Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000028546 (Elavl4)
Chromosomal location
Chr 4: 109876327 - 110024419 (-)
Description
ELAV (embryonic lethal, abnormal vision, Drosophila)-like 4 (Hu antigen D) Gene [Source:MGI (curated);Acc:Elavl4-001]
RefSeq_dna
NM_010488 NM_001038698 
RefSeq_peptide
NP_034618.2 NP_001033787.1 
MGI
MGI:107427 
Uniprot/SWISSPROT
Q61701 
Uniprot/SPTREMBL
A2A9S1 A2A9R4 A2A9R5 A2A9R6 Q9CXQ0 A2A9R7 Q80XH9 A2A9R8 Q8BVA9 A2A9S0 A2A9S2 Q1KS26 A2A9S3 
Human Ortholog
ENSG00000162374 (ELAVL4)
Omim not available
UniTrap UNI30975
Vector Insertion
Chr 4: 109965239 - 110024420
Public Clones IST10858H7 (tigm) IST10886C11 (tigm) IST12387B2 (tigm) IST12032E4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20666
Vector Insertion
Chr 4: 109924127 - 109924297
Public Clones not available
Private Clones OST355228 (lexicon)
Severity of mutation (?) Insertion after 17% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI35403
Vector Insertion
Chr 4: 109899149 - 109924127
Public Clones IST11773E2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 23% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000001387
Sequence
ATGTTTGAAATCAGCAGGACGCTTAATGCTGCTTTATTAAATAATGAG - UNI20666 - - UNI35402 - ATAATTAGCACCATGGAGCCTCAGG

TGTCAAATGGACCGACATCCAATACAAGCAATGGACCCTCCAGCAACAACAGAAACTGTCCTTCTCCCATGCAGACAGGCGCCGCCACAGATGACAGCAA

AACCAACCTCATCGTCAACTATTTACCCCAGAATATGACCCAAGAGGAATTCAGGAGTCTCTTTGGGAGCATTGGTGAAATAGAATCCTGCAAACTCGTG

AGAGACAAAATCACAG - UNI35402 - GACAGAGTTTAGGGTATGGATTTGTTAACTATATTGATCCAAAGGATGCAGAGAAAGCCATCAACACTTT

AAATGGACTCAGACTCCAGACCAAAACCATAAAG - UNI35402 - GTGTCCTACGCCCGCCCAAGCTCGGCCTCGATCAGGGATGCTAACCTGTATG

TTAGTGGCCTTCCCAAGACCATGACCCAGAAGGAGCTGGAGCAGCTTTTCTCTCAATACGGTCGCATCATCACCTCACGCATCCTGGTTGATCAAGTCAC

AG GGGTCTCTAGAGGGGTGGGATTCATCCGCTTTGATAAGAGGATTGAGGCAGAAGAAGCCATCAAAGGACTGAATGGCCAGAAGCCCAGCGGTGCTAC

AGAACCGATTACTGTGAAGTTTGCCAACAACCCCAGCCAGAAGTCCAGCCAGGCCCTGCTCTCCCAGCTGTACCAGTCCCCCAACAGGCGATACCCTGGC

CCTCTCCACCACCAGGCTCAAAGATTCAG GCTGGACAATTTGCTTAATATGGCCTATGGCGTAAAGAG ACTGATGTCTGGACCAGTCCCCCCTTCTGC

TTGTCCCCCCAGGTTCTCCCCAATCACCATTGACGGGATGACAAGTCTTGTGGGAATGAACATCCCTGGTCACACAGGGACAGGCTGGTGCATCTTCGTC

TATAACCTGTCCCCTGATTCTGATGAGAGTGTCCTCTGGCAGCTCTTTGGCCCCTTTGGCGCAGTGAACAACGTCAAGGTCATCCGTGACTTCAACACCA

ACAAGTGCAAGGGATTCGGCTTCGTCACCATGACCAACTACGATGAGGCAGCCATGGCCATCGCCAGCCTCAATGGCTATCGCCTGGGAGACAGAGTGTT

GCAAGTTTCCTTTAAAACCAACAAAGCCCACAAATCCTGAATTTCTCACCCTTACTTATTAAAATATATATATAAATATATACGAACAAAACATGCGCGC

ACACACATACACAAAAGAGAGAGACAAACTTTCCAAGGCTTATATTCAACCATGGACTTTATAAGCCCGCGTTGCCTAAGTATTAAAACATTGGATTATC

CTGAGGTGTACCAGGAAAGGATTTTATAATGCTTAGAAAAAAAAAGAAAAAAAAAACAAAAAAATACCTTTGATGCATTGAATGTTCTTTCATAGCTGTC

GTTGTTGAATATAATATACATAGATAGCAATGTGCAGGGATTTTTACCCAGCCAGCTAACTTTACCACCTTCCTTGAAGGTGGGTCTTTTTAAGATGACC

ATTCGCTCATTTGAAGAAG
Translation
MFEISRTLNAALLNNE - UNI20666 - - UNI35402 - IISTMEPQVSNGPTSNTSNGPSSNNRNCPSPMQTGAATDDSKTNLIVNYLPQNMTQE

EFRSLFGSIGEIESCKLVR - UNI35402 -  - UNI35402 -    
Transcript ENSMUST00000106593
Sequence
CAAGGGGCTGGTCTAAAAATA - UNI20666 - - UNI35402 - ATAATTAGCACCATGGAGCCTCAGGTGTCAAATGGACCGACATCCAATACAA

GCAATGGACCCTCCAGCAACAACAGAAACTGTCCTTCTCCCATGCAGACAGGCGCCGCCACAGATGACAGCAAAACCAACCTCATCGTCAACTATTTACC

CCAGAATATGACCCAAGAGGAATTCAGGAGTCTCTTTGGGAGCATTGGTGAAATAGAATCCTGCAAACTCGTGAGAGACAAAATCACAG - UNI35402

 - GACAGAGTTTAGGGTATGGATTTGTTAACTATATTGATCCAAAGGATGCAGAGAAAGCCATCAACACTTTAAATGGACTCAGACTCCAGACCAAAAC

CATAAAG - UNI35402 - GTGTCCTACGCCCGCCCAAGCTCGGCCTCGATCAGGGATGCTAACCTGTATGTTAGTGGCCTTCCCAAGACCATGACCC

AGAAGGAGCTGGAGCAGCTTTTCTCTCAATACGGTCGCATCATCACCTCACGCATCCTGGTTGATCAAGTCACAG GGGTCTCTAGAGGGGTGGGATTCA

TCCGCTTTGATAAGAGGATTGAGGCAGAAGAAGCCATCAAAGGACTGAATGGCCAGAAGCCCAGCGGTGCTACAGAACCGATTACTGTGAAGTTTGCCAA

CAACCCCAGCCAGAAGTCCAGCCAGGCCCTGCTCTCCCAGCTGTACCAGTCCCCCAACAGGCGATACCCTGGCCCTCTCCACCACCAGGCTCAAAGATTC

AG GCTGGACAATTTGCTTAATATGGCCTATGGCGTAAAGAG ACTGATGTCTGGACCAGTCCCCCCTTCTGCTTGTCCCCCCAGGTTCTCCCCAATCAC

CATTGACGGGATGACAAGTCTTGTGGGAATGAACATCCCTGGTCACACAGGGACAGGCTGGTGCATCTTCGTCTATAACCTGTCCCCTGATTCTGATGAG

AGTGTCCTCTGGCAGCTCTTTGGCCCCTTTGGCGCAGTGAACAACGTCAAGGTCATCCGTGACTTCAACACCAACAAGTGCAAGGGATTCGGCTTCGTCA

CCATGACCAACTACGATGAGGCAGCCATGGCCATCGCCAGCCTCAATGGCTATCGCCTGGGAGACAGAGTGTTGCAAGTTTCCTTTAAAACCAACAAAGC

CCACAAATCCTGAATTTCTCACCCTTACTTATTAAAATATATATATAAATATATACGAACAAAACATGCGCGCACACACATACACAAAAGAGAGAGACAA

ACTTTCCAAGGCTTATATTCAACCATGGACTTTATAAGCCCGCGTTGCCTAAGTATTAAAACATTGGATTATCCTGAGGTGTACCAGGAAAGGATTTTAT

AATGCTTAGAAAAAAAAAGAAAAAAAAAACAAAAAAATACCTTTGATGCATTGAATGTTCTTTCATAGCTGTCGTTGTTGAATATAATATACATAGATAG

CAATGTGCAGGGATTTTTACCCAGCCAGCTAACTTTACCACCTTCCTTGAAGGTGGGTCTTTTTAAGATGACCATTCGCTCATTTGAAGAAG
Translation
QGAGLKI - UNI20666 - - UNI35402 - IISTMEPQVSNGPTSNTSNGPSSNNRNCPSPMQTGAATDDSKTNLIVNYLPQNMTQEEFRSLFGSI

GEIESCKLVRDKITG - UNI35402 - GQSLGYGFVNYIDPKDAEKAINTLNGLRLQTKTIK - UNI35402 - VSYARPSSASIRDANLYVSGLP

KTMTQKELEQLFSQYGRIITSRILVDQVTG GVSRGVGFIRFDKRIEAEEAIKGLNGQKPSGATEPITVKFANNPSQKSSQALLSQLYQSPNRRYPGPLH

HQAQRFR RLDNLLNMAYGVKR RLMSGPVPPSACPPRFSPITIDGMTSLVGMNIPGHTGTGWCIFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNT

NKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSFKTNKAHKS
Transcript ENSMUST00000106594
Sequence
TTAATCATG - UNI20666 - - UNI35402 - ATAATTAGCACCATGGAGCCTCAGGTGTCAAATGGACCGACATCCAATACAAGCAATGGACCCT

CCAGCAACAACAGAAACTGTCCTTCTCCCATGCAGACAGGCGCCGCCACAGATGACAGCAAAACCAACCTCATCGTCAACTATTTACCCCAGAATATGAC

CCAAGAGGAATTCAGGAGTCTCTTTGGGAGCATTGGTGAAATAGAATCCTGCAAACTCGTGAGAGACAAAATCACAG - UNI35402 - GACAGAGTT

TAGGGTATGGATTTGTTAACTATATTGATCCAAAGGATGCAGAGAAAGCCATCAACACTTTAAATGGACTCAGACTCCAGACCAAAACCATAAAG - UN

I35402 - GTGTCCTACGCCCGCCCAAGCTCGGCCTCGATCAGGGATGCTAACCTGTATGTTAGTGGCCTTCCCAAGACCATGACCCAGAAGGAGCTGG

AGCAGCTTTTCTCTCAATACGGTCGCATCATCACCTCACGCATCCTGGTTGATCAAGTCACAG GGGTCTCTAGAGGGGTGGGATTCATCCGCTTTGATA

AGAGGATTGAGGCAGAAGAAGCCATCAAAGGACTGAATGGCCAGAAGCCCAGCGGTGCTACAGAACCGATTACTGTGAAGTTTGCCAACAACCCCAGCCA

GAAGTCCAGCCAGGCCCTGCTCTCCCAGCTGTACCAGTCCCCCAACAGGCGATACCCTGGCCCTCTCCACCACCAGGCTCAAAGATTCAG GCTGGACAA

TTTGCTTAATATGGCCTATGGCGTAAAGAG GTTCTCCCCAATCACCATTGACGGGATGACAAGTCTTGTGGGAATGAACATCCCTGGTCACACAGGGAC

AGGCTGGTGCATCTTCGTCTATAACCTGTCCCCTGATTCTGATGAGAGTGTCCTCTGGCAGCTCTTTGGCCCCTTTGGCGCAGTGAACAACGTCAAGGTC

ATCCGTGACTTCAACACCAACAAGTGCAAGGGATTCGGCTTCGTCACCATGACCAACTACGATGAGGCAGCCATGGCCATCGCCAGCCTCAATGGCTATC

GCCTGGGAGACAGAGTGTTGCAAGTTTCCTTTAAAACCAACAAAGCCCACAAATCCTGAATTTCTCACCCTTACTTATTAAAATATATATATAAATATAT

ACGAACAAAACATGCGCGCACACACATACACAAAAGAGAGAGACAAACTTTCCAAGGCTTATATTCAACCATGGACTTTATAAGCCCGCGTTGCCTAAGT

ATTAAAACATTGGATTATCCTGAGGTGTACCAGGAAAGGATTTTATAATGCTTAGAAAAAAAAAGAAAAAAAAAACAAAAAAATACCTTTGATGCATTGA

ATGTTCTTTCATAGCTGTCGTTGTTGAATATAATATACATAGATAGCAATGTGCAGGGATTTTTACCCAGCCAGCTAACTTTACCACCTTCCTTGAAGGT

GGGTCTTTTTAAGATGACCATTCGCTCATTTGAAGAAGAAAAACAAAAAACACAAAAAAATAACAAACAATTTTTACAAAGTAATGGAATTCAAAGGAAG

AAAAAAAAGATTTTTCTTTTTTGTCAAAAATGTTGATCCAATCAGATTGGTTAAAAAACCCCCACACAAATTAAAGAGGAATAATAAAAATTGCAAAAAT

GAAAAAAAACTTTTGCAAATTTTTTTATTTTTCCTTTTTCTTTTATATCATGTGAACTAAAACAGTCTTCTGTTAGGGGACGGGGAAAGGGGGTGTACCT

GATGACATTAACAATTTAATAACATTAACATTGTTGCCAAAGAGGTGGTCTCTTTGCTGAAAATGGGTTTCAAGAAAAATCTATTTTTATAAAATATAAA

GAATTTTTACAAGAGAATCTGGATTTGAGAAAAAATATTTTGACTGGCTAATTTAGGGGAAATTGACAACTTTGTCGCGTTCATACTGCACTGGTAACTT

TTTAGAGATCAAGATGTGTGTTTTAAACTGGATTCGTAGACTGTTTTTTGAAGGATGGGCTATAAACAGATGATCTTCATATCTTTTCATAGCATGTAAT

AATAATAAAAAATATTAATTGCTAGGGAAAAGGAGTGTTCGTTCTACCCAGGGTACCACAGTTCCCCACAGTCAAAACCCAAAAGCAAGGAGATGAGTTG

AAAGACAGTTTTTCTTTAAGTCATCAGTATGGGATGTCAGCAGAACAAAAATTAAAAAGATTCATTTTCCTTTTAATCTAAAACTTCCTTAGTTTGAGCA

GTAGGTGCTACAGAATTATTTACATATCTTAGTATCATAGTTAAATGTAAGCGTGTTTAGGAGAGGAGACACAAGATACATTTGCTTTACATTCGTTAAG

CAATTTTCTAATTCACTTTGTAGCCCGTGCTGATAAAATTGGGCTGTGTGGGTACATTTGAAACACTGTTTATGTTGCTTGAAACACTTATTTATTTAAT

TGCAGATGTGATGATGATGCCTCTGGCCAAGATCAAATATAGCTAGATTGGCTAGACTACTTGTTTGTTTACTTAGACTTTGGGAAGAAGCATATTACTG

TGTCCTTCTGTTGTGTGTGTGTATGTGTACATATAATATAAATATATATATAAAGTTATTTTTTTCCTTTGGTTAATTTATTATAAGTTGTAACACTTGG

CTAGTTTTGTTTGTATATGTCTTAAGATGTTTTCTTATGATATTTAAGTGACAGTTAAAGAGGTATCAAGGTAACTTGTGTAGAACTATTGTTTGATATA

TTGTCATGTTTGTTGTGAATATTTTTTCTTACTGCACAGTAGAAAATTAAAAAAAAAAACTGGGTCTTTATTTTAATGTAATTCAGATTGGGGAAAACTA

AACAGAGCTAAGGGAACAAAAGGACCGTGGGAGCAAACTCCCACGTCCAGTGCACTGATCATTTTAGTACGTTTGTGCTTTGTATGGTTATATATTT
Translation
LIM - UNI20666 - - UNI35402 - IISTMEPQVSNGPTSNTSNGPSSNNRNCPSPMQTGAATDDSKTNLIVNYLPQNMTQEEFRSLFGSIGEIE

SCKLVRDKITG - UNI35402 - GQSLGYGFVNYIDPKDAEKAINTLNGLRLQTKTIK - UNI35402 - VSYARPSSASIRDANLYVSGLPKTMT

QKELEQLFSQYGRIITSRILVDQVTG GVSRGVGFIRFDKRIEAEEAIKGLNGQKPSGATEPITVKFANNPSQKSSQALLSQLYQSPNRRYPGPLHHQAQ

RFR RLDNLLNMAYGVKR RFSPITIDGMTSLVGMNIPGHTGTGWCIFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAA

MAIASLNGYRLGDRVLQVSFKTNKAHKS
Transcript ENSMUST00000106595
Sequence
AAACAG - UNI20666 - - UNI35402 - ATAATTAGCACCATGGAGCCTCAGGTGTCAAATGGACCGACATCCAATACAAGCAATGGACCCTCCA

GCAACAACAGAAACTGTCCTTCTCCCATGCAGACAGGCGCCGCCACAGATGACAGCAAAACCAACCTCATCGTCAACTATTTACCCCAGAATATGACCCA

AGAGGAATTCAGGAGTCTCTTTGGGAGCATTGGTGAAATAGAATCCTGCAAACTCGTGAGAGACAAAATCACAG - UNI35402 - GACAGAGTTTAG

GGTATGGATTTGTTAACTATATTGATCCAAAGGATGCAGAGAAAGCCATCAACACTTTAAATGGACTCAGACTCCAGACCAAAACCATAAAG - UNI35

402 - GTGTCCTACGCCCGCCCAAGCTCGGCCTCGATCAGGGATGCTAACCTGTATGTTAGTGGCCTTCCCAAGACCATGACCCAGAAGGAGCTGGAGC

AGCTTTTCTCTCAATACGGTCGCATCATCACCTCACGCATCCTGGTTGATCAAGTCACAG GGGTCTCTAGAGGGGTGGGATTCATCCGCTTTGATAAGA

GGATTGAGGCAGAAGAAGCCATCAAAGGACTGAATGGCCAGAAGCCCAGCGGTGCTACAGAACCGATTACTGTGAAGTTTGCCAACAACCCCAGCCAGAA

GTCCAGCCAGGCCCTGCTCTCCCAGCTGTACCAGTCCCCCAACAGGCGATACCCTGGCCCTCTCCACCACCAGGCTCAAAGATTCAG GCTGGACAATTT

GCTTAATATGGCCTATGGCGTAAAGAG GTTCTCCCCAATCACCATTGACGGGATGACAAGTCTTGTGGGAATGAACATCCCTGGTCACACAGGGACAGG

CTGGTGCATCTTCGTCTATAACCTGTCCCCTGATTCTGATGAGAGTGTCCTCTGGCAGCTCTTTGGCCCCTTTGGCGCAGTGAACAACGTCAAGGTCATC

CGTGACTTCAACACCAACAAGTGCAAGGGATTCGGCTTCGTCACCATGACCAACTACGATGAGGCAGCCATGGCCATCGCCAGCCTCAATGGCTATCGCC

TGGGAGACAGAGTGTTGCAAGTTTCCTTTAAAACCAACAAAGCCCACAAATCCTGAATTTCTCACCCTTACTTATTAAAATATATATATAAATATATACG

AACAAAACATGCGCGCACACACATACACAAAAGAGAGAGACAAACTTTCCAAGGCTTATATTCAACCATGGACTTTATAAGCCCGCGTTGCCTAAGTATT

AAAACATTGGATTATCCTGAGGTGTACCAGGAAAGGATTTTATAATGCTTAGAAAAAAAAAGAAAAAAAAAACAAAAAAATACCTTTGATGCATTGAATG

TTCTTTCATAGCTGTCGTTGTTGAATATAATATACATAGATAGCAATGTGCAGGGATTTTTACCCAGCCAGCTAACTTTACCACCTTCCTTGAAGGTGGG

TCTTTTTAAGATGACCATTCGCTCATTTGAAGAAGAAAAACAAAAAACACAAAAAAATAACAAACAATTTTTACAAAGTAATGGAATTCAAAGGAAGAAA

AAAAAGATTTTTCTTTTTTGTCAAAAATGTTGATCCAATCAGATTGGTTAAAAAACCCCCACACAAATTAAAGAGGAATAATAAAAATTGCAAAAATGAA

AAAAAACTTTTGCAAATTTTTTTATTTTTCCTTTTTCTTTTATATCATGTGAACTAAAACAGTCTTCTGTTAGGGGACGGGGAAAGGGGGTGTACCTGAT

GACATTAACAATTTAATAACATTAACATTGTTGCCAAAGAGGTGGTCTCTTTGCTGAAAATGGGTTTCAAGAAAAATCTATTTTTATAAAATATAAAGAA

TTTTTACAAGAGAATCTGGATTTGAGAAAAAATATTTTGACTGGCTAATTTAGGGGAAATTGACAACTTTGTCGCGTTCATACTGCACTGGTAACTTTTT

AGAGATCAAGATGTGTGTTTTAAACTGGATTCGTAGACTGTTTTTTGAAGGATGGGCTATAAACAGATGATCTTCATATCTTTTCATAGCATGTAATAAT

AATAAAAAATATTAATTGCTAGGGAAAAGGAGTGTTCGTTCTACCCAGGGTACCACAGTTCCCCACAGTCAAAACCCAAAAGCAAGGAGATGAGTTGAAA

GACAGTTTTTCTTTAAGTCATCAGTATGGGATGTCAGCAGAACAAAAATTAAAAAGATTCATTTTCCTTTTAATCTAAAACTTCCTTAGTTTGAGCAGTA

GGTGCTACAGAATTATTTACATATCTTAGTATCATAGTTAAATGTAAGCGTGTTTAGGAGAGGAGACACAAGATACATTTGCTTTACATTCGTTAAGCAA

TTTTCTAATTCACTTTGTAGCCCGTGCTGATAAAATTGGGCTGTGTGGGTACATTTGAAACACTGTTTATGTTGCTTGAAACACTTATTTATTTAATTGC

AGATGTGATGATGATGCCTCTGGCCAAGATCAAATATAGCTAGATTGGCTAGACTACTTGTTTGTTTACTTAGACTTTGGGAAGAAGCATATTACTGTGT

CCTTCTGTTGTGTGTGTGTATGTGTACATATAATATAAATATATATATAAAGTTATTTTTTTCCTTTGGTTAATTTATTATAAGTTGTAACACTTGGCTA

GTTTTGTTTGTATATGTCTTAAGATGTTTTCTTATGATATTTAAGTGACAGTTAAAGAGGTATCAAGGTAACTTGTGTAGAACTATTGTTTGATATATTG

TCATGTTTGTTGTGAATATTTTTTCTTACTGCACAGTAGAAAATTAAAAAAAAAAACTGGGTCTTTATTTTAATGTAATTCAGATTGGGGAAAACTAAAC

AGAGCTAAGGGAACAAAAGGACCGTGGGAGCAAACTCCCACGTCCAGTGCACTGATCATTTTAGTACGTTTGTGCTTTGTATGGTTATATATTT
Translation
KQ - UNI20666 - - UNI35402 - IISTMEPQVSNGPTSNTSNGPSSNNRNCPSPMQTGAATDDSKTNLIVNYLPQNMTQEEFRSLFGSIGEIES

CKLVRDKITG - UNI35402 - GQSLGYGFVNYIDPKDAEKAINTLNGLRLQTKTIK - UNI35402 - VSYARPSSASIRDANLYVSGLPKTMTQ

KELEQLFSQYGRIITSRILVDQVTG GVSRGVGFIRFDKRIEAEEAIKGLNGQKPSGATEPITVKFANNPSQKSSQALLSQLYQSPNRRYPGPLHHQAQR

FR RLDNLLNMAYGVKR RFSPITIDGMTSLVGMNIPGHTGTGWCIFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAM

AIASLNGYRLGDRVLQVSFKTNKAHKS
Transcript ENSMUST00000102722
Sequence
CTTGTCTACATGCCTGGGTTTTGTGGGGCATTGGGTGGATGCAGCAGGGTTAGGAATCTCTCCATTTCTGTGCTGGTGGAAATGTAAACCTCGAGAGGCA

GCTCCTGGATGCTGAACGTTGAGATGGGCAGTTGTGTTTCTGGGGACTGCGCAGTCAAAACGGCAAAGAGAGTGATTTATTTGGGCTTCAGTAAACGCTG

CATCTTGTATTTCAAAGAGTTTCCTGTCATGACCTCATAAAAAGAGGAGGCGGCTTGTATGTGTAGCGGTGCCTGGCGTGTTGAGTTGTTGCTTCCTTCT

CTGGGCAGCAGCTCTGTAAGAAGGGAATGTCAGCTTTTACATAACGCTCCTTTCTGCTTTTGACACACTGTGTGAGGGTCCATCTTCTGATCACAGATGG

AGTGGAATGGCTTGAAGATG - UNI20666 - - UNI35402 - ATAATTAGCACCATGGAGCCTCAGGTGTCAAATGGACCGACATCCAATACAAG

CAATGGACCCTCCAGCAACAACAGAAACTGTCCTTCTCCCATGCAGACAGGCGCCGCCACAGATGACAGCAAAACCAACCTCATCGTCAACTATTTACCC

CAGAATATGACCCAAGAGGAATTCAGGAGTCTCTTTGGGAGCATTGGTGAAATAGAATCCTGCAAACTCGTGAGAGACAAAATCACAG - UNI35402 

- GACAGAGTTTAGGGTATGGATTTGTTAACTATATTGATCCAAAGGATGCAGAGAAAGCCATCAACACTTTAAATGGACTCAGACTCCAGACCAAAACC

ATAAAG - UNI35402 - GTGTCCTACGCCCGCCCAAGCTCGGCCTCGATCAGGGATGCTAACCTGTATGTTAGTGGCCTTCCCAAGACCATGACCCA

GAAGGAGCTGGAGCAGCTTTTCTCTCAATACGGTCGCATCATCACCTCACGCATCCTGGTTGATCAAGTCACAG GGGTCTCTAGAGGGGTGGGATTCAT

CCGCTTTGATAAGAGGATTGAGGCAGAAGAAGCCATCAAAGGACTGAATGGCCAGAAGCCCAGCGGTGCTACAGAACCGATTACTGTGAAGTTTGCCAAC

AACCCCAGCCAGAAGTCCAGCCAGGCCCTGCTCTCCCAGCTGTACCAGTCCCCCAACAGGCGATACCCTGGCCCTCTCCACCACCAGGCTCAAAGATTCA

G GCTGGACAATTTGCTTAATATGGCCTATGGCGTAAAGAG GTTCTCCCCAATCACCATTGACGGGATGACAAGTCTTGTGGGAATGAACATCCCTGGT

CACACAGGGACAGGCTGGTGCATCTTCGTCTATAACCTGTCCCCTGATTCTGATGAGAGTGTCCTCTGGCAGCTCTTTGGCCCCTTTGGCGCAGTGAACA

ACGTCAAGGTCATCCGTGACTTCAACACCAACAAGTGCAAGGGATTCGGCTTCGTCACCATGACCAACTACGATGAGGCAGCCATGGCCATCGCCAGCCT

CAATGGCTATCGCCTGGGAGACAGAGTGTTGCAAGTTTCCTTTAAAACCAACAAAGCCCACAAATCCTGAATTTCTCACCCTTACTTATTAAAATATATA

TATAAATATATACGAACAAAACATGCGCGCACACACATACACAAAAGAGAGAGACAAACTTTCCAAGGCTTATATTCAACCATGGACTTTATAAGCCCGC

GTTGCCTAAGTATTAAAACATTGGATTATCCTGAGGTGTACCAGGAAAGGATTTTATAATGCTTAGAAAAAAAAAGAAAAAAAAAACAAAAAAATACCTT

TGATGCATTGAATGTTCTTTCATAGCTGTCGTTGTTGAATATAATATACATAGATAGCAATGTGCAGGGATTTTTACCCAGCCAGCTAACTTTACCACCT

TCCTTGAAGGTGGGTCTTTTTAAGATGACCATTCGCTCATTTGAAGAAGAAAAACAAAAAACACAAAAAAATAACAAACAATTTTTACAAAGTAATGGAA

TTCAAAGGAAGAAAAAAAAGATTTTTCTTTTTTGTCAAAAATGTTGATCCAATCAGATTGGTTAAAAAACCCCCACACAAATTAAAGAGGAATAATAAAA

ATTGCAAAAATGAAAAAAAACTTTTGCAAATTTTTTTATTTTTCCTTTTTCTTTTATATCATGTGAACTAAAACAGTCTTCTGTTAGGGGACGGGGAAAG

GGGGTGTACCTGATGACATTAACAATTTAATAACATTAACATTGTTGCCAAAGAGGTGGTCTCTTTGCTGAAAATGGGTTTCAAGAAAAATCTATTTTTA

TAAAATATAAAGAATTTTTACAAGAGAATCTGGATTTGAGAAAAAATATTTTGACTGGCTAATTTAGGGGAAATTGACAACTTTGTCGCGTTCATACTGC

ACTGGTAACTTTTTAGAGATCAAGATGTGTGTTTTAAACTGGATTCGTAGACTGTTTTTTGAAGGATGGGCTATAAACAGATGATCTTCATATCTTTTCA

TAGCATGTAATAATAATAAAAAATATTAATTGCTAGGGAAAAGGAGTGTTCGTTCTACCCAGGGTACCACAGTTCCCCACAGTCAAAACCCAAAAGCAAG

GAGATGAGTTGAAAGACAGTTTTTCTTTAAGTCATCAGTATGGGATGTCAGCAGAACAAAAATTAAAAAGATTCATTTTCCTTTTAATCTAAAACTTCCT

TAGTTTGAGCAGTAGGTGCTACAGAATTATTTACATATCTTAGTATCATAGTTAAATGTAAGCGTGTTTAGGAGAGGAGACACAAGATACATTTGCTTTA

CATTCGTTAAGCAATTTTCTAATTCACTTTGTAGCCCGTGCTGATAAAATTGGGCTGTGTGGGTACATTTGAAACACTGTTTATGTTGCTTGAAACACTT

ATTTATTTAATTGCAGATGTGATGATGATGCCTCTGGCCAAGATCAAATATAGCTAGATTGGCTAGACTACTTGTTTGTTTACTTAGACTTTGGGAAGAA

GCATATTACTGTGTCCTTCTGTTGTGTGTGTGTATGTGTACATATAATATAAATATATATATAAAGTTATTTTTTTCCTTTGGTTAATTTATTATAAGTT

GTAACACTTGGCTAGTTTTGTTTGTATATGTCTTAAGATGTTTTCTTATGATATTTAAGTGACAGTTAAAGAGGTATCAAGGTAACTTGTGTAGAACTAT

TGTTTGATATATTGTCATGTTTGTTGTGAATATTTTTTCTTACTGCACAGTAGAAAATTAAAAAAAAAAACTGGGTCTTTATTTTAATGTAATTCAGATT

GGGGAAAACTAAACAGAGCTAAGGGAACAAAAGGACCGTGGGAGCAAACTCCCACGTCCAGTGCACTGATCATTTTAGTACGTTTGTGCTTTGTATGGTT

ATATATTTAAAACAAAAATGAAACAAAAAAAAATACAAGAGTTCATGCTCTTCCCTGGGTAATAGAAACAGTTACTCGCTATGCATAATCTAGTTGATAG

TAAAATTTGCTATTGCTTTTCTTGTCTTGTTACATAAAATCTTTTCAATACAAGTTTAGTCTTAATGGTAATAAAACGTTATGGTTATTTATAACTTGTG

CTTATTTTGTGCATTTTTTCCCATGCTGAACCCACTAAGTGCATGTAGACAGGACTGTTGTTTGCACATTGAAGAGGCAAACTTTGTAGTAGTCGTTGTA

GTGGTAGACAGATAACGAAAACCGAGGCTGCATCATAGACTACTCCTTTAAATTTTTTTTCTATTTTTTTTTCCTCTTTTCGGTTTTTGGAGAAAAATAA

ATAACACCAGATTTCAGTTCAGAGAACACTCGTTCAACATTCAGGGAAACCTTTATATGTCACCTGCTATGAATGAATGCAGTTTGCTGGCAAAGTTCTG

ATGCATTTGCTAAGCATTCATGGGAAAGGCATGCCAAAATCTCTTCTCTATGATGTGTTCAATCTGAGGGAAAAAAAAGGAAAAAAAATCTTAGGACCAG

GCAGTTGTATACTTTAGTTATAAATGAATGACTTCATGTTAATCTTGCTAGTTTAGATGATTTCTGAGGGAAAGTATTGTAAATGTTTTTTTTTCATAAT

CTTGTTGTGTTTGAATTATTTGTACTTTATCTGTCCAGACAATAAATGAAAGTGTGTAGAATGAA
Translation
MEWNGLKM - UNI20666 - - UNI35402 - IISTMEPQVSNGPTSNTSNGPSSNNRNCPSPMQTGAATDDSKTNLIVNYLPQNMTQEEFRSLFGS

IGEIESCKLVRDKITG - UNI35402 - GQSLGYGFVNYIDPKDAEKAINTLNGLRLQTKTIK - UNI35402 - VSYARPSSASIRDANLYVSGL

PKTMTQKELEQLFSQYGRIITSRILVDQVTG GVSRGVGFIRFDKRIEAEEAIKGLNGQKPSGATEPITVKFANNPSQKSSQALLSQLYQSPNRRYPGPL

HHQAQRFR RLDNLLNMAYGVKR RFSPITIDGMTSLVGMNIPGHTGTGWCIFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTN

YDEAAMAIASLNGYRLGDRVLQVSFKTNKAHKS
Transcript ENSMUST00000106597
Sequence
ATGGAGTGGAATGGCTTGAAGATG - UNI20666 - - UNI35402 - ATAATTAGCACCATGGAGCCTCAGGTGTCAAATGGACCGACATCCAATA

CAAGCAATGGACCCTCCAGCAACAACAGAAACTGTCCTTCTCCCATGCAGACAGGCGCCGCCACAGATGACAGCAAAACCAACCTCATCGTCAACTATTT

ACCCCAGAATATGACCCAAGAGGAATTCAGGAGTCTCTTTGGGAGCATTGGTGAAATAGAATCCTGCAAACTCGTGAGAGACAAAATCACAG - UNI35

402 - GACAGAGTTTAGGGTATGGATTTGTTAACTATATTGATCCAAAGGATGCAGAGAAAGCCATCAACACTTTAAATGGACTCAGACTCCAGACCAA

AACCATAAAG - UNI35402 - GTGTCCTACGCCCGCCCAAGCTCGGCCTCGATCAGGGATGCTAACCTGTATGTTAGTGGCCTTCCCAAGACCATGA

CCCAGAAGGAGCTGGAGCAGCTTTTCTCTCAATACGGTCGCATCATCACCTCACGCATCCTGGTTGATCAAGTCACAG GGGTCTCTAGAGGGGTGGGAT

TCATCCGCTTTGATAAGAGGATTGAGGCAGAAGAAGCCATCAAAGGACTGAATGGCCAGAAGCCCAGCGGTGCTACAGAACCGATTACTGTGAAGTTTGC

CAACAACCCCAGCCAGAAGTCCAGCCAGGCCCTGCTCTCCCAGCTGTACCAGTCCCCCAACAGGCGATACCCTGGCCCTCTCCACCACCAGGCTCAAAGA

TTCAG GCTGGACAATTTGCTTAATATGGCCTATGGCGTAAAGAG ACTGATGTCTGGACCAGTCCCCCCTTCTGCTTGTCCCCCCAGGTTCTCCCCAAT

CACCATTGACGGGATGACAAGTCTTGTGGGAATGAACATCCCTGGTCACACAGGGACAGGCTGGTGCATCTTCGTCTATAACCTGTCCCCTGATTCTGAT

GAGAGTGTCCTCTGGCAGCTCTTTGGCCCCTTTGGCGCAGTGAACAACGTCAAGGTCATCCGTGACTTCAACACCAACAAGTGCAAGGGATTCGGCTTCG

TCACCATGACCAACTACGATGAGGCAGCCATGGCCATCGCCAGCCTCAATGGCTATCGCCTGGGAGACAGAGTGTTGCAAGTTTCCTTTAAAACCAACAA

AGCCCACAAATCCTGAATTTCTCACCCTTACTTATTAAAATATATATATAAATATATACGAACAAAACATGCGCGCACACACATACACAAAAGAGAGAGA

CAAACTTTCCAAGGCTTATATTCAACCATGGACTTTATAAGCCCGCGTTGCCTAAGTATTAAAACATTGGATTATCCTGAGGTGTACCAGGAAAGGATTT

TATAATGCTTAGAAAAAAAAAGAAAAAAAAAACAAAAAAATACCTTTGATGCATTGAATGTTCTTTCATAGCTGTCGTTGTTGAATATAATATACATAGA

TAGCAATGTGCAGGGATTTTTACCCAGCCAGCTAACTTTACCACCTTCCTTGAAGGTGGGTCTTTTTAAGATGACCATTCGCTCATTTGAAGAAG
Translation
MEWNGLKM - UNI20666 - - UNI35402 - IISTMEPQVSNGPTSNTSNGPSSNNRNCPSPMQTGAATDDSKTNLIVNYLPQNMTQEEFRSLFGS

IGEIESCKLVRDKITG - UNI35402 - GQSLGYGFVNYIDPKDAEKAINTLNGLRLQTKTIK - UNI35402 - VSYARPSSASIRDANLYVSGL

PKTMTQKELEQLFSQYGRIITSRILVDQVTG GVSRGVGFIRFDKRIEAEEAIKGLNGQKPSGATEPITVKFANNPSQKSSQALLSQLYQSPNRRYPGPL

HHQAQRFR RLDNLLNMAYGVKR RLMSGPVPPSACPPRFSPITIDGMTSLVGMNIPGHTGTGWCIFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFN

TNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSFKTNKAHKS
Transcript ENSMUST00000106598
Sequence
GAGCCAATTTCAGCAAGGCTCTGTTCAGTTGTTCTTATCTACATCCTAGAATCGGGGGTTTCAGCTCACTGCGCCTTTTCTTCCTCTCTTTTTTTTCCCC

CTTTCTTTCCCACCCCACCCCCTCCCAATAATAGATTTACTTTACAATCATCCACACTGTGGTCTGTGGATCTTTAATATATATATATATAAAACAATAG

TAGTCATTTTTAAGTATATTCTGAAACCTTTGCAAATTTTAAGAGAAGAGTCGAAGCGCTGCGAGACCCAATATTTGCCAATAAGAATGGTTATG - UN

I20666 - - UNI35402 - ATAATTAGCACCATGGAGCCTCAGGTGTCAAATGGACCGACATCCAATACAAGCAATGGACCCTCCAGCAACAACAGA

AACTGTCCTTCTCCCATGCAGACAGGCGCCGCCACAGATGACAGCAAAACCAACCTCATCGTCAACTATTTACCCCAGAATATGACCCAAGAGGAATTCA

GGAGTCTCTTTGGGAGCATTGGTGAAATAGAATCCTGCAAACTCGTGAGAGACAAAATCACAG - UNI35402 - GACAGAGTTTAGGGTATGGATTT

GTTAACTATATTGATCCAAAGGATGCAGAGAAAGCCATCAACACTTTAAATGGACTCAGACTCCAGACCAAAACCATAAAG - UNI35402 - GTGTC

CTACGCCCGCCCAAGCTCGGCCTCGATCAGGGATGCTAACCTGTATGTTAGTGGCCTTCCCAAGACCATGACCCAGAAGGAGCTGGAGCAGCTTTTCTCT

CAATACGGTCGCATCATCACCTCACGCATCCTGGTTGATCAAGTCACAG GGGTCTCTAGAGGGGTGGGATTCATCCGCTTTGATAAGAGGATTGAGGCA

GAAGAAGCCATCAAAGGACTGAATGGCCAGAAGCCCAGCGGTGCTACAGAACCGATTACTGTGAAGTTTGCCAACAACCCCAGCCAGAAGTCCAGCCAGG

CCCTGCTCTCCCAGCTGTACCAGTCCCCCAACAGGCGATACCCTGGCCCTCTCCACCACCAGGCTCAAAGATTCAG GCTGGACAATTTGCTTAATATGG

CCTATGGCGTAAAGAG GTTCTCCCCAATCACCATTGACGGGATGACAAGTCTTGTGGGAATGAACATCCCTGGTCACACAGGGACAGGCTGGTGCATCT

TCGTCTATAACCTGTCCCCTGATTCTGATGAGAGTGTCCTCTGGCAGCTCTTTGGCCCCTTTGGCGCAGTGAACAACGTCAAGGTCATCCGTGACTTCAA

CACCAACAAGTGCAAGGGATTCGGCTTCGTCACCATGACCAACTACGATGAGGCAGCCATGGCCATCGCCAGCCTCAATGGCTATCGCCTGGGAGACAGA

GTGTTGCAAGTTTCCTTTAAAACCAACAAAGCCCACAAATCCTGAATTTCTCACCCTTACTTATTAAAATATATATATAAATATATACGAACAAAACATG

CGCGCACACACATACACAAAAGAGAGAGACAAACTTTCCAAGGCTTATATTCAACCATGGACTTTATAAGCCCGCGTTGCCTAAGTATTAAAACATTGGA

TTATCCTGAGGTGTACCAGGAAAGGATTTTATAATGCTTAGAAAAAAAAAGAAAAAAAAAACAAAAAAATACCTTTGATGCATTGAATGTTCTTTCATAG

CTGTCGTTGTTGAATATAATATACATAGATAGCAATGTGCAGGGATTTTTACCCAGCCAGCTAACTTTACCACCTTCCTTGAAGGTGGGTCTTTTTAAGA

TGACCATTCGCTCATTTGAAGAAGAAAAACAAAAAACACAAAAAAATAACAAACAATTTTTACAAAGTAATGGAATTCAAAGGAAGAAAAAAAAGATTTT

TCTTTTTTGTCAAAAATGTTGATCCAATCAGATTGGTTAAAAAACCCCCACACAAATTAAAGAGGAATAATAAAAATTGCAAAAATGAAAAAAAACTTTT

GCAAATTTTTTTATTTTTCCTTTTTCTTTTATATCATGTGAACTAAAACAGTCTTCTGTTAGGGGACGGGGAAAGGGGGTGTACCTGATGACATTAACAA

TTTAATAACATTAACATTGTTGCCAAAGAGGTGGTCTCTTTGCTGAAAATGGGTTTCAAGAAAAATCTATTTTTATAAAATATAAAGAATTTTTACAAGA

GAATCTGGATTTGAGAAAAAATATTTTGACTGGCTAATTTAGGGGAAATTGACAACTTTGTCGCGTTCATACTGCACTGGTAACTTTTTAGAGATCAAGA

TGTGTGTTTTAAACTGGATTCGTAGACTGTTTTTTGAAGGATGGGCTATAAACAGATGATCTTCATATCTTTTCATAGCATGTAATAATAATAAAAAATA

TTAATTGCTAGGGAAAAGGAGTGTTCGTTCTACCCAGGGTACCACAGTTCCCCACAGTCAAAACCCAAAAGCAAGGAGATGAGTTGAAAGACAGTTTTTC

TTTAAGTCATCAGTATGGGATGTCAGCAGAACAAAAATTAAAAAGATTCATTTTCCTTTTAATCTAAAACTTCCTTAGTTTGAGCAGTAGGTGCTACAGA

ATTATTTACATATCTTAGTATCATAGTTAAATGTAAGCGTGTTTAGGAGAGGAGACACAAGATACATTTGCTTTACATTCGTTAAGCAATTTTCTAATTC

ACTTTGTAGCCCGTGCTGATAAAATTGGGCTGTGTGGGTACATTTGAAACACTGTTTATGTTGCTTGAAACACTTATTTATTTAATTGCAGATGTGATGA

TGATGCCTCTGGCCAAGATCAAATATAGCTAGATTGGCTAGACTACTTGTTTGTTTACTTAGACTTTGGGAAGAAGCATATTACTGTGTCCTTCTGTTGT

GTGTGTGTATGTGTACATATAATATAAATATATATATAAAGTTATTTTTTTCCTTTGGTTAATTTATTATAAGTTGTAACACTTGGCTAGTTTTGTTTGT

ATATGTCTTAAGATGTTTTCTTATGATATTTAAGTGACAGTTAAAGAGGTATCAAGGTAACTTGTGTAGAACTATTGTTTGATATATTGTCATGTTTGTT

GTGAATATTTTTTCTTACTGCACAGTAGAAAATTAAAAAAAAAAACTGGGTCTTTATTTTAATGTAATTCAGATTGGGGAAAACTAAACAGAGCTAAGGG

AACAAAAGGACCGTGGGAGCAAACTCCCACGTCCAGTGCACTGATCATTTTAGTACGTTTGTGCTTTGTATGGTTATATATTTAAAACAAAAATGAAACA

AAAAAAAATACAAGAGTTCATGCTCTTCCCTGGGTAATAGAAACAGTTACTCGCTATGCATAATCTAGTTGATAGTAAAATTTGCTATTGCTTTTCTTGT

CTTGTTACATAAAATCTTTTCAATACAAGTTTAGTCTTAATGGTAATAAAACGTTATGGTTATTTATAACTTGTGCTTATTTTGTGCATTTTTTCCCATG

CTGAACCCACTAAGTGCATGTAGACAGGACTGTTGTTTGCACATTGAAGAGGCAAACTTTGTAGTAGTCGTTGTAGTGGTAGACAGATAACGAAAACCGA

GGCTGCATCATAGACTACTCCTTTAAATTTTTTTTCTATTTTTTTTTCCTCTTTTCGGTTTTTGGAGAAAAATAAATAACACCAGATTTCAGTTCAGAGA

ACACTCGTTCAACATTCAGGGAAACCTTTATATGTCACCTGCTATGAATGAATGCAGTTTGCTGGCAAAGTTCTGATGCATTTGCTAAGCATTCATGGGA

AAGGCATGCCAAAATCTCTTCTCTATGATGTGTTCAATCTGAGGGAAAAAAAAGGAAAAAAAATCTTAGGACCAGGCAGTTGTATACTTTAGTTATAAAT

GAATGACTTCATGTTAATCTTGCTAGTTTAGATGATTTCTGAGGGAAAGTATTGTAAATGTTTTTTTTTCATAATCTTGTTGTGTTTGAATTATTTGTAC

TTTATCTGTCCAGACAATAAATGAAAGTGTGTAGAATGAATTTGAGCTTCCCAAA
Translation
MVM - UNI20666 - - UNI35402 - IISTMEPQVSNGPTSNTSNGPSSNNRNCPSPMQTGAATDDSKTNLIVNYLPQNMTQEEFRSLFGSIGEIE

SCKLVRDKITG - UNI35402 - GQSLGYGFVNYIDPKDAEKAINTLNGLRLQTKTIK - UNI35402 - VSYARPSSASIRDANLYVSGLPKTMT

QKELEQLFSQYGRIITSRILVDQVTG GVSRGVGFIRFDKRIEAEEAIKGLNGQKPSGATEPITVKFANNPSQKSSQALLSQLYQSPNRRYPGPLHHQAQ

RFR RLDNLLNMAYGVKR RFSPITIDGMTSLVGMNIPGHTGTGWCIFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAA

MAIASLNGYRLGDRVLQVSFKTNKAHKS
Transcript ENSMUST00000102723
Sequence
AGTTGTTCTTATCTACATCCTAGAATCGGGGGTTTCAGCTCACTGCGCCTTTTCTTCCTCTCTTTTTTTTCCCCCTTTCTTTCCCACCCCACCCCCTCCC

AATAATAGATTTACTTTACAATCATCCACACTGTGGTCTGTGGATCTTTAATATATATATATATAAAACAATAGTAGTCATTTTTAAGTATATTCTGAAA

CCTTTGCAAATTTTAAGAGAAGAGTCGAAGCGCTGCGAGACCCAATATTTGCCAATAAGAATGGTTATG - UNI20666 - - UNI35402 - ATAA

TTAGCACCATGGAGCCTCAGGTGTCAAATGGACCGACATCCAATACAAGCAATGGACCCTCCAGCAACAACAGAAACTGTCCTTCTCCCATGCAGACAGG

CGCCGCCACAGATGACAGCAAAACCAACCTCATCGTCAACTATTTACCCCAGAATATGACCCAAGAGGAATTCAGGAGTCTCTTTGGGAGCATTGGTGAA

ATAGAATCCTGCAAACTCGTGAGAGACAAAATCACAG - UNI35402 - GACAGAGTTTAGGGTATGGATTTGTTAACTATATTGATCCAAAGGATGC

AGAGAAAGCCATCAACACTTTAAATGGACTCAGACTCCAGACCAAAACCATAAAG - UNI35402 - GTGTCCTACGCCCGCCCAAGCTCGGCCTCGA

TCAGGGATGCTAACCTGTATGTTAGTGGCCTTCCCAAGACCATGACCCAGAAGGAGCTGGAGCAGCTTTTCTCTCAATACGGTCGCATCATCACCTCACG

CATCCTGGTTGATCAAGTCACAG GGGTCTCTAGAGGGGTGGGATTCATCCGCTTTGATAAGAGGATTGAGGCAGAAGAAGCCATCAAAGGACTGAATGG

CCAGAAGCCCAGCGGTGCTACAGAACCGATTACTGTGAAGTTTGCCAACAACCCCAGCCAGAAGTCCAGCCAGGCCCTGCTCTCCCAGCTGTACCAGTCC

CCCAACAGGCGATACCCTGGCCCTCTCCACCACCAGGCTCAAAGATTCAG GCTGGACAATTTGCTTAATATGGCCTATGGCGTAAAGAG ACTGATGTC

TGGACCAGTCCCCCCTTCTGCTTGTCCCCCCAGGTTCTCCCCAATCACCATTGACGGGATGACAAGTCTTGTGGGAATGAACATCCCTGGTCACACAGGG

ACAGGCTGGTGCATCTTCGTCTATAACCTGTCCCCTGATTCTGATGAGAGTGTCCTCTGGCAGCTCTTTGGCCCCTTTGGCGCAGTGAACAACGTCAAGG

TCATCCGTGACTTCAACACCAACAAGTGCAAGGGATTCGGCTTCGTCACCATGACCAACTACGATGAGGCAGCCATGGCCATCGCCAGCCTCAATGGCTA

TCGCCTGGGAGACAGAGTGTTGCAAGTTTCCTTTAAAACCAACAAAGCCCACAAATCCTGAATTTCTCACCCTTACTTATTAAAATATATATATAAATAT

ATACGAACAAAACATGCGCGCACACACATACACAAAAGAGAGAGACAAACTTTCCAAGGCTTATATTCAACCATGGACTTTATAAGCCCGCGTTGCCTAA

GTATTAAAACATTGGATTATCCTGAGGTGTACCAGGAAAGGATTTTATAATGCTTAGAAAAAAAAAGAAAAAAAAAACAAAAAAATACCTTTGATGCATT

GAATGTTCTTTCATAGCTGTCGTTGTTGAATATAATATACATAGATAGCAATGTGCAGGGATTTTTACCCAGCCAGCTAACTTTACCACCTTCCTTGAAG

GTGGGTCTTTTTAAGATGACCATTCGCTCATTTGAAGAAG
Translation
MVM - UNI20666 - - UNI35402 - IISTMEPQVSNGPTSNTSNGPSSNNRNCPSPMQTGAATDDSKTNLIVNYLPQNMTQEEFRSLFGSIGEIE

SCKLVRDKITG - UNI35402 - GQSLGYGFVNYIDPKDAEKAINTLNGLRLQTKTIK - UNI35402 - VSYARPSSASIRDANLYVSGLPKTMT

QKELEQLFSQYGRIITSRILVDQVTG GVSRGVGFIRFDKRIEAEEAIKGLNGQKPSGATEPITVKFANNPSQKSSQALLSQLYQSPNRRYPGPLHHQAQ

RFR RLDNLLNMAYGVKR RLMSGPVPPSACPPRFSPITIDGMTSLVGMNIPGHTGTGWCIFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCK

GFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSFKTNKAHKS
Transcript ENSMUST00000106600
Sequence
ATGGGATTACTTCTTTTAAGGGAAATTGTTATTAATGAGTCAAGAAACTGCTCATTTATG - UNI20666 - - UNI35402 - ATAATTAGCACCA

TGGAGCCTCAGGTGTCAAATGGACCGACATCCAATACAAGCAATGGACCCTCCAGCAACAACAGAAACTGTCCTTCTCCCATGCAGACAGGCGCCGCCAC

AGATGACAGCAAAACCAACCTCATCGTCAACTATTTACCCCAGAATATGACCCAAGAGGAATTCAGGAGTCTCTTTGGGAGCATTGGTGAAATAGAATCC

TGCAAACTCGTGAGAGACAAAATCACAG - UNI35402 - GACAGAGTTTAGGGTATGGATTTGTTAACTATATTGATCCAAAGGATGCAGAGAAAGC

CATCAACACTTTAAATGGACTCAGACTCCAGACCAAAACCATAAAG - UNI35402 - GTGTCCTACGCCCGCCCAAGCTCGGCCTCGATCAGGGATG

CTAACCTGTATGTTAGTGGCCTTCCCAAGACCATGACCCAGAAGGAGCTGGAGCAGCTTTTCTCTCAATACGGTCGCATCATCACCTCACGCATCCTGGT

TGATCAAGTCACAG GGGTCTCTAGAGGGGTGGGATTCATCCGCTTTGATAAGAGGATTGAGGCAGAAGAAGCCATCAAAGGACTGAATGGCCAGAAGCC

CAGCGGTGCTACAGAACCGATTACTGTGAAGTTTGCCAACAACCCCAGCCAGAAGTCCAGCCAGGCCCTGCTCTCCCAGCTGTACCAGTCCCCCAACAGG

CGATACCCTGGCCCTCTCCACCACCAGGCTCAAAGATTCAG GCTGGACAATTTGCTTAATATGGCCTATGGCGTAAAGAG GTTCTCCCCAATCACCAT

TGACGGGATGACAAGTCTTGTGGGAATGAACATCCCTGGTCACACAGGGACAGGCTGGTGCATCTTCGTCTATAACCTGTCCCCTGATTCTGATGAGAGT

GTCCTCTGGCAGCTCTTTGGCCCCTTTGGCGCAGTGAACAACGTCAAGGTCATCCGTGACTTCAACACCAACAAGTGCAAGGGATTCGGCTTCGTCACCA

TGACCAACTACGATGAGGCAGCCATGGCCATCGCCAGCCTCAATGGCTATCGCCTGGGAGACAGAGTGTTGCAAGTTTCCTTTAAAACCAACAAAGCCCA

CAAATCCTGAATTTCTCACCCTTACTTATTAAAATATATATATAAATATATACGAACAAAACATGCGCGCACACACATACACAAAAGAGAGAGACAAACT

TTCCAAGGCTTATATTCAACCATGGACTTTATAAGCCCGCGTTGCCTAAGTATTAAAACATTGGATTATCCTGAGGTGTACCAGGAAAGGATTTTATAAT

GCTTAGAAAAAAAAAGAAAAAAAAAACAAAAAAATACCTTTGATGCATTGAATGTTCTTTCATAGCTGTCGTTGTTGAATATAATATACATAGATAGCAA

TGTGCAGGGATTTTTACCCAGCCAGCTAACTTTACCACCTTCCTTGAAGGTGGGTCTTTTTAAGATGACCATTCGCTCATTTGAAGAAGAAAAACAAAAA

ACACAAAAAAATAACAAACAATTTTTACAAAGTAATGGAATTCAAAGGAAGAAAAAAAAGATTTTTCTTTTTTGTCAAAAATGTTGATCCAATCAGATTG

GTTAAAAAACCCCCACACAAATTAAAGAGGAATAATAAAAATTGCAAAAATGAAAAAAAACTTTTGCAAATTTTTTTATTTTTCCTTTTTCTTTTATATC

ATGTGAACTAAAACAGTCTTCTGTTAGGGGACGGGGAAAGGGGGTGTACCTGATGACATTAACAATTTAATAACATTAACATTGTTGCCAAAGAGGTGGT

CTCTTTGCTGAAAATGGGTTTCAAGAAAAATCTATTTTTATAAAATATAAAGAATTTTTACAAGAGAATCTGGATTTGAGAAAAAATATTTTGACTGGCT

AATTTAGGGGAAATTGACAACTTTGTCGCGTTCATACTGCACTGGTAACTTTTTAGAGATCAAGATGTGTGTTTTAAACTGGATTCGTAGACTGTTTTTT

GAAGGATGGGCTATAAACAGATGATCTTCATATCTTTTCATAGCATGTAATAATAATAAAAAATATTAATTGCTAGGGAAAAGGAGTGTTCGTTCTACCC

AGGGTACCACAGTTCCCCACAGTCAAAACCCAAAAGCAAGGAGATGAGTTGAAAGACAGTTTTTCTTTAAGTCATCAGTATGGGATGTCAGCAGAACAAA

AATTAAAAAGATTCATTTTCCTTTTAATCTAAAACTTCCTTAGTTTGAGCAGTAGGTGCTACAGAATTATTTACATATCTTAGTATCATAGTTAAATGTA

AGCGTGTTTAGGAGAGGAGACACAAGATACATTTGCTTTACATTCGTTAAGCAATTTTCTAATTCACTTTGTAGCCCGTGCTGATAAAATTGGGCTGTGT

GGGTACATTTGAAACACTGTTTATGTTGCTTGAAACACTTATTTATTTAATTGCAGATGTGATGATGATGCCTCTGGCCAAGATCAAATATAGCTAGATT

GGCTAGACTACTTGTTTGTTTACTTAGACTTTGGGAAGAAGCATATTACTGTGTCCTTCTGTTGTGTGTGTGTATGTGTACATATAATATAAATATATAT

ATAAAGTTATTTTTTTCCTTTGGTTAATTTATTATAAGTTGTAACACTTGGCTAGTTTTGTTTGTATATGTCTTAAGATGTTTTCTTATGATATTTAAGT

GACAGTTAAAGAGGTATCAAGGTAACTTGTGTAGAACTATTGTTTGATATATTGTCATGTTTGTTGTGAATATTTTTTCTTACTGCACAGTAGAAAATTA

AAAAAAAAAACTGGGTCTTTATTTTAATGTAATTCAGATTGGGGAAAACTAAACAGAGCTAAGGGAACAAAAGGACCGTGGGAGCAAACTCCCACGTCCA

GTGCACTGATCATTTTAGTACGTTTGTGCTTTGTATGGTTATATATTT
Translation
MGLLLLREIVINESRNCSFM - UNI20666 - - UNI35402 - IISTMEPQVSNGPTSNTSNGPSSNNRNCPSPMQTGAATDDSKTNLIVNYLPQN

MTQEEFRSLFGSIGEIESCKLVRDKITG - UNI35402 - GQSLGYGFVNYIDPKDAEKAINTLNGLRLQTKTIK - UNI35402 - VSYARPSSA

SIRDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTG GVSRGVGFIRFDKRIEAEEAIKGLNGQKPSGATEPITVKFANNPSQKSSQALLSQL

YQSPNRRYPGPLHHQAQRFR RLDNLLNMAYGVKR RFSPITIDGMTSLVGMNIPGHTGTGWCIFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTN

KCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSFKTNKAHKS
Transcript ENSMUST00000106601
Sequence
CTGACTTGGAGTTTTGTGTGTTGCACGTGAATGCTCTGGAACTGCCCTAATCGACTGAAAATGAGCCAGCCACAGTCATATGGAACAG - UNI20666 

- - UNI30975 - - UNI35402 - ATAATTAGCACCATGGAGCCTCAGGTGTCAAATGGACCGACATCCAATACAAGCAATGGACCCTCCAGCAAC

AACAGAAACTGTCCTTCTCCCATGCAGACAGGCGCCGCCACAGATGACAGCAAAACCAACCTCATCGTCAACTATTTACCCCAGAATATGACCCAAGAGG

AATTCAGGAGTCTCTTTGGGAGCATTGGTGAAATAGAATCCTGCAAACTCGTGAGAGACAAAATCACAG - UNI35402 - GACAGAGTTTAGGGTAT

GGATTTGTTAACTATATTGATCCAAAGGATGCAGAGAAAGCCATCAACACTTTAAATGGACTCAGACTCCAGACCAAAACCATAAAG - UNI35402 -

 GTGTCCTACGCCCGCCCAAGCTCGGCCTCGATCAGGGATGCTAACCTGTATGTTAGTGGCCTTCCCAAGACCATGACCCAGAAGGAGCTGGAGCAGCTT

TTCTCTCAATACGGTCGCATCATCACCTCACGCATCCTGGTTGATCAAGTCACAG GGGTCTCTAGAGGGGTGGGATTCATCCGCTTTGATAAGAGGATT

GAGGCAGAAGAAGCCATCAAAGGACTGAATGGCCAGAAGCCCAGCGGTGCTACAGAACCGATTACTGTGAAGTTTGCCAACAACCCCAGCCAGAAGTCCA

GCCAGGCCCTGCTCTCCCAGCTGTACCAGTCCCCCAACAGGCGATACCCTGGCCCTCTCCACCACCAGGCTCAAAGATTCAG GCTGGACAATTTGCTTA

ATATGGCCTATGGCGTAAAGAG GTTCTCCCCAATCACCATTGACGGGATGACAAGTCTTGTGGGAATGAACATCCCTGGTCACACAGGGACAGGCTGGT

GCATCTTCGTCTATAACCTGTCCCCTGATTCTGATGAGAGTGTCCTCTGGCAGCTCTTTGGCCCCTTTGGCGCAGTGAACAACGTCAAGGTCATCCGTGA

CTTCAACACCAACAAGTGCAAGGGATTCGGCTTCGTCACCATGACCAACTACGATGAGGCAGCCATGGCCATCGCCAGCCTCAATGGCTATCGCCTGGGA

GACAGAGTGTTGCAAGTTTCCTTTAAAACCAACAAAGCCCACAAATCCTGAATTTCTCACCCTTACTTATTAAAATATATATATAAATATATACGAACAA

AACATGCGCGCACACACATACACAAAAGAGAGAGACAAACTTTCCAAGGCTTATATTCAACCATGGACTTTATAAGCCCGCGTTGCCTAAGTATTAAAAC

ATTGGATTATCCTGAGGTGTACCAGGAAAGGATTTTATAATGCTTAGAAAAAAAAAGAAAAAAAAAACAAAAAAATACCTTTGATGCATTGAATGTTCTT

TCATAGCTGTCGTTGTTGAATATAATATACATAGATAGCAATGTGCAGGGATTTTTACCCAGCCAGCTAACTTTACCACCTTCCTTGAAGGTGGGTCTTT

TTAAGATGACCATTCGCTCATTTGAAGAAGAAAAACAAAAAACACAAAAAAATAACAAACAATTTTTACAAAGTAATGGAATTCAAAGGAAGAAAAAAAA

GATTTTTCTTTTTTGTCAAAAATGTTGATCCAATCAGATTGGTTAAAAAACCCCCACACAAATTAAAGAGGAATAATAAAAATTGCAAAAATGAAAAAAA

ACTTTTGCAAATTTTTTTATTTTTCCTTTTTCTTTTATATCATGTGAACTAAAACAGTCTTCTGTTAGGGGACGGGGAAAGGGGGTGTACCTGATGACAT

TAACAATTTAATAACATTAACATTGTTGCCAAAGAGGTGGTCTCTTTGCTGAAAATGGGTTTCAAGAAAAATCTATTTTTATAAAATATAAAGAATTTTT

ACAAGAGAATCTGGATTTGAGAAAAAATATTTTGACTGGCTAATTTAGGGGAAATTGACAACTTTGTCGCGTTCATACTGCACTGGTAACTTTTTAGAGA

TCAAGATGTGTGTTTTAAACTGGATTCGTAGACTGTTTTTTGAAGGATGGGCTATAAACAGATGATCTTCATATCTTTTCATAGCATGTAATAATAATAA

AAAATATTAATTGCTAGGGAAAAGGAGTGTTCGTTCTACCCAGGGTACCACAGTTCCCCACAGTCAAAACCCAAAAGCAAGGAGATGAGTTGAAAGACAG

TTTTTCTTTAAGTCATCAGTATGGGATGTCAGCAGAACAAAAATTAAAAAGATTCATTTTCCTTTTAATCTAAAACTTCCTTAGTTTGAGCAGTAGGTGC

TACAGAATTATTTACATATCTTAGTATCATAGTTAAATGTAAGCGTGTTTAGGAGAGGAGACACAAGATACATTTGCTTTACATTCGTTAAGCAATTTTC

TAATTCACTTTGTAGCCCGTGCTGATAAAATTGGGCTGTGTGGGTACATTTGAAACACTGTTTATGTTGCTTGAAACACTTATTTATTTAATTGCAGATG

TGATGATGATGCCTCTGGCCAAGATCAAATATAGCTAGATTGGCTAGACTACTTGTTTGTTTACTTAGACTTTGGGAAGAAGCATATTACTGTGTCCTTC

TGTTGTGTGTGTGTATGTGTACATATAATATAAATATATATATAAAGTTATTTTTTTCCTTTGGTTAATTTATTATAAGTTGTAACACTTGGCTAGTTTT

GTTTGTATATGTCTTAAGATGTTTTCTTATGATATTTAAGTGACAGTTAAAGAGGTATCAAGGTAACTTGTGTAGAACTATTGTTTGATATATTGTCATG

TTTGTTGTGAATATTTTTTCTTACTGCACAGTAGAAAATTAAAAAAAAAAACTGGGTCTTTATTTTAATGTAATTCAGATTGGGGAAAACTAAACAGAGC

TAAGGGAACAAAAGGACCGTGGGAGCAAACTCCCACGTCCAGTGCACTGATCATTTTAGTACGTTTGTGCTTTGTATGGTTATATATTTAAAACAAAAAT

GAAACAAAAAAAAATACAAGAGTTCATGCTCTTCCCTGGGTAATAGAAACAGTTACTCGCTATGCATAATCTAGTTGATAGTAAAATTTGCTATTGCTTT

TCTTGTCTTGTTACATAAAATCTTTTCAATACAAGTTTAGTCTTAATGGTAATAAAACGTTATGGTTATTTATAACTTGTGCTTATTTTGTGCATTTTTT

CCCATGCTGAACCCACTAAGTGCATGTAGACAGGACTGTTGTTTGCACATTGAAGAGGCAAACTTTGTAGTAGTCGTTGTAGTGGTAGACAGATAACGAA

AACCGAGGCTGCATCATAGACTACTCCTTTAAATTTTTTTTCTATTTTTTTTTCCTCTTTTCGGTTTTTGGAGAAAAATAAATAACACCAGATTTCAGTT

CAGAGAACACTCGTTCAACATTCAGGGAAACCTTTATATGTCACCTGCTATGAATGAATGCAGTTTGCTGGCAAAGTTCTGATGCATTTGCTAAGCATTC

ATGGGAAAGGCATGCCAAAATCTCTTCTCTATGATGTGTTCAATCTGAGGGAAAAAAAAGGAAAAAAAATCTTAGGACCAGGCAGTTGTATACTTTAGTT

ATAAATGAATGACTTCATGTTAATCTTGCTAGTTTAGATGATTTCTGAGGGAAAGTATTGTAAATGTTTTTTTTTCATAATCTTGTTGTGTTTGAATTAT

TTGTACTTTATCTGTCCAGACAATAAATGAAAGTGTGTAGAATGAA
Translation
MEQ - UNI20666 - - UNI30975 - - UNI35402 - IISTMEPQVSNGPTSNTSNGPSSNNRNCPSPMQTGAATDDSKTNLIVNYLPQNMTQE

EFRSLFGSIGEIESCKLVRDKITG - UNI35402 - GQSLGYGFVNYIDPKDAEKAINTLNGLRLQTKTIK - UNI35402 - VSYARPSSASIRD

ANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTG GVSRGVGFIRFDKRIEAEEAIKGLNGQKPSGATEPITVKFANNPSQKSSQALLSQLYQSP

NRRYPGPLHHQAQRFR RLDNLLNMAYGVKR RFSPITIDGMTSLVGMNIPGHTGTGWCIFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKG

FGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSFKTNKAHKS
Transcript ENSMUST00000106603
Sequence
ATGAGGCTCCAGAACCAG - UNI20666 - - UNI30975 - - UNI35402 - ATAATTAGCACCATGGAGCCTCAGGTGTCAAATGGACCGACA

TCCAATACAAGCAATGGACCCTCCAGCAACAACAGAAACTGTCCTTCTCCCATGCAGACAGGCGCCGCCACAGATGACAGCAAAACCAACCTCATCGTCA

ACTATTTACCCCAGAATATGACCCAAGAGGAATTCAGGAGTCTCTTTGGGAGCATTGGTGAAATAGAATCCTGCAAACTCGTGAGAGACAAAATCACAG 

- UNI35402 - GACAGAGTTTAGGGTATGGATTTGTTAACTATATTGATCCAAAGGATGCAGAGAAAGCCATCAACACTTTAAATGGACTCAGACTCC

AGACCAAAACCATAAAG - UNI35402 - GTGTCCTACGCCCGCCCAAGCTCGGCCTCGATCAGGGATGCTAACCTGTATGTTAGTGGCCTTCCCAAG

ACCATGACCCAGAAGGAGCTGGAGCAGCTTTTCTCTCAATACGGTCGCATCATCACCTCACGCATCCTGGTTGATCAAGTCACAG GGGTCTCTAGAGGG

GTGGGATTCATCCGCTTTGATAAGAGGATTGAGGCAGAAGAAGCCATCAAAGGACTGAATGGCCAGAAGCCCAGCGGTGCTACAGAACCGATTACTGTGA

AGTTTGCCAACAACCCCAGCCAGAAGTCCAGCCAGGCCCTGCTCTCCCAGCTGTACCAGTCCCCCAACAGGCGATACCCTGGCCCTCTCCACCACCAGGC

TCAAAGATTCAG GTTCTCCCCAATCACCATTGACGGGATGACAAGTCTTGTGGGAATGAACATCCCTGGTCACACAGGGACAGGCTGGTGCATCTTCGT

CTATAACCTGTCCCCTGATTCTGATGAGAGTGTCCTCTGGCAGCTCTTTGGCCCCTTTGGCGCAGTGAACAACGTCAAGGTCATCCGTGACTTCAACACC

AACAAGTGCAAGGGATTCGGCTTCGTCACCATGACCAACTACGATGAGGCAGCCATGGCCATCGCCAGCCTCAATGGCTATCGCCTGGGAGACAGAGTGT

TGCAAGTTTCCTTTAAAACCAACAAAGCCCACAAATCCTGAATTTCTCACCCTTACTTATTAAAATATATATATAAATATATACGAACAAAACATGCGCG

CACACACATACACAAAAGAGAGAGACAAACTTTCCAAGGCTTATATTCAACCATGGACTTTATAAGCCCGCGTTGCCTAAGTATTAAAACATTGGATTAT

CCTGAGGTGTACCAGGAAAGGATTTTATAATGCTTAGAAAAAAAAAGAAAAAAAAAACAAAAAAATACCTTTGATGCATTGAATGTTCTTTCATAGCTGT

CGTTGTTGAATATAATATACATAGATAGCAATGTGCAGGGATTTTTACCCAGCCAGCTAACTTTACCACCTTCCTTGAAGGTGGGTCTTTTTAAGATGAC

CATTCGCTCATTTGAAGAAGAAAAACAAAAAACACAAAAAAATAACAAACAATTTTTACAAAGTAATGGAATTCAAAGGAAGAAAAAAAAGATTTTTCTT

TTTTGTCAAAAATGTTGATCCAATCAGATTGGTTAAAAAACCCCCACACAAATTAAAGAGGAATAATAAAAATTGCAAAAATGAAAAAAAACTTTTGCAA

ATTTTTTTATTTTTCCTTTTTCTTTTATATCATGTGAACTAAAACAGTCTTCTGTTAGGGGACGGGGAAAGGGGGTGTACCTGATGACATTAACAATTTA

ATAACATTAACATTGTTGCCAAAGAGGTGGTCTCTTTGCTGAAAATGGGTTTCAAGAAAAATCTATTTTTATAAAATATAAAGAATTTTTACAAGAGAAT

CTGGATTTGAGAAAAAATATTTTGACTGGCTAATTTAGGGGAAATTGACAACTTTGTCGCGTTCATACTGCACTGGTAACTTTTTAGAGATCAAGATGTG

TGTTTTAAACTGGATTCGTAGACTGTTTTTTGAAGGATGGGCTATAAACAGATGATCTTCATATCTTTTCATAGCATGTAATAATAATAAAAAATATTAA

TTGCTAGGGAAAAGGAGTGTTCGTTCTACCCAGGGTACCACAGTTCCCCACAGTCAAAACCCAAAAGCAAGGAGATGAGTTGAAAGACAGTTTTTCTTTA

AGTCATCAGTATGGGATGTCAGCAGAACAAAAATTAAAAAGATTCATTTTCCTTTTAATCTAAAACTTCCTTAGTTTGAGCAGTAGGTGCTACAGAATTA

TTTACATATCTTAGTATCATAGTTAAATGTAAGCGTGTTTAGGAGAGGAGACACAAGATACATTTGCTTTACATTCGTTAAGCAATTTTCTAATTCACTT

TGTAGCCCGTGCTGATAAAATTGGGCTGTGTGGGTACATTTGAAACACTGTTTATGTTGCTTGAAACACTTATTTATTTAATTGCAGATGTGATGATGAT

GCCTCTGGCCAAGATCAAATATAGCTAGATTGGCTAGACTACTTGTTTGTTTACTTAGACTTTGGGAAGAAGCATATTACTGTGTCCTTCTGTTGTGTGT

GTGTATGTGTACATATAATATAAATATATATATAAAGTTATTTTTTTCCTTTGGTTAATTTATTATAAGTTGTAACACTTGGCTAGTTTTGTTTGTATAT

GTCTTAAGATGTTTTCTTATGATATTTAAGTGACAGTTAAAGAGGTATCAAGGTAACTTGTGTAGAACTATTGTTTGATATATTGTCATGTTTGTTGTGA

ATATTTTTTCTTACTGCACAGTAGAAAATTAAAAAAAAAAACTGGGTCTTTATTTTAATGTAATTCAGATTGGGGAAAACTAAACAGAGCTAAGGGAACA

AAAGGACCGTGGGAGCAAACTCCCACGTCCAGTGCACTGATCATTTTAGTACGTTTGTGCTTTGTATGGTTATATATTT
Translation
MRLQNQ - UNI20666 - - UNI30975 - - UNI35402 - IISTMEPQVSNGPTSNTSNGPSSNNRNCPSPMQTGAATDDSKTNLIVNYLPQNM

TQEEFRSLFGSIGEIESCKLVRDKITG - UNI35402 - GQSLGYGFVNYIDPKDAEKAINTLNGLRLQTKTIK - UNI35402 - VSYARPSSAS

IRDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTG GVSRGVGFIRFDKRIEAEEAIKGLNGQKPSGATEPITVKFANNPSQKSSQALLSQLY

QSPNRRYPGPLHHQAQRFR RFSPITIDGMTSLVGMNIPGHTGTGWCIFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEA

AMAIASLNGYRLGDRVLQVSFKTNKAHKS

For any suggestions or comments, please send an email to unitrap@crg.es