRELVAQGK VGAIPANALDDGQWSQGLISA ARMVAAATNNLCEAANAAVQGHA

SQEKLISSAKQVAASTAQLLVACKVKADQDSEAMKRLQ AAGNAVKRASDNLVKAAQKAAAFEDQENETVVVKEKMVGGIAQ IIAAQEEMLRKERELEE

ARKKLAQIRQQQYKFLPSELRDEH

For any suggestions or comments, please send an email to unitrap@crg.es