Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000028582 (Cc2d1b)
Chromosomal location
Chr 4: 108292561 - 108306710 (+)
Description
coiled-coil and C2 domain containing 1B Gene [Source:MGI (curated);Acc:Cc2d1b-001]
RefSeq_dna
NM_177045 
RefSeq_peptide
NP_796019.1 
UniGene
Mm.151129 
MGI
MGI:2443076 
Uniprot/SWISSPROT
Q8BRN9 
Uniprot/SPTREMBL
A2A8R6 A2A8R5 B2RQ40 Q7TPN1 
Human Ortholog
ENSG00000154222 (CC2D1B)
Omim not available
UniTrap UNI38640
Vector Insertion
Chr 4: 108292679 - 108294116
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19856
Vector Insertion
Chr 4: 108294200 - 108296055
Public Clones not available
Private Clones OST378731 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11016
Vector Insertion
Chr 4: 108296201 - 108297048
Public Clones A009E06 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3128
Vector Insertion
Chr 4: 108298420 - 108298585
Public Clones DC0787 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7795
Vector Insertion
Chr 4: 108300554 - 108300634
Public Clones RRN240 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14471
Vector Insertion
Chr 4: 108305909 - 108306127
Public Clones FHCRC-GT-S11-4A1 (fhcrc)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000106665
Sequence
ACAAGCCCTGCTGTTAGCCCGACAGAGAGAGTACAAGGCGGCTGCTCTCGATGCCAAGCGGGCTGGAGATCTAGACCGTGCTCGGGAGCTCATGAGGATC

GGGAAG AGATTTGGTACTGTCCTAGAGGCCCTGGAAAAGGGTCAGCCTGTGGACCTGAGTGGCATGCCCCCAGCACCTGCGG ATCTGAAGGCCCTCCC

CCAGGCTTCTAAGGCCTCCTCAGCAACCCAAGGCCTGTCCCCAGCAGTAGAGCAAATGCAGCCAGTGATGGCCTCTGACCTCCCAGCCACCCCAG TGGC

CCCTGCGGAGCCAACAACAGTGCTGGATGCTTTACAGCAAAGGCTGAACAAGTATCGTGAGGCAGGCATCCAGGCCCGGGCCAATGGGGATGAGCGCAAG

GCCAGGATGCACGATCGCATTGCCAAG CAATATCAGGATGCTGTTCGAGCTCATCAGGCAGGACAGAAAGTTGACTTTGCCGAGTTACCTGTTCCTCCA

GGTGGGTGATGTTTGGACTTGATGAGGTTTCTAAGCAAGAATGGAGAAAGAAGTTTCTCATGTATTGCCTCCACCTTGTGAGAGTTACCCATCCCAGAGC

CAGGCAAGATGCACAGCAGGCTCATGTGGCCTTAATGCTGCCTCCTTGCCCCTCTCTGTTCCGTCTCTTCTCAGGATTTCCTCCCATCCCTGGCCTGGAG

CCCAGGAAAGGTAGTGAGCAGGATTCAGTGGCAGCAACTTTAGCAACTGCCCAAAAACTGGCCTCAGAAGATGCAGCCCTGGTAGATGACGACGAGGAGG

TTTGGCTATGGGCCCAGGACTTCAGGGCTTGGTTGTAGGGGCATGGGGGTAGGGGGGGAGGGGAACAACAGATAAGGAGTAAACCCAGACCCTACTGTAT

ATTAACCTCATAAACTAGAGATCCTTTCCTCCTTTTCAGAGAAAAAAAATTGCAGAGGCAGAACTAGAATTCAGACCTGGGTATTTCTGGGCCCCAACAC

TCAAAGTTTCTTTATTACTGTGATGCTTCCTGCCGAGGAAGTTAGGCTGGGAAACTTTGGATGGTTCTGTCATTGGGTGGCAGGGCTCTGGAGGTAAAGC

TACCCCACTAAGGTCATACAGTGAATGGGTGCAACATTAAGGAGGTAGCCCAAGTGTAGGCATGGGGATTGATAACTATCTGATAGCCTCCTAACTGGGT

GCCACCTGCAGAGTGACACTCCAGCACAGGCCCCATTGGCCAAGAAGCCAGCGCAGACTCTGGTCTCTCCATCCCATCTTCTGACTGAGCCCAAGGCTTC

AAGTTCTAAGGAGTCACTGAGTCCATCTG - UNI7795 - TTCGGGAGCAGGTGACACTGCTGGAGGCTCGGAAACTGCAATACCAGCGAGCAGCTCT

GCAAGCCAAGCGCAGGCAGGATCTTGAGCAGGCCAAATCCCACTTACGAGTAGCTAAAAGTCTTGAGGCTCAGATCATCCAGGCCCGAGCTGGTCAACCC

ATTGATCTCTCCAAG GTGCCTTCACCGTTGACAGATGAAGAGGGGGACTTCATCCTCATTCACCATGAGGATCTGCGACTCTCCCAGAAGGCTGAGGAG

GTGTATGCCCAGCTACAGAAAATGCTCCAGGAGCAGCAAGCG AAGTGCCTGCTATTCTCCAAGCAGTACATGCACCAGGGAAATGTGGCTGAGACCACT

CG GTTTGAGAGGCTTGCGGAGGACCGAAAGAAACAGCTTGAGATCCTGCAGCTAGCCCAAGCCCAGGGCCTTGACCCTCCTAGTCATCACTTTGAGCTG

AAGACATTCCAGACTGTGAG GATCTTCTCAGAACTCAACAGCACAGAAATGCATCTGATCATCGTGCGGGGAATGAACCTCCCAGCCCCGCCAG GAGT

GACTCCGGATGACTTGGATGCTTTTGTACGGTTTGAGTTTCACTACCCTAACTCG GACCAGGCTCAAAAAAGCAAAACAGCTGTGGTAAAAAATACCAA

TTCTCCAG AATTTGAACAAGTTTTCAAGCTAAACATCAATCGAAACCACCGAGGCTTTAGGAGAGTGATCCAGAGCAAAGGAATCAAATTTGAGATCTT

CCACAAAGG ATCCTTTTTTAGAAGTGACAAGCTGGTTGGCACAGCACACTTGAAATTGGAAAGGCTGGAGAAGGAGTGTGAGATCAGAGAGATCATGGA

G GTTTTGGATGGCAGAAAGCCCACTGGGGGGAAGCTGGAGGTGAAGGTGAGGCTTCGGGAGCCTCTGAGCAGCCAGGACGTGCAGACGGTCACTGAGAA

CTGGCTGGTCCTGGAGCCTCGGGGCCTGTGAAGAG - UNI14471 - GTGGACATCCTTGGTAACAGCTCACTGACCCAGCTGTGCCGGCTCAAGAGC

CGTTGTACATCAGAGATGCTGCTACACACGCACCAAAGACCTGATAACTAACAGTGGCCTGGGCTTTCCTCCTGCTGCCTCTCCTGGACCTTCGTGGAAG

CAGGCCTCCCACCCTCCCTGTGGGCGAAGACAAGGATACCCCACTGCTCTGTGCCACAGAGTCCCGTAACCGCTGCATAGTAATTGCGTACCGCTTAACC

CAGCCCCCATTTGCACCATTTCTGGATGTGCCTTTCAAAGATGTAACTGTAGGGATGGGAGAACTCGAGGGTGATCGGAACATCCCGTGTGGGGAGGGAC

AGGATTCCGTGACTCCAGCTGGCCAGCGGCAGACTGTCCCGCTCAGCTGTTTTCCCTCTGCCTGTGCCTTTGTTCCTGACAGCTGCTGCACTAGCCTTTC

TGCTTCCCAGAGGACTCGGGAACAGGAACGTTACTTTGGTACTATTGGTGGGAAGTAAGGGAAGGTTCTCTTTGGTTTGGTCCATGTACCTAAGGTGAAA

GACTGTTAATTGGGGAGAAAAAAAGGAAAAAA
Translation
     - UNI7795 -  MLQEQQA KCLLFSKQYMHQGNVAETTR RFERLAEDRKKQLEILQLAQAQGLDPPSHHFELKTFQTVR RIFSELNSTEMH

LIIVRGMNLPAPPG GVTPDDLDAFVRFEFHYPNS DQAQKSKTAVVKNTNSPE EFEQVFKLNINRNHRGFRRVIQSKGIKFEIFHKG GSFFRSDKLV

GTAHLKLERLEKECEIREIME VLDGRKPTGGKLEVKVRLREPLSSQDVQTVTENWLVLEPRGL - UNI14471 - 
Transcript ENSMUST00000030320
Sequence
ACCGCCTCCTGGGCGGGAGCTTCCTGTGGCTGTCTCCGCCGCGGCCGCCCGGGGGCCGCGGAAAGCTAGGCGGTTCCGGGCTCGAGAAGGCCCGGTTTTG

GTTCGGATCCGCCGCGAG GTATCTAGCCTGCCAAGATGCCAGGGCCAAGACCTCGGAAGGGCCCTAAGACCAGTGGCCAGGGTGCTGAGACTGCCAAGC

AG - UNI19856 - CTGGGGCTTTTTGTGGAGTTCAACCCTGAGGACATGCTCCTGGGGGTGGATGAGACTGAAGATGATGGAGACCTGGAGGCTGAG

TTACTGGCACTCACAGGGGAAACAGCGAGCAGGAGCAGGAAGCCAGCACCCAAGGGGCAGG - UNI11016 - CTCCACTGCCCATGGCCCACATTGA

GAAGCTGGCAGCAGACTGTATGCGAGATGTGGAGGAGGATGAAGAAGAGGAAGGGCTGGAGGACGATGCAGACCTTCTG ACAGAGCTGCAGGAGGTCCT

GGGTGAGGATGAAGAAGCGGGTCTGCTGGACGGCAGTGAGGCAGCAAGTCCAGACCTCTGTGAGGAGAAGACTTGGGACAACACTGAACTACCTGTAGAG

CAGGCAGCCTGCCAACAGGCAGTACCTGCTGCAGCTCAG GCTGGAGGGCCTCGGGGGCTGCAGGCTTTGCTGGAGGAACGGATCCGTAACTACCGGGAG

GCCGCAGCCAGTGCCAAGGAGGCTGGTGAAGCTGCCAAAGCCCGGCGCTGTGAGCGAGGCCTAAAG ACTCTGCAGTCCCAGCTTGCCACTGTGAGGAAA

GGCGGGAAGATCTGTGAGGATGAGATCCCACCTCCAGTAGCCTTGGGCAAAAGGCCCCCAGCCCCCCAGGAAAGAGCCATCAAGAACCCTGAGATAGACT

CTCCAGGTCCCTGTGCCATGGAGCCAG - UNI3128 - GCAACCTTTCCCAGCCCGAGTCCAGCCTCCCTGCCATTGCTCCCTTGCCTGATTCAGACC

CAGACCCACAAGCCCTGCTGTTAGCCCGACAGAGAGAGTACAAGGCGGCTGCTCTCGATGCCAAGCGGGCTGGAGATCTAGACCGTGCTCGGGAGCTCAT

GAGGATCGGGAAG AGATTTGGTACTGTCCTAGAGGCCCTGGAAAAGGGTCAGCCTGTGGACCTGAGTGGCATGCCCCCAGCACCTGCGG ATCTGAAGG

CCCTCCCCCAGGCTTCTAAGGCCTCCTCAGCAACCCAAGGCCTGTCCCCAGCAGTAGAGCAAATGCAGCCAGTGATGGCCTCTGACCTCCCAGCCACCCC

AG TGGCCCCTGCGGAGCCAACAACAGTGCTGGATGCTTTACAGCAAAGGCTGAACAAGTATCGTGAGGCAGGCATCCAGGCCCGGGCCAATGGGGATGA

GCGCAAGGCCAGGATGCACGATCGCATTGCCAAG CAATATCAGGATGCTGTTCGAGCTCATCAGGCAGGACAGAAAGTTGACTTTGCCGAGTTACCTGT

TCCTCCAG GATTTCCTCCCATCCCTGGCCTGGAGCCCAGGAAAGGTAGTGAGCAGGATTCAGTGGCAGCAACTTTAGCAACTGCCCAAAAACTGGCCTC

AGAAGATGCAGCCCTGGTAGATGACGACGAGGAG AGTGACACTCCAGCACAGGCCCCATTGGCCAAGAAGCCAGCGCAGACTCTGGTCTCTCCATCCCA

TCTTCTGACTGAGCCCAAGGCTTCAAGTTCTAAGGAGTCACTGAGTCCATCTG - UNI7795 - TTCGGGAGCAGGTGACACTGCTGGAGGCTCGGAA

ACTGCAATACCAGCGAGCAGCTCTGCAAGCCAAGCGCAGGCAGGATCTTGAGCAGGCCAAATCCCACTTACGAGTAGCTAAAAGTCTTGAGGCTCAGATC

ATCCAGGCCCGAGCTGGTCAACCCATTGATCTCTCCAAG GTGCCTTCACCGTTGACAGATGAAGAGGGGGACTTCATCCTCATTCACCATGAGGATCTG

CGACTCTCCCAGAAGGCTGAGGAGGTGTATGCCCAGCTACAGAAAATGCTCCAGGAGCAGCAAGCG AAGTGCCTGCTATTCTCCAAGCAGTACATGCAC

CAGGGAAATGTGGCTGAGACCACTCG GTTTGAGAGGCTTGCGGAGGACCGAAAGAAACAGCTTGAGATCCTGCAGCTAGCCCAAGCCCAGGGCCTTGAC

CCTCCTAGTCATCACTTTGAGCTGAAGACATTCCAGACTGTGAG GATCTTCTCAGAACTCAACAGCACAGAAATGCATCTGATCATCGTGCGGGGAATG

AACCTCCCAGCCCCGCCAG GAGTGACTCCGGATGACTTGGATGCTTTTGTACGGTTTGAGTTTCACTACCCTAACTCG GACCAGGCTCAAAAAAGCAA

AACAGCTGTGGTAAAAAATACCAATTCTCCAG AATTTGAACAAGTTTTCAAGCTAAACATCAATCGAAACCACCGAGGCTTTAGGAGAGTGATCCAGAG

CAAAGGAATCAAATTTGAGATCTTCCACAAAGG ATCCTTTTTTAGAAGTGACAAGCTGGTTGGCACAGCACACTTGAAATTGGAAAGGCTGGAGAAGGA

GTGTGAGATCAGAGAGATCATGGAG GTTTTGGATGGCAGAAAGCCCACTGGGGGGAAGCTGGAGGTGAAGGTGAGGCTTCGGGAGCCTCTGAGCAGCCA

GGACGTGCAGACGGTCACTGAGAACTGGCTGGTCCTGGAGCCTCGGGGCCTGTGAAGAG - UNI14471 - GTGGACATCCTTGGTAACAGCTCACTG

ACCCAGCTGTGCCGGCTCAAGAGCCGTTGTACATCAGAGATGCTGCTACACACGCACCAAAGACCTGATAACTAACAGTGGCCTGGGCTTTCCTCCTGCT

GCCTCTCCTGGACCTTCGTGGAAGCAGGCCTCCCACCCTCCCTGTGGGCGAAGACAAGGATACCCCACTGCTCTGTGCCACAGAGTCCCGTAACCGCTGC

ATAGTAATTGCGTACCGCTTAACCCAGCCCCCATTTGCACCATTTCTGGATGTGCCTTTCAAAGATGTAACTGTAGGGATGGGAGAACTCGAGGGTGATC

GGAACATCCCGTGTGGGGAGGGACAGGATTCCGTGACTCCAGCTGGCCAGCGGCAGACTGTCCCGCTCAGCTGTTTTCCCTCTGCCTGTGCCTTTGTTCC

TGACAGCTGCTGCACTAGCCTTTCTGCTTCCCAGAGGACTCGGGAACAGGAACGTTACTTTGGTACTATTGGTGGGAAGTAAGGGAAGGTTCTCTTTGGT

TTGGTCCATGTACCTAAGGTGAAAGACTGTTAATTGGGG
Translation
 MPGPRPRKGPKTSGQGAETAKQ - UNI19856 - LGLFVEFNPEDMLLGVDETEDDGDLEAELLALTGETASRSRKPAPKGQA - UNI11016 - 

APLPMAHIEKLAADCMRDVEEDEEEEGLEDDADLL TELQEVLGEDEEAGLLDGSEAASPDLCEEKTWDNTELPVEQAACQQAVPAAAQ AGGPRGLQAL

LEERIRNYREAAASAKEAGEAAKARRCERGLK TLQSQLATVRKGGKICEDEIPPPVALGKRPPAPQERAIKNPEIDSPGPCAMEPG - UNI3128 - 

GNLSQPESSLPAIAPLPDSDPDPQALLLARQREYKAAALDAKRAGDLDRARELMRIGK RFGTVLEALEKGQPVDLSGMPPAPAD DLKALPQASKASSA

TQGLSPAVEQMQPVMASDLPATPV VAPAEPTTVLDALQQRLNKYREAGIQARANGDERKARMHDRIAK QYQDAVRAHQAGQKVDFAELPVPPG GFPP

IPGLEPRKGSEQDSVAATLATAQKLASEDAALVDDDEE SDTPAQAPLAKKPAQTLVSPSHLLTEPKASSSKESLSPSV - UNI7795 - VREQVTLL

EARKLQYQRAALQAKRRQDLEQAKSHLRVAKSLEAQIIQARAGQPIDLSK VPSPLTDEEGDFILIHHEDLRLSQKAEEVYAQLQKMLQEQQA KCLLFS

KQYMHQGNVAETTR RFERLAEDRKKQLEILQLAQAQGLDPPSHHFELKTFQTVR RIFSELNSTEMHLIIVRGMNLPAPPG GVTPDDLDAFVRFEFHY

PNS DQAQKSKTAVVKNTNSPE EFEQVFKLNINRNHRGFRRVIQSKGIKFEIFHKG GSFFRSDKLVGTAHLKLERLEKECEIREIME VLDGRKPTGG

KLEVKVRLREPLSSQDVQTVTENWLVLEPRGL - UNI14471 - 

For any suggestions or comments, please send an email to unitrap@crg.es