Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000028559 (Osbpl9)
Chromosomal location
Chr 4: 108734260 - 108874821 (-)
Description
oxysterol binding protein-like 9 Gene [Source:MGI (curated);Acc:Osbpl9-001]
RefSeq_dna
NM_133885 
RefSeq_peptide
NP_775485.2 NP_001128263.1 NP_598646.2 
MGI
MGI:1923784 
Uniprot/SPTREMBL
A2A8Z0 Q8VDM5 Q99LZ2 A2A9Q6 A2A9Q7 A2A9Q8 Q5FWX7 Q8R0G3 A2A8Z1 
Human Ortholog
ENSG00000117859 (OSBPL9)
Omim not available
UniTrap UNI28886
Vector Insertion
Chr 4: 108844878 - 108844930
Public Clones not available
Private Clones OST17177 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36235
Vector Insertion
Chr 4: 108844878 - 108874822
Public Clones IST11055C5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7451
Vector Insertion
Chr 4: 108834982 - 108844878
Public Clones RRT048 (baygenomics) RRN339 (baygenomics) XL643 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20157
Vector Insertion
Chr 4: 108806426 - 108829259
Public Clones CMHD-GT_330E10-3 (cmhd) IST11254G6 (tigm)
Private Clones OST371085 (lexicon) OST371083 (lexicon) OST283279 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28855
Vector Insertion
Chr 4: 108775101 - 108775198
Public Clones not available
Private Clones OST17857 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34097
Vector Insertion
Chr 4: 108775101 - 108790527
Public Clones IST14418E9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22796
Vector Insertion
Chr 4: 108771107 - 108771159
Public Clones not available
Private Clones OST284491 (lexicon) OST15004 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7051
Vector Insertion
Chr 4: 108745755 - 108755693
Public Clones RRY059 (baygenomics) D139A07 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 24% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000106634
Sequence
ATGCAGACTCAAAGAGGGTCCTGGCTGTTGTTGAAGAGTCTTGCATATGTGCACCAGCAGCTGGGGCTGGTGAAGAGGAGAGAAAAG GGAGCTGTGATT

GGTATAGACGACGAGGACGACAGCACCTTCACAATCACTGTCGATCAGAAAACCTTCCACTTCCAGG - UNI20157 - CTCGAGATGCAGACGAGCG

AGAGAAGTGGATCCATGCCTTAGAAGAAACTATTCTTCGCCATACTCTTCAGCTTCAA - UNI28855 - - UNI34097 - GGTTTGGATTCAGGA

TTCATCCCCAGTGTCCAAGACTTTGATAAGAAACTTACCGAGGCTGACGCGTACCTGCAGATCTTGATAGAACAATTAAAG - UNI28855 - - UNI

34097 - CTTTTTGATGACAAGCTTCAAAATTGTAAAGATGATGAACAGAGAAAG AAAGTTGAAACTCTCAAAGACA
Translation
MQTQRGSWLLLKSLAYVHQQLGLVKRREK GAVIGIDDEDDSTFTITVDQKTFHFQA - UNI20157 - ARDADEREKWIHALE - UNI28855 - 

- UNI34097 -  - UNI28855 - - UNI34097 -  
Transcript ENSMUST00000084365
Sequence
GATGGCGTCCATCGTGGAAGGGCCGCTGAGCAAATGGACTAACGTGATGAAGGGATGGCAGTATCGTTGGTTCGTGCTGGACTACAATGCAGGGCTGCTC

TCCTACTACACG - UNI28886 - - UNI36235 - TCCAAGGACAAAATGATGAGAGGCTCTCGAAGAGGATGCGTTAGACTCAGA - UNI7451

 - - UNI28886 - - UNI36235 - GGAGCTGTGATTGGTATAGACGACGAGGACGACAGCACCTTCACAATCACTGTCGATCAGAAAACCTTCCA

CTTCCAGG - UNI20157 - CTCGAGATGCAGACGAGCGAGAGAAGTGGATCCATGCCTTAGAAGAAACTATTCTTCGCCATACTCTTCAGCTTCAA 

- UNI28855 - - UNI34097 - GGTTTGGATTCAGGATTCATCCCCAGTGTCCAAGACTTTGATAAGAAACTTACCGAGGCTGACGCGTACCTGCA

GATCTTGATAGAACAATTAAAG - UNI28855 - - UNI34097 - CTTTTTGATGACAAGCTTCAAAATTGTAAAGATGATGAACAGAGAAAG AA

AGTTGAAACTCTCAAAGACACAACAAAT - UNI22796 - AGCATGGTAGAATCAATTAAACACTGCATTGTGTTGCTACAGATTGCTAAA - UNI2

2796 - AGTACTATTAATCCTGTAGATGCAATATACCAGCCTAGTCCCTTGGAACCTGTGATCAGCACAATGCCTTCCCAGACTGCCTTACCTCCAG A

ACCCGCTCAGTTGTGTAAGTCAGAGCAGCGTCCATCTTCCTTACCTGTTGGACCTGTGTTAGCTACCTTGGGACATCATCAGACTCCAACACCAAATAGT

ACAG GCAGTGGGAACTCACCACCTAGCAGCAGTCTGACTCCTCCCAGCCATGTCAACTTGTCTCCAAATACAGTCCCAGAGTTCTCTTACTCTAGCAGT

GAAGATGAGTTCTATGATGCTGATGAATTCCATCAAAGTGGCTCGTCCCCAAAGCGCTTAATAGA - UNI7051 - TTCTTCTGGATCTGCCTCAGTC

TTGACACACAGCAGCTCCGGAAATAGCTTAAAACGCCCAGATACCACAGAGTCTCTGAATTCCTCCATGTCCAATGGCACAAGCGATGCTG ATCTTTTT

GACTCACATGACGACAGAGATGATGATGGGGAGGCTGGGTCAGTGGAGGAGCACAAGAGCGTTATCATGCACCTCTTATCACAAGTCAGGCTGGGGATGG

ACCTCACAAAG GTAGTTCTTCCAACGTTTATTCTCGAGAGAAGATCTCTGTTAGAAATGTATGCAGACTTTTTCGCACATCCAGACCTGTTCGTGAG C

ATTAGTGATCAGAAGGATCCCAGGGATCGAATGGTTCAGGTTGTGAAATGGTACCTCTCGGCCTTCCATGCAGGAAGGAGAGGATCGGTGGCCAAAAAGC

CGTACAATCCTATTTTGGGTGAGATCTTTCAGTGTCACTGGACGTTGCCGAATGATACTGAAGAGAACGCA GAGCTCGTTTCAGAAGGGCCGGTTCCCT

GGGTTTCTAAGAACAGTGTAACATTTGTGGCTGAGCAAGTTTCCCACCATCCGCCCA TTTCAGCCTTTTATGCTGAGTGTTTTAACAAGAAGATACAAT

TCAATGCTCATATCTGGACTAAATCAAAATTCCTTGGGATGTCAATTGGGGTACACAACATAGGTCAGG GCTGTGTCTCGTGTCTGGAGTACGATGAGC

ACTACATCCTCACGTTCCCCAATGGCTATGGAAG GTCTATCCTGACAGTGCCCTGGGTGGAATTGGGAGGAGAATGCAATATCAACTGCTCCAAAACGG

GTTACAGCGCAAACATCGTCTTCCACACTAAGCCTTTCTATGGGGGCAAGAAGCACAGAATTACTGCAGAGATTTT TTCTCCGAATGACAAGAAATCCT

TCTGCTCAATTGAAGGGGAATGGAATGGTATCATGTATGCAAAATACGCAACAGGG GAAAACACTGTCTTTGTAGACACCAAGAAATTGCCTATAATCA

AGAAAAAGGTGAGGAAGTTGGAAGATCAGAATGAGTATGAGTCCCGCAG CCTTTGGAAGGATGTCACTTTCAATTTAAAAATCAGAGACATTGATGCAG

CAACGGAAGCAAAGCACAGACTTGAAGAAAGACAAAGAGCAGAAGCCCGAGAAAGGAAGGAGAAGGAAATTCAGTGGGAGACGAGG CTCTTTCACGAGG

ATGGCGAATGCTGGGTTTACGATGAGCCTTTACTGAAGCGTCTTGGTGCTGTGAAGCATTAGGCCGACAACCGAGTCCACACCTGGTGACCAGGGCAGTA

GGCGTAATTAAGCAACAATCGATCTTCCTTCAGGAGAGCTTGTCACTTCCTTCTTAACGCAGTGGTTCCTATCTCAGGGATACTGGACTTGACGACACAG

ATGAACAATTAAAGTGGAAACCGCTTCCCTTTTCTCCTCTGTGGCAGTTACAATTTTGACTTCAGGCCTGAGAAAAACTTCAGGTTTCGAAACATGACAT

CTCTTCCTTTTCCAGATCCCATGCTTTGAAAAATATTTATAGACAGTTCCAGGTCTCAGCTTCCTGTCCTCTAGTTCTGCTGTTCGGGCATAAAATCTTT

ATCTCCAGTTCATATAATCTTGAGTTTTAGATATACACACATGCGTAACAGCTGACAGTTTTTCACAAGTACACCCACCTGTAAATACTGTATCCTCAGT

TTAGAAAATTAGTGCAATGTATGAAAATCAAGTGTTAGGAAATTTCATGGTTTCACCTATAACCTTTATTTTAGAATTGAACTATGATTAGATTGTATCT

AAACCTGAAGTATAATTATATGCAGTGCTTCTTAAGGCTTCATAAAATAATTTTCCAACCTTTTT
Translation
 - UNI28886 - - UNI36235 -  - UNI7451 - - UNI28886 - - UNI36235 -  - UNI20157 -  - UNI28855 - - UNI3

4097 -  - UNI28855 - - UNI34097 -   - UNI22796 - MVESIKHCIVLLQIAK - UNI22796 - STINPVDAIYQPSPLEPVIST

MPSQTALPPE EPAQLCKSEQRPSSLPVGPVLATLGHHQTPTPNSTG GSGNSPPSSSLTPPSHVNLSPNTVPEFSYSSSEDEFYDADEFHQSGSSPKRL

ID - UNI7051 - DSSGSASVLTHSSSGNSLKRPDTTESLNSSMSNGTSDAD DLFDSHDDRDDDGEAGSVEEHKSVIMHLLSQVRLGMDLTK VVLP

TFILERRSLLEMYADFFAHPDLFVS SISDQKDPRDRMVQVVKWYLSAFHAGRRGSVAKKPYNPILGEIFQCHWTLPNDTEENA ELVSEGPVPWVSKNS

VTFVAEQVSHHPPI ISAFYAECFNKKIQFNAHIWTKSKFLGMSIGVHNIGQG GCVSCLEYDEHYILTFPNGYGR RSILTVPWVELGGECNINCSKTG

YSANIVFHTKPFYGGKKHRITAEIF FSPNDKKSFCSIEGEWNGIMYAKYATG ENTVFVDTKKLPIIKKKVRKLEDQNEYESRS SLWKDVTFNLKIRD

IDAATEAKHRLEERQRAEARERKEKEIQWETR LFHEDGECWVYDEPLLKRLGAVKH
Transcript ENSMUST00000084366
Sequence
ATGGCTCTCCTGCTGGCCGCTTGCGGA - UNI28855 - - UNI34097 - GGTTTGGATTCAGGATTCATCCCCAGTGTCCAAGACTTTGATAAGA

AACTTACCGAGGCTGACGCGTACCTGCAGATCTTGATAGAACAATTAAAG - UNI28855 - - UNI34097 - CTTTTTGATGACAAGCTTCAAAA

TTGTAAAGATGATGAACAGAGAAAG AAAGTTGAAACTCTCAAAGACACAACAAAT - UNI22796 - AGCATGGTAGAATCAATTAAACACTGCATT

GTGTTGCTACAGATTGCTAAA - UNI22796 - GACCAGAGTAATGCGGAGCAGCACGCAGATGGAATTATA AGTACTATTAATCCTGTAGATGCAA

TATACCAGCCTAGTCCCTTGGAACCTGTGATCAGCACAATGCCTTCCCAGACTGCCTTACCTCCAG AACCCGCTCAGTTGTGTAAGTCAGAGCAGCGTC

CATCTTCCTTACCTGTTGGACCTGTGTTAGCTACCTTGGGACATCATCAGACTCCAACACCAAATAGTACAG GCAGTGGGAACTCACCACCTAGCAGCA

GTCTGACTCCTCCCAGCCATGTCAACTTGTCTCCAAATACAGTCCCAGAGTTCTCTTACTCTAGCAGTGAAGATGAGTTCTATGATGCTGATGAATTCCA

TCAAAGTGGCTCGTCCCCAAAGCGCTTAATAGA - UNI7051 - TTCTTCTGGATCTGCCTCAGTCTTGACACACAGCAGCTCCGGAAATAGCTTAAA

ACGCCCAGATACCACAGAGTCTCTGAATTCCTCCATGTCCAATGGCACAAGCGATGCTG ATCTTTTTGACTCACATGACGACAGAGATGATGATGGGGA

GGCTGGGTCAGTGGAGGAGCACAAGAGCGTTATCATGCACCTCTTATCACAAGTCAGGCTGGGGATGGACCTCACAAAG GTAGTTCTTCCAACGTTTAT

TCTCGAGAGAAGATCTCTGTTAGAAATGTATGCAGACTTTTTCGCACATCCAGACCTGTTCGTGAG CATTAGTGATCAGAAGGATCCCAGGGATCGAAT

GGTTCAGGTTGTGAAATGGTACCTCTCGGCCTTCCATGCAGGAAGGAGAGGATCGGTGGCCAAAAAGCCGTACAATCCTATTTTGGGTGAGATCTTTCAG

TGTCACTGGACGTTGCCGAATGATACTGAAGAGAACGCA GAGCTCGTTTCAGAAGGGCCGGTTCCCTGGGTTTCTAAGAACAGTGTAACATTTGTGGCT

GAGCAAGTTTCCCACCATCCGCCCA TTTCAGCCTTTTATGCTGAGTGTTTTAACAAGAAGATACAATTCAATGCTCATATCTGGACTAAATCAAAATTC

CTTGGGATGTCAATTGGGGTACACAACATAGGTCAGG GCTGTGTCTCGTGTCTGGAGTACGATGAGCACTACATCCTCACGTTCCCCAATGGCTATGGA

AG GTCTATCCTGACAGTGCCCTGGGTGGAATTGGGAGGAGAATGCAATATCAACTGCTCCAAAACGGGTTACAGCGCAAACATCGTCTTCCACACTAAG

CCTTTCTATGGGGGCAAGAAGCACAGAATTACTGCAGAGATTTT TTCTCCGAATGACAAGAAATCCTTCTGCTCAATTGAAGGGGAATGGAATGGTATC

ATGTATGCAAAATACGCAACAGGG GAAAACACTGTCTTTGTAGACACCAAGAAATTGCCTATAATCAAGAAAAAGGTGAGGAAGTTGGAAGATCAGAAT

GAGTATGAGTCCCGCAG CCTTTGGAAGGATGTCACTTTCAATTTAAAAATCAGAGACATTGATGCAGCAACGGAAGCAAAGCACAGACTTGAAGAAAGA

CAAAGAGCAGAAGCCCGAGAAAGGAAGGAGAAGGAAATTCAGTGGGAGACGAGG CTCTTTCACGAGGATGGCGAATGCTGGGTTTACGATGAGCCTTTA

CTGAAGCGTCTTGGTGCTGTGAAGCATTAGGCCGACAACCGAGTCCACACCTGGTGACCAGGGCAGTAGGCGTAATTAAGCAACAATCGATCTTCCTTCA

GGAGAGCTTGTCACTTCCTTCTTAACGCAGTGGTTCCTATCTCAGGGATACTGGACTTGACGACACAGATGAACAATTAAAGTGGAAACCGCTTCCCTTT

TCTCCTCTGTGGCAGTTACAATTTTGACTTCAGGCCTGAGAAAAACTTCAGGTTTCGAAACATGACATCTCTTCCTTTTCCAGATCCCATGCTTTGAAAA

ATATTTATAGACAGTTCCAGGTCTCAGCTTCCTGTCCTCTAGTTCTGCTGTTCGGGCATAAAATCTTTATCTCCAGTTCATATAATCTTGAGTTTTAGAT

ATACACACATGCGTAACAGCTGACAGTTTTTCACAAGTACACCCACCTGTAAATACTGTATCCTCAGTTTAGAAAATTAGTGCAATGTATGAAAATCAAG

TGTTAGGAAATTTCATGGTTTCACCTATAACCTTTATTTTAGAATTGAACTATGATTAGATTGTATCTAAACCTGAAGTATAATTATATGCAGTGCTTCT

TAAGGCTTCATAAAATAATTTTCCAACCTTTTT
Translation
MALLLAACG - UNI28855 - - UNI34097 - GLDSGFIPSVQDFDKKLTEADAYLQILIEQLK - UNI28855 - - UNI34097 - LFDDK

LQNCKDDEQRK KVETLKDTTN - UNI22796 - SMVESIKHCIVLLQIAK - UNI22796 - DQSNAEQHADGII STINPVDAIYQPSPLEPVI

STMPSQTALPPE EPAQLCKSEQRPSSLPVGPVLATLGHHQTPTPNSTG GSGNSPPSSSLTPPSHVNLSPNTVPEFSYSSSEDEFYDADEFHQSGSSPK

RLID - UNI7051 - DSSGSASVLTHSSSGNSLKRPDTTESLNSSMSNGTSDAD DLFDSHDDRDDDGEAGSVEEHKSVIMHLLSQVRLGMDLTK VV

LPTFILERRSLLEMYADFFAHPDLFVS SISDQKDPRDRMVQVVKWYLSAFHAGRRGSVAKKPYNPILGEIFQCHWTLPNDTEENA ELVSEGPVPWVSK

NSVTFVAEQVSHHPPI ISAFYAECFNKKIQFNAHIWTKSKFLGMSIGVHNIGQG GCVSCLEYDEHYILTFPNGYGR RSILTVPWVELGGECNINCSK

TGYSANIVFHTKPFYGGKKHRITAEIF FSPNDKKSFCSIEGEWNGIMYAKYATG ENTVFVDTKKLPIIKKKVRKLEDQNEYESRS SLWKDVTFNLKI

RDIDAATEAKHRLEERQRAEARERKEKEIQWETR LFHEDGECWVYDEPLLKRLGAVKH
Transcript ENSMUST00000030288
Sequence
GATGGCGTCCATCGTGGAAGGGCCGCTGAGCAAATGGACTAACGTGATGAAGGGATGGCAGTATCGTTGGTTCGTGCTGGACTACAATGCAGGGCTGCTC

TCCTACTACACG - UNI28886 - - UNI36235 - TCCAAGGACAAAATGATGAGAGGCTCTCGAAGAGGATGCGTTAGACTCAGA - UNI7451

 - - UNI28886 - - UNI36235 - GGAGCTGTGATTGGTATAGACGACGAGGACGACAGCACCTTCACAATCACTGTCGATCAGAAAACCTTCCA

CTTCCAGG - UNI20157 - CTCGAGATGCAGACGAGCGAGAGAAGTGGATCCATGCCTTAGAAGAAACTATTCTTCGCCATACTCTTCAGCTTCAA 

- UNI28855 - - UNI34097 - GGTTTGGATTCAGGATTCATCCCCAGTGTCCAAGACTTTGATAAGAAACTTACCGAGGCTGACGCGTACCTGCA

GATCTTGATAGAACAATTAAAG - UNI28855 - - UNI34097 - CTTTTTGATGACAAGCTTCAAAATTGTAAAGATGATGAACAGAGAAAG AA

AGTTGAAACTCTCAAAGACACAACAAAT - UNI22796 - AGCATGGTAGAATCAATTAAACACTGCATTGTGTTGCTACAGATTGCTAAA - UNI2

2796 - GACCAGAGTAATGCGGAGCAGCACGCAGATGGAATTATA AGTACTATTAATCCTGTAGATGCAATATACCAGCCTAGTCCCTTGGAACCTGT

GATCAGCACAATGCCTTCCCAGACTGCCTTACCTCCAG AACCCGCTCAGTTGTGTAAGTCAGAGCAGCGTCCATCTTCCTTACCTGTTGGACCTGTGTT

AGCTACCTTGGGACATCATCAGACTCCAACACCAAATAGTACAG GCAGTGGGAACTCACCACCTAGCAGCAGTCTGACTCCTCCCAGCCATGTCAACTT

GTCTCCAAATACAGTCCCAGAGTTCTCTTACTCTAGCAGTGAAGATGAGTTCTATGATGCTGATGAATTCCATCAAAGTGGCTCGTCCCCAAAGCGCTTA

ATAGA - UNI7051 - TTCTTCTGGATCTGCCTCAGTCTTGACACACAGCAGCTCCGGAAATAGCTTAAAACGCCCAGATACCACAGAGTCTCTGAAT

TCCTCCATGTCCAATGGCACAAGCGATGCTG ATCTTTTTGACTCACATGACGACAGAGATGATGATGGGGAGGCTGGGTCAGTGGAGGAGCACAAGAGC

GTTATCATGCACCTCTTATCACAAGTCAGGCTGGGGATGGACCTCACAAAG GTAGTTCTTCCAACGTTTATTCTCGAGAGAAGATCTCTGTTAGAAATG

TATGCAGACTTTTTCGCACATCCAGACCTGTTCGTGAG CATTAGTGATCAGAAGGATCCCAGGGATCGAATGGTTCAGGTTGTGAAATGGTACCTCTCG

GCCTTCCATGCAGGAAGGAGAGGATCGGTGGCCAAAAAGCCGTACAATCCTATTTTGGGTGAGATCTTTCAGTGTCACTGGACGTTGCCGAATGATACTG

AAGAGAACGCA GAGCTCGTTTCAGAAGGGCCGGTTCCCTGGGTTTCTAAGAACAGTGTAACATTTGTGGCTGAGCAAGTTTCCCACCATCCGCCCA TT

TCAGCCTTTTATGCTGAGTGTTTTAACAAGAAGATACAATTCAATGCTCATATCTGGACTAAATCAAAATTCCTTGGGATGTCAATTGGGGTACACAACA

TAGGTCAGG GCTGTGTCTCGTGTCTGGAGTACGATGAGCACTACATCCTCACGTTCCCCAATGGCTATGGAAG GTCTATCCTGACAGTGCCCTGGGTG

GAATTGGGAGGAGAATGCAATATCAACTGCTCCAAAACGGGTTACAGCGCAAACATCGTCTTCCACACTAAGCCTTTCTATGGGGGCAAGAAGCACAGAA

TTACTGCAGAGATTTT TTCTCCGAATGACAAGAAATCCTTCTGCTCAATTGAAGGGGAATGGAATGGTATCATGTATGCAAAATACGCAACAGGG GAA

AACACTGTCTTTGTAGACACCAAGAAATTGCCTATAATCAAGAAAAAGGTGAGGAAGTTGGAAGATCAGAATGAGTATGAGTCCCGCAG CCTTTGGAAG

GATGTCACTTTCAATTTAAAAATCAGAGACATTGATGCAGCAACGGAAGCAAAGCACAGACTTGAAGAAAGACAAAGAGCAGAAGCCCGAGAAAGGAAGG

AGAAGGAAATTCAGTGGGAGACGAGG CTCTTTCACGAGGATGGCGAATGCTGGGTTTACGATGAGCCTTTACTGAAGCGTCTTGGTGCTGTGAAGCATT

AGGCCGACAACCGAGTCCACACCTGGTGACCAGGGCAGTAGGCGTAATTAAGCAACAATCGATCTTCCTTCAGGAGAGCTTGTCACTTCCTTCTTAACGC

AGTGGTTCCTATCTCAGGGATACTGGACTTGACGACACAGATGAACAATTAAAGTGGAAACCGCTTCCCTTTTCTCCTCTGTGGCAGTTACAATTTTGAC

TTCAGGCCTGAGAAAAACTTCAGGTTTCGAAACATGACATCTCTTCCTTTTCCAGATCCCATGCTTTGAAAAATATTTATAGACAGTTCCAGGTCTCAGC

TTCCTGTCCTCTAGTTCTGCTGTTCGGGCATAAAATCTTTATCTCCAGTTCATATAATCTTGAGTTTTAGATATACACACATGCGTAACAGCTGACAGTT

TTTCACAAGTACACCCACCTGTAAATACTGTATCCTCAGTTTAGAAAATTAGTGCAATGTATGAAAATCAAGTGTTAGGAAATTTCATGGTTTCACCTAT

AACCTTTATTTTAGAATTGAACTATGATTAGATTGTATCTAAACCTGAAGTATAATTATATGCAGTGCTTCTTAAGGCTTCATAAAATAATTTTCCAACC

TTTTT
Translation
MASIVEGPLSKWTNVMKGWQYRWFVLDYNAGLLSYYT - UNI28886 - - UNI36235 - SKDKMMRGSRRGCVRLR - UNI7451 - - UNI2

8886 - - UNI36235 - GAVIGIDDEDDSTFTITVDQKTFHFQA - UNI20157 - ARDADEREKWIHALEETILRHTLQLQ - UNI28855 -

 - UNI34097 - GLDSGFIPSVQDFDKKLTEADAYLQILIEQLK - UNI28855 - - UNI34097 - LFDDKLQNCKDDEQRK KVETLKDTTN

 - UNI22796 - SMVESIKHCIVLLQIAK - UNI22796 - DQSNAEQHADGII STINPVDAIYQPSPLEPVISTMPSQTALPPE EPAQLCKSE

QRPSSLPVGPVLATLGHHQTPTPNSTG GSGNSPPSSSLTPPSHVNLSPNTVPEFSYSSSEDEFYDADEFHQSGSSPKRLID - UNI7051 - DSSGS

ASVLTHSSSGNSLKRPDTTESLNSSMSNGTSDAD DLFDSHDDRDDDGEAGSVEEHKSVIMHLLSQVRLGMDLTK VVLPTFILERRSLLEMYADFFAHP

DLFVS SISDQKDPRDRMVQVVKWYLSAFHAGRRGSVAKKPYNPILGEIFQCHWTLPNDTEENA ELVSEGPVPWVSKNSVTFVAEQVSHHPPI ISAFY

AECFNKKIQFNAHIWTKSKFLGMSIGVHNIGQG GCVSCLEYDEHYILTFPNGYGR RSILTVPWVELGGECNINCSKTGYSANIVFHTKPFYGGKKHRI

TAEIF FSPNDKKSFCSIEGEWNGIMYAKYATG ENTVFVDTKKLPIIKKKVRKLEDQNEYESRS SLWKDVTFNLKIRDIDAATEAKHRLEERQRAEAR

ERKEKEIQWETR LFHEDGECWVYDEPLLKRLGAVKH

For any suggestions or comments, please send an email to unitrap@crg.es