Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000028655 (Mfsd2)
Chromosomal location
Chr 4: 122624113 - 122638430 (-)
Description
major facilitator superfamily domain containing 2 Gene [Source:MGI (curated);Acc:Mfsd2-001]
Human Ortholog
not available
Omim not available
UniTrap UNI37885
Vector Insertion
Chr 4: 122629232 - 122634100
Public Clones (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 22% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000030408
Sequence
GAGTTTTCATCGCCGGCGTTCCTGGTTTGCTAAGTGCTAGCGAACGTAGTAGTGGCTGGGGCTGCGCCTAGGATCGGAGCCACAGGCGAGTGCCGGCCGG

CAGAACACAAGAGCATCCCGGCGTCCCGGTCCCACGCGGCGTGGCCCGCGGGTCATGGCCAAAGGAGAAGGCGCCGAGAGCGGTTCCGCGGCGGGGCTGC

TCCCCACCAGCATCCTCCAAGCCAGTGAACGGCCGGTCCAGGTGAAG AAGGAACCAAAAAAGAAGCAGCAACTGTCCATTTGCAACAAGCTTTGCTATG

CAGTTGGAGGGGCCCCGTACCAGTTGACCGGCTGCGCACTGGGATTCTTCCTGCAGATCTACCTATTGGATGTGGCTAAG - UNI37885 - GTGGAA

CCACTTCCTGCTTCCATTATCCTTTTTGTGGGCCGAGCCTGGGATGCCTTCACTGACCCTCTGGTGGGCTTCTGCATTAGCAAGTCCTCCTGGACCCGCC

TGGGCCGCCTCATGCCCTG - UNI37885 - GATCATCTTCTCCACTCCCCTGGCCATCATTGCTTACTTCCTCATCTGGTTTGTGCCTGACTTCCCA

TCAGGGACGGAAAGTTCACACGGCTTCCTTTGGTACCTGCTTTTCTATTGCCTCTTTGAGACACTGGTCACG - UNI37885 - TGCTTTCATGTTCC

CTACTCAGCGCTCACCATGTTCATCAGCACGGAGCAGAGTGAGCGTGACTCAGCCACGGCATACA GAATGACTGTGGAGGTGCTGGGCACAGTGATAGG

CACAGCGATTCAAGGACAAATTGTGGGCCAAGCCAAGGCACCTTGTCTCCAGGACCAGAATGGCTCTGTGGTGGTCTCAGAAGTTGCCAATCGCACCCAG

AGTACTGCCTCCCTCAAAGACACG CAAAATGCTTACCTGCTGGCAGCAGGGATCATCGCCTCCATCTACGTCCTCTGTGCCTTCATTCTGATCCTAGGC

GTGCGGGAGCAGAGAG AACTCTACGAGTCCCAGCAGGCTGAGTCAATGCCCTTCTTTCAGGGCCTCCGGCTGGTCATGGGTCATGGCCCCTATGTCAAG

CTCATTGCCGGCTTCCTTTTTACCTCCCTGGCTTTCATG CTGGTGGAGGGTAACTTTGCCTTGTTCTGCACCTATACCTTGGACTTCCGAAATGAGTTC

CAGAACCTCCTCCTGGCCATCATG CTCTCGGCCACATTCACCATCCCTATCTGGCAGTGGTTCCTAACCCGGTTTGGCAAGAAGACAGCTGTATACATC

GGGATCTCT TCTGCAGTTCCTTTTCTCATCTTGGTGGCCCTCATGGAGCGTAATCTAATCGTCACTTACGTGGTGGCCGTAGCAGCTGGCGTCAGTGTA

GCAGCTGCCTTCCTACTACCATG GTCCATGCTGCCTGACGTTATCGATGACTTCCACCTGAAACACCCTCACTCCCCTGGCACCGAGCCCATATTCTTC

TCCTTCTATGTCTTCTTCACCAAGTTTGCCTCTGGAGTCTCACTGGGTGTCTCTACCCTCAGTCTCGA CTTTGCCAACTACCAGAGGCAGGGATGCTCC

CAGCCAGAACAGGTCAAGTTTACACTGAAGATGCTGGTGACCATGGCTCCTATCATCCTCATCTTGCTGGGCCTGCTGCTCTTCAAGCTCTACCCCATTG

ATGAGGAGAAGCGGCGACAGAATAAGAAAGCTCTGCAGGCTCTACG AGAAGAAGCCAGCAGCTCAGGTTGCTCGGATACAGACTCCACAGAGCTGGCCA

GTATTCTCTAGGACTTGCCAGGGTGCCTGAAGCCACCACACAAAGGACCTGGGGCACCAGGTAGCATTAAGCACGGGATCTCTTTGCCCTTGCACTGAGC

AGCTGTTCTTCCTATGTCAAGACAGGGACCAAGGAGTGGAGGGTGAGCGGACCAGGACATCTGTGCTCACTGCAAGGCTGACCGCTCTGTCACCTCCTCA

CTGCCTGCCCACTGGGCCAAGCCTTAGGGCTGCTACTGTGAATATGCCAAGGACTGACTGGGCCTAGCTCGGAACACTAATGTAGAAACGTTTTATACAG

AGACTAATTAATAACTTAATGACTATGTATATAGTGATGTGTGTATGTATGTGTCTATGAGGTATTAATGTTATTAATTTTC
Translation
MAKGEGAESGSAAGLLPTSILQASERPVQVK KEPKKKQQLSICNKLCYAVGGAPYQLTGCALGFFLQIYLLDVAK - UNI37885 - VEPLPASIIL

FVGRAWDAFTDPLVGFCISKSSWTRLGRLMPW - UNI37885 - WIIFSTPLAIIAYFLIWFVPDFPSGTESSHGFLWYLLFYCLFETLVT - UNI3

7885 - CFHVPYSALTMFISTEQSERDSATAYR RMTVEVLGTVIGTAIQGQIVGQAKAPCLQDQNGSVVVSEVANRTQSTASLKDT QNAYLLAAGII

ASIYVLCAFILILGVREQRE ELYESQQAESMPFFQGLRLVMGHGPYVKLIAGFLFTSLAFM LVEGNFALFCTYTLDFRNEFQNLLLAIM LSATFTIP

IWQWFLTRFGKKTAVYIGIS SAVPFLILVALMERNLIVTYVVAVAAGVSVAAAFLLPW WSMLPDVIDDFHLKHPHSPGTEPIFFSFYVFFTKFASGVS

LGVSTLSLD DFANYQRQGCSQPEQVKFTLKMLVTMAPIILILLGLLLFKLYPIDEEKRRQNKKALQALR REEASSSGCSDTDSTELASIL

For any suggestions or comments, please send an email to unitrap@crg.es