Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000028577 (Plaa)
Chromosomal location
Chr 4: 94231830 - 94269942 (-)
Description
phospholipase A2, activating protein Gene [Source:MGI (curated);Acc:Plaa-001]
RefSeq_dna
NM_172695 
RefSeq_peptide
NP_766283.2 
UniGene
Mm.474094 Mm.22724 Mm.370954 
MGI
MGI:104810 
Uniprot/SWISSPROT
P27612 
Uniprot/SPTREMBL
B1AWF9 A4QPD6 
Human Ortholog
ENSG00000137055 (PLAA)
Omim not available
UniTrap UNI7630
Vector Insertion
Chr 4: 94269567 - 94269939
Public Clones RRR627 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24093
Vector Insertion
Chr 4: 94256571 - 94256766
Public Clones not available
Private Clones OST235047 (lexicon) OST134894 (lexicon) OST118909 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9257
Vector Insertion
Chr 4: 94250263 - 94250523
Public Clones XG214 (baygenomics) RRC015 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 43% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI271
Vector Insertion
Chr 4: 94245147 - 94249171
Public Clones GC0437 (tigem) PST8525-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 73% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000030312
Sequence
GGCGGATGATGAATTCCGGCGTGTGTGTTAGGGTTGCTGTGTCACTCAGGCGGCTCGGCGCGCCCCTTCCCCCGCGGTCCTTCCGCACCGGCTGACTGGC

TCTTCCGGTCTCCGGCGCCCCTCTCCTGCAGGCGGGTCTCGGGCCGCAGCCTGGCGCACGCCGGCTCGGGCCTGTGGACGAGTCTCGCGCTGTGCCCGGG

GGCCGGGCTCCGGATCCACGCTGGCCATGGCGAGCGGCGCCTCCAGATACCGGCTGAGCTGCTCGCTCCCGGGCCACGAACTGGACGTGAGGGGCCTGGT

GTGCTGCCTCTACCCGCCGGGAGCCTTTGTGTCTGTGTCCCGGGATCGGACCACCCGCCTCTGGGCTCCAGACAG - UNI7630 - - UNI24093 -

 TCCTAACAGGGGCTTTACAGAAATGCACTGTATGAGCGGCCACTCTAATTTTGTGTCTTGTGTGTGTATCATACCCTCAAGTGACATATATCCTCATGG

ACTGATTGCCACTGGAGGAAATGACCACAATATTTGCATTTTCTCGCTGGACAGTCCAATGCCACTTTATATTTTAAAGGGTCACAAAGATACTG - UN

I24093 - TTTGTAGTCTTTCTTCTGGAAAATTTGGGACATTACTTAGTGGCTCATGGGACACCACTGCTAAAGTCTGGCTGAATGACAAATGCATGAT

GACATTACAG GGTCATACAGCCGCAGTATGGGCAGTAAAGATTTTACCTGAACAGGGCTTAATGCTAACTGGATCAGCAGACAAGACCATTAAACTATG

GAAGGCTGGAAGATGTGAGAGGACTTTTTTAG GGCATGAAGACTGTGTAAGAGGCTTGGCAATCTTGAGTGAGACAGAATTTCTTTCCTGTGCAAACGA

TGCTAGTATTAGAAGGTGGCAGATCACTGGCGAGTGTCTGGAAGTATACTTTGGACATACAAATTATATTTATAGCATATCTGTCTTTCCAAACTCCAAA

G ATTTTGTGACCACTGCAGAAGACAGATCTCTAAGAATATGGAAACATGGTGAATGCGCCCAAACAATCCGACTTCCAGCTCAGTCTATATGGTGTTGC

TGCGTACTGGAAAATGGTGACATTGTGGTTGGTGCGAG TGATGGTATTATTAGGGTGTTTACAGAGTCAGAGGAGCGGACAGCAAGTGCTGAGGAAATC

AAAGCTTTTGAGAGAGAGCTCTCTCAGGCAACTATCGATTCCAAAACTGGTGACTTGGGGGATATTAATGCGGAGCAGCTTCCTGGGAGGGAACATCTCA

GTGAGCCAG - UNI9257 - GTACTAGAGAAGGACAGACTCGTCTAATCAGAGATGGAGAGAGAGTTGAAGCCTATCAGTGGAGTGTTAGTGACGGGA

GGTGGATAAAAATTGGTGATGTTGTTGGCTCATCTGGTGCTAATCAGCAAACATCTGGAAAAGTTTTATATGAAGGGAAA GAATTTGATTATGTTTTCT

CAATCGATGTGAATGAAGGTGGACCATCGTATAAATTACCATATAATGTCAGTGACGATCCCTGGCTAGTTGCATACAACTTCTTGCAGAAAAATGATTT

GAATCCCATGTTTCTGGATCAGGTGGCTAAATTTATTATTGATAACACAAAAGGTCAAACACTGGGACTTGGGAATACCAGTTTTTCAGATCCGTTTACA

G - UNI271 - GTGCTGGGCGTTACATGCCAGGTTCTGCAGGTATGGACACCACCATGACTGGAGTTGATCCATTTACAG GGAACAGTGCCTACCGA

TCAGCTGCATCTAAAACAGTGAACATTTATTTCCCCAAAAAAGAAGCTCTTACCTTTGACCAAGCAAACCCTACACAAATATTAG GAAAACTGAAGGAA

CTTAATGGAACTGCACCTGAAGAGAAGAAGCTAACTGAAGACGACTTAGTACTTCTTGAAAAGATACTGTCCCTGATTTGTAATAATTCCTCAGAAAAGC

CAACGGCCCAGCAACTTCAGATTTTGTGGAAAGCTATCAACTGGCCTGAAG ACATTGTCTTTCCTGCACTTGACATTCTTCGCCTATCGATTAAGCATC

CCAATGTGAATGAGAATTTCTGCAATGAAAAAGGAGACCAGTTCAGCAGCCATCTTATCAACCTTCTGAACCCCAAAGGAAAGCCAGCAAACCAGCTGCT

TGCTCTTAGGACTTTTTGCAATTGCTTTGTTAGTCAGGCAGGACAAAAGCTCATGATGTCCCAGAGGGAGTCACTGATGTCACATGCAATAGAACTGAAA

TCCGGGAGTAATAAGAACATTCATATTGCTCTGGCTACATTGACCTTGAACTATTCTGTTTGTTTCCATAAAGACCATAACATTGAAGGGAAAGCTCAAT

GCCTCTCAGTAATTAGCACAATCTTGGAAGTTGTGCAAGACCTAGAAGCCACGTTTAGACTCCTTGTGGCTCTTGGGACACTTATCAGTGATGATTCAAA

TGCTATACAATTAGCCAAATCTTTAGGTGTTGATTCTCAAATAAAAAAGTATGTCTCCGTATCAGAGCCAGCTAAAGTGAGTGAATGCTGTAGACTTGTC

TTACATTTGCTGTAGCAGTGGGGAAAAGACGCTGAGGGGTTTTCTTTTTTTGTTTTGTTTTGTTTTGTTTTTTTCCACATTTTACATGACTGATTGCAGA

TGTTTAAAAAGAAAGAAAGGAAAATTGGATTAAGTTCAGATCTTGTAAAGTTGTGTTGAGGAGAAACAAATTATAAATAAAGTTTTTGCACT
Translation
 - UNI7630 - - UNI24093 -  - UNI24093 -  MLTGSADKTIKLWKAGRCERTFLG GHEDCVRGLAILSETEFLSCANDASIRRWQITGE

CLEVYFGHTNYIYSISVFPNSKD DFVTTAEDRSLRIWKHGECAQTIRLPAQSIWCCCVLENGDIVVGAS SDGIIRVFTESEERTASAEEIKAFERELS

QATIDSKTGDLGDINAEQLPGREHLSEPG - UNI9257 - GTREGQTRLIRDGERVEAYQWSVSDGRWIKIGDVVGSSGANQQTSGKVLYEGK EFDY

VFSIDVNEGGPSYKLPYNVSDDPWLVAYNFLQKNDLNPMFLDQVAKFIIDNTKGQTLGLGNTSFSDPFTG - UNI271 - GAGRYMPGSAGMDTTMTG

VDPFTG GNSAYRSAASKTVNIYFPKKEALTFDQANPTQILG GKLKELNGTAPEEKKLTEDDLVLLEKILSLICNNSSEKPTAQQLQILWKAINWPE 
Transcript ENSMUST00000107107
Sequence
GATGATGAATTCCGGCGTGTGTGTTAGGGTTGCTGTGTCACTCAGGCGGCTCGGCGCGCCCCTTCCCCCGCGGTCCTTCCGCACCGGCTGACTGGCTCTT

CCGGTCTCCGGCGCCCCTCTCCTGCAGGCGGGTCTCGGGCCGCAGCCTGGCGCACGCCGGCTCGGGCCTGTGGACGAGTCTCGCGCTGTGCCCGGGGGCC

GGGCTCCGGATCCACGCTGGCCATGGCGAGCGGCGCCTCCAGATACCGGCTGAGCTGCTCGCTCCCGGGCCACGAACTGGACGTGAGGGGCCTGGTGTGC

TGCCTCTACCCGCCGGGAGCCTTTGTGTCTGTGTCCCGGGATCGGACCACCCGCCTCTGGGCTCCAGACAG - UNI7630 - - UNI24093 - TCC

TAACAGGGGCTTTACAGAAATGCACTGTATGAGCGGCCACTCTAATTTTGTGTCTTGTGTGTGTATCATACCCTCAAGTGACATATATCCTCATGGACTG

ATTGCCACTGGAGGAAATGACCACAATATTTGCATTTTCTCGCTGGACAGTCCAATGCCACTTTATATTTTAAAGGGTCACAAAGATACTG - UNI240

93 - TTTGTAGTCTTTCTTCTGGAAAATTTGGGACATTACTTAGTGGCTCATGGGACACCACTGCTAAAGTCTGGCTGAATGACAAATGCATGATGACA

TTACAG GGTCATACAGCCGCAGTATGGGCAGTAAAGATTTTACCTGAACAGGGCTTAATGCTAACTGGATCAGCAGACAAGACCATTAAACTATGGAAG

GCTGGAAGATGTGAGAGGACTTTTTTAG GGCATGAAGACTGTGTAAGAGGCTTGGCAATCTTGAGTGAGACAGAATTTCTTTCCTGTGCAAACGATGCT

AGTATTAGAAGGTGGCAGATCACTGGCGAGTGTCTGGAAGTATACTTTGGACATACAAATTATATTTATAGCATATCTGTCTTTCCAAACTCCAAAG AT

TTTGTGACCACTGCAGAAGACAGATCTCTAAGAATATGGAAACATGGTGAATGCGCCCAAACAATCCGACTTCCAGCTCAGTCTATATGGTGTTGCTGCG

TACTGGAAAATGGTGACATTGTGGTTGGTGCGAG TGATGGTATTATTAGGGTGTTTACAGAGTCAGAGGAGCGGACAGCAAGTGCTGAGGAAATCAAAG

CTTTTGAGAGAGAGCTCTCTCAGGCAACTATCGATTCCAAAACTGGTGACTTGGGGGATATTAATGCGGAGCAGCTTCCTGGGAGGGAACATCTCAGTGA

GCCAG - UNI9257 - GTACTAGAGAAGGACAGACTCGTCTAATCAGAGATGGAGAGAGAGTTGAAGCCTATCAGTGGAGTGTTAGTGACGGGAGGTG

GATAAAAATTGGTGATGTTGTTGGCTCATCTGGTGCTAATCAGCAAACATCTGGAAAAGTTTTATATGAAGGGAAA GAATTTGATTATGTTTTCTCAAT

CGATGTGAATGAAGGTGGACCATCGTATAAATTACCATATAATGTCAGTGACGATCCCTGGCTAGTTGCATACAACTTCTTGCAGAAAAATGATTTGAAT

CCCATGTTTCTGGATCAGGTGGCTAAATTTATTATTGATAACACAAAAGGTCAAACACTGGGACTTGGGAATACCAGTTTTTCAGATCCGTTTACAG - 

UNI271 - GTGGTGGTCGCTATGTTCCAGGAACTTCAGGACCTTCCAACACAGTGCAGACAGCAGATCCTTTCACAG GTGCTGGGCGTTACATGCCAG

GTTCTGCAGGTATGGACACCACCATGACTGGAGTTGATCCATTTACAG GGAACAGTGCCTACCGATCAGCTGCATCTAAAACAGTGAACATTTATTTCC

CCAAAAAAGAAGCTCTTACCTTTGACCAAGCAAACCCTACACAAATATTAG GAAAACTGAAGGAACTTAATGGAACTGCACCTGAAGAGAAGAAGCTAA

CTGAAGACGACTTAGTACTTCTTGAAAAGATACTGTCCCTGATTTGTAATAATTCCTCAGAAAAGCCAACGGCCCAGCAACTTCAGATTTTGTGGAAAGC

TATCAACTGGCCTGAAG ACATTGTCTTTCCTGCACTTGACATTCTTCGCCTATCGATTAAGCATCCCAATGTGAATGAGAATTTCTGCAATGAAAAAGG

AGACCAGTTCAGCAGCCATCTTATCAACCTTCTGAACCCCAAAGGAAAGCCAGCAAACCAGCTGCTTGCTCTTAGGACTTTTTGCAATTGCTTTGTTAGT

CAGGCAGGACAAAAGCTCATGATGTCCCAGAGGGAGTCACTGATGTCACATGCAATAGAACTGAAATCCGGGAGTAATAAGAACATTCATATTGCTCTGG

CTACATTGACCTTGAACTATTCTGTTTGTTTCCATAAAGACCATAACATTGAAGGGAAAGCTCAATGCCTCTCAGTAATTAGCACAATCTTGGAAGTTGT

GCAAGACCTAGAAGCCACGTTTAGACTCCTTGTGGCTCTTGGGACACTTATCAGTGATGATTCAAATGCTATACAATTAGCCAAATCTTTAGGTGTTGAT

TCTCAAATAAAAAAGTATGTCTCCGTATCAGAGCCAGCTAAAGTGAGTGAATGCTGTAGACTTGTCTTACATTTGCTGTAGCAGTGGGGAAAAGACGCTG

AGGGGTTTTCTTTTTTTGTTTTGTTTTGTTTTGTTTTTTTCCACATTTTACATGACTGATTGCAGATGTTTAAAAAGAAAGAAAGGAAAATTGGATTAAG

TTCAGATCTTGTAAAGTTGTGTTGAGGAGAAACAAATTATAAATAAAGTTTTTGCACTGATGGTTGTGAGGTTTTCCTGTGTAATGGAGTAGATTTTCAA

GGGTGTAGAAATGTTAAAAACTATAACCAATAACAGCACAATTATAACAGCATTTTCTTCCTTACCTTCACCACTCAGGAGAACACAGAGGTTCTATAAC

CTGTTTCTGATCTATGACATCTTGTTCAGTTGACTGTTCTCTTTTGTACATTAGCTTCTCCACTTTCACTGTTGTATTCTTTCAATAGCACTGATGCATT

TCAAGGTCTTCTTTTAGGATTTACTTGAAAAATCATTTCAATTAAGTTTGTTATAAATTGTAAATTGATAAATAACAATAATTTCTTGAGCCATTTGTAA

ATAGAAAGTATCATCTTTCATGGTTCAATTTTACATGAAGAAAGCACATTGGTAAGCTGTTATATTACATATCATTTCAGACAACTGAGGCCTTAAATGA

GTATGGCTTAGGAGTTTCTTTCACTATATGAGGTAACTTCATTTTTTCTAGTTTTGATATCTTACAAGTTAAATCATTTCTTTTATCCTTCACCATTTGA

AGTAGTAGTGTCATCTTTCATTTCAGTTTTGTACATGTTGATCATATTCATTATTTCAAAGAGAATATTTGGAATTTTTTTACTTTTACTAGGCAATTGT

GTAAGCAACATTTATCAGACTTTAAAGTAAAAAAACCTGTCATGTGAAATTAGTATTTTTAGTCCCTGGAATGGTCCAGGTCTTACATTGCTATCTAATT

CTCAAATCAGCTTTCTTTGAAAAGTGGTTATTGTGCTTCTGTTTTCAAAAGGAAAGGTAATAGAATAAATTATAATAGGAAGGTTAAACATGAACATAAA

GGCATGAGTACTCCATGTAGTCTAGTCTACACAGAGCACTTGCCATGATGCAGCTTCCTGGAAAGCCACAGGTTTGTTTCTAAACAGCCCAGCAACTAAA

ACAAAGGAGACATCCTTTAATTGAACAATTCATTATGTCTATGACAGTGCTGTTTCTTCTTTCTTTTTTTGGTTTCTCCAGACAAGGTTTCATTAGCAGC

TGTTCTGGCACTCACTTTATAAACCAGGTTGGCCTTGAACCCCGAAACCTGTCTGCCTCTGCCTCCTGAGTACTAGGATTAAAGCCACCACTCCCAGCTC

AGTCCCTTTTCTTAAGAAGTGTACTTATATTGGTATGTGTATGTGTGTGCCTTTTGGTTTTATTTGTTTTTCGGTACTAGGGACCAAACCTGGTTGCATG

TTGGGGAAGGTCTACTCACTGGATTACATTCCCAGTTCCAGGCTTTCGTCTTGATTATGGAAGAAATGGTTTTATAAGGACTTTGTTAAAAATGGTGAGC

AGTGATCTCAACATTGCCATTATGGAGAGCCATGGGTTTCCTGACTTAATGCCATATCACAGTCTAAGAAGAACAAATTTTTTTCCACTAAGGGGAAGAA

GATTCCGAGTGTTGAGATTAATACAGGAAAGAACTTCTAGAATATCAAAAGGGAGTGAGGAAATGTAAATAGAGGATGTGTGCTTTACTGAGTATTAAAT

TCCAAGTTCCTGTGTGTACCTGAACTTTAAACTTCATGTTGCTGTTTCATTTATGTATTCATACTTTACCTGTATTGAATTGAGAGTTAAATTTTTATAT

CAGAATTAAATGGTAAAAAAATCATCCTGGTGCCATTATAACACTTGGCTTGTTAATACATCCATTCTAGCATGCAATTTTAAGTACAATTTATGTTATA

TTTTGAAAAGCAGGGTGGGTATCTTTGAAAAAAGAATGGATGTGGTCTTACTTAAAACATGAGTTCACTCTTCAGAATGTAAGAGGTGGCAAATTGTAAA

TACTTTTGTTTCTTATCACTGGCTTTTTTATAACTTTTATTTGTACAGCCTAACAAAAACATAATCTCACTTGAACCTGTCAAATGGTGGTTTACATATT

TTGTTTTTCTTTAAACTTTTTTATAGACCTCTTAATGTTTTCTTGAATATAAAAGAAATAAACATTCATTTAGTAAAGCATACACACATCTTATTGACTG

TAATCCTACTAAGTAGAAAACCATTCTTAGTTTTATACTACCATGACATGTATGTAAATATGCATTTTAATTTTTCAAAAAGGGATGTATTGGTCAGAAA

CTTTAATATCCCATTATATTAATATACCCATTTTCTAGTATCTGAAACTTTCCTGCTTTTGATTATCAAGCAATGCTATTAAAGATTGCACAACAATCTT

ACCATTCCCTTAGGAATATATTTTATGCATAAAATTGATGGATCAAGTTAATAGGCAATTTTGGATTGATGTCTGTCTAAATCAACTCCACTAGGACAAT

TACAGGTTAGTGAATCTCCTACTGTATTTTCAACTACATTATACATTCAACTACAGACATACGTGATGTCCCTTTCATTAACTATTGTTTTTATCTCCTT

ATAAATGCTACTGCTGTGGTTTTCTTATGACTAGCTGCGTTTGTTTTACTGGTAATATATATCAACCACACAGCATTATAGTTTTTTTTTTTTTTAATCC

AGTGCAGTTTGGTAGAAACATAGCTAAAGATAAATCTTTTTCAAAGATAATTTTGGAGTTAAATGTAGGTTACTTGGTGCTTACCACACAGCATTTTATG

AAGAAGTGATAAGATGAATAGACAAGTGTTTGATGTGTTATTTTTCCTTCAGGTCTTTAAAGGATTTCCTCCTGCATGTCTTAAGAGAGAACTTAACTGC

TCAGGATTAAGACTTACCCAGGGGCTGGAGAGATGACTCAACGCTTGGATACTTGTTGGTTTACAGAGGACCTGGGTTCAGTTCCCTATACCTAATGGTG

GTTCACAGCCATCCATAACTCCAGTTCCAGAGGACATGGTCTCTTCTGACCTTTGTGTGCCAGGCACAAGCATGTGGGACATACGTCATACATTCATAGA

TATATACAGGCAAAACCTGTAGCTGCAAAAAATATGTAAATTTTAAAGTGTTACTTAGTTGTATTAAAATATACTTTCTAGGGACTGGAGAAATGGCTCA

GTGGTTAAGTTTGTGTCCTGCTTTTCTACAACCTGAGTTAGAGTCACAGTTCACAGATGGCTCACAACTGCCTGCTAACTCCAGATCCAGAAAGACTGGA

TACCTCTGGCCTCTGTTGTCTCAGCACTCAGGTGCCTATGTAGACCCACATATCTACACATAATTTAAAAGTAATAAATCTTTAAACTTTCTAATTTTAA

TTCCTAATGCATTTTCTGTAACGTACTGAATAGTTTAAGTATGATTATAGATATAATACCGAAGACCCTTTTTAACATTTTCCCATGAGTTTTCCTTTAA

TGTTCATAAAAGTTATAAAAAATTCAGTGACCCTCTACGGACTTAAAGCTATACAGTGCTCCTTGACATGGAGTTAAATCTCTTCCCAAATCTACCACTA

CCTCAAGTTGAAAACACATGTTAGTACACTGAACCTATTAAACAGCAGCCTGAGACACTGGAGTACTGATGATTCCTGTCAGGTTAATTTAGCTGTCCTG

CATCGCCTCTCCTTTGTACAAAAGGGTATCTTAACCAGATATTGCTATTTGAGAAAAGCTTAAAAGTCTAGTTTTCTTCTGAGTGGCATTACTCTTGTGC

CATCATAAAGTCTAACCACTGCTGTCCAAGACTAGATCCTACATTTTCACCGTGTTTGCTTTCTCTATACTTTAAGACCATAAATTGCAGATTTCACATC

AATTAAACATTTCAATATAAATCCCTGAATACAAGCATATTTATACATTTTTGAAATTACTTATTTGCCCTAATATCACTCTTGCTTTAAAGCTACCTAC

TCAGAAAAACAGTCATCAGGATTTATGAGTTGTAGGCATGTATGTAATATTTCTTACTCTAGAATAGTCCATCTCTTAAAGATACTGTCTTTAGAATTCT

GCCTACTATAGAATTTGAAGTACCTCACATGCTAAAACATTTCCTATAACCCTTCTGTATTACATATTGTTTAATAAAATACCCTACAA
Translation
MASGASRYRLSCSLPGHELDVRGLVCCLYPPGAFVSVSRDRTTRLWAPDS - UNI7630 - - UNI24093 - SPNRGFTEMHCMSGHSNFVSCVCI

IPSSDIYPHGLIATGGNDHNICIFSLDSPMPLYILKGHKDTV - UNI24093 - VCSLSSGKFGTLLSGSWDTTAKVWLNDKCMMTLQ GHTAAVWAV

KILPEQGLMLTGSADKTIKLWKAGRCERTFLG GHEDCVRGLAILSETEFLSCANDASIRRWQITGECLEVYFGHTNYIYSISVFPNSKD DFVTTAEDR

SLRIWKHGECAQTIRLPAQSIWCCCVLENGDIVVGAS SDGIIRVFTESEERTASAEEIKAFERELSQATIDSKTGDLGDINAEQLPGREHLSEPG - U

NI9257 - GTREGQTRLIRDGERVEAYQWSVSDGRWIKIGDVVGSSGANQQTSGKVLYEGK EFDYVFSIDVNEGGPSYKLPYNVSDDPWLVAYNFLQK

NDLNPMFLDQVAKFIIDNTKGQTLGLGNTSFSDPFTG - UNI271 - GGGRYVPGTSGPSNTVQTADPFTG GAGRYMPGSAGMDTTMTGVDPFTG G

NSAYRSAASKTVNIYFPKKEALTFDQANPTQILG GKLKELNGTAPEEKKLTEDDLVLLEKILSLICNNSSEKPTAQQLQILWKAINWPED DIVFPALD

ILRLSIKHPNVNENFCNEKGDQFSSHLINLLNPKGKPANQLLALRTFCNCFVSQAGQKLMMSQRESLMSHAIELKSGSNKNIHIALATLTLNYSVCFHKD

HNIEGKAQCLSVISTILEVVQDLEATFRLLVALGTLISDDSNAIQLAKSLGVDSQIKKYVSVSEPAKVSECCRLVLHLL

For any suggestions or comments, please send an email to unitrap@crg.es