Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000028677 (Rnf220)
Chromosomal location
Chr 4: 116944068 - 117169657 (-)
Description
ring finger protein 220 Gene [Source:MGI Symbol;Acc:MGI:1913993]
RefSeq_dna
NM_025739 
RefSeq_peptide
NP_080015.3 
UniGene
Mm.318331 Mm.469653 
MGI
MGI:1913993 
Uniprot/SWISSPROT
Q6PDX6 
Uniprot/SPTREMBL
A2APP0 A2APN9 Q9D4L6 
Human Ortholog
ENSG00000187147 (RNF220)
Omim not available
UniTrap UNI14594
Vector Insertion
Chr 4: 117162193 - 117169658
Public Clones FHCRC-GT-S17-1A1 (fhcrc) IST14604C7 (tigm) IST13540A12 (tigm) IST14909D6 (tigm)
IST12604D3 (tigm) IST14886C7 (tigm)
Private Clones OST332563 (lexicon) OST302037 (lexicon) OST194404 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30557
Vector Insertion
Chr 4: 117047918 - 117162819
Public Clones IST12294A2 (tigm) IST11094B6 (tigm) IST12501G5 (tigm) IST15073D5 (tigm)
IST15081G3 (tigm) IST11028A5 (tigm) IST12294A1 (tigm) IST10939B4 (tigm)
IST13652C5 (tigm) IST12095E5 (tigm) IST12809H7 (tigm) IST13435G1 (tigm)
IST11081D12 (tigm) IST10614G10 (tigm) IST11520D8 (tigm) IST14956A3 (tigm)
IST12938H8 (tigm) IST10455D7 (tigm) IST12111B7 (tigm) IST14661E8 (tigm)
IST11616D1 (tigm) IST10043C9 (tigm) IST12285E12 (tigm) IST12125E6 (tigm)
IST12690H1 (tigm) IST12252E6 (tigm) IST10140D6 (tigm) IST12573C3 (tigm)
IST13201F3 (tigm) IST11797D10BBF1 (tigm) IST12328E1 (tigm) IST10144G7 (tigm)
IST12516C2 (tigm) IST13094B10 (tigm) IST13945A1 (tigm) IST14592D4 (tigm)
IST11575D3 (tigm) IST14704F3 (tigm) IST11393E2 (tigm) IST12571B11 (tigm)
IST10011F12 (tigm) IST14274C3 (tigm) IST10528E6 (tigm) IST10554F8 (tigm)
IST12061G3 (tigm) IST12437D11 (tigm) IST13019B2 (tigm) IST12846D3 (tigm)
IST10592G9 (tigm) IST10056A8 (tigm) IST12355C9 (tigm) IST10873H7 (tigm)
IST12349D4 (tigm) IST10487D6 (tigm) IST13897F6 (tigm) IST14938H10 (tigm)
IST10522E4 (tigm) IST11857A7 (tigm) IST14850C10 (tigm) IST11081C11 (tigm)
IST10046C9 (tigm) IST10652C11 (tigm) IST11643F7 (tigm) IST14843H2 (tigm)
IST10679C7 (tigm) IST14473B3 (tigm) IST12643D12 (tigm) IST11751C4 (tigm)
IST13405E4 (tigm) IST14986D11 (tigm) IST11584B5 (tigm) IST12052E5 (tigm)
IST12617E7 (tigm) IST14864E12 (tigm) IST12266C1 (tigm) IST12662E7 (tigm)
IST10091D3 (tigm) IST14959H3 (tigm) IST11753C12 (tigm) IST15095C2 (tigm)
IST14915G4 (tigm) IST12988A10 (tigm) IST11916B2 (tigm) IST12188C12HMR1 (tigm)
IST10286G7 (tigm) IST12343H9 (tigm) IST12312A8 (tigm) IST11083H9 (tigm)
IST12072H5 (tigm) IST10003D2 (tigm) IST10804H12 (tigm) IST13543F7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 36% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19527
Vector Insertion
Chr 4: 116980284 - 117047918
Public Clones (ggtc) CMHD-GT_523A8-5S (cmhd) PST20525-NR (escells) IST15095G7 (tigm)
IST14285E5 (tigm) IST10430E4 (tigm) IST14683C10 (tigm) IST14150E1 (tigm)
IST10374C9 (tigm) IST15067C11 (tigm) IST10012F11 (tigm) IST11534B1 (tigm)
IST11842C1 (tigm) IST12922E9 (tigm) IST14647B4 (tigm) IST12978F3 (tigm)
IST11310E6 (tigm) IST11625H4 (tigm) IST15081G3 (tigm) IST13719D10 (tigm)
IST14909A5 (tigm) IST13506D10 (tigm) IST10558F6 (tigm) IST14328E5 (tigm)
IST10631F2 (tigm) IST10945G9 (tigm) IST14151A1 (tigm) IST10012G12 (tigm)
IST14920C5 (tigm) IST10088F5 (tigm) IST14587H6 (tigm) IST12237C12 (tigm)
IST10185B4 (tigm) IST12883G6 (tigm) IST11675F5 (tigm) IST10898C11 (tigm)
IST14834H6 (tigm) IST14284C5 (tigm) IST12614B12 (tigm) IST11071E2 (tigm)
IST14774D4 (tigm) IST10045H8 (tigm) IST12681G5 (tigm) IST14828D6 (tigm)
IST15014H3 (tigm) IST14810F4 (tigm) IST12292C1 (tigm) IST14214G9 (tigm)
IST14793A12 (tigm) IST12041D11 (tigm) IST14699E9 (tigm) IST12442D8 (tigm)
IST11655D1 (tigm) IST13849E6 (tigm) IST10812A11 (tigm) IST12346E7 (tigm)
IST10890C6 (tigm) IST15111B6 (tigm) IST12981H1 (tigm) IST13891A12 (tigm)
IST10487H4 (tigm) IST14035D1 (tigm) IST10026B3 (tigm) IST11989F11 (tigm)
IST11797D10 (tigm) IST12625E1 (tigm) IST13943G11 (tigm) IST12032E2 (tigm)
IST14224E10 (tigm) IST12372B6 (tigm) IST14174E5 (tigm) IST14722E5 (tigm)
IST10846C12 (tigm) IST11086B5 (tigm) IST13218D2 (tigm) IST14828B8 (tigm)
IST14722D6 (tigm) IST13318E7 (tigm) IST10550E3 (tigm) IST13683E6 (tigm)
IST12075C11 (tigm) IST14318B10 (tigm) IST11852D1 (tigm) IST14283D4 (tigm)
IST10601C11 (tigm) IST10186A2 (tigm) IST14122C6 (tigm) IST14271E5 (tigm)
IST11817G2 (tigm) IST11625F4 (tigm)
Private Clones OST389654 (lexicon) OST372004 (lexicon) OST292129 (lexicon) OST283104 (lexicon)
OST247036 (lexicon) OST111799 (lexicon) OST36732 (lexicon)
Severity of mutation (?) Insertion after 36% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20009
Vector Insertion
Chr 4: 116972196 - 116980150
Public Clones CMHD-GT_261B2-3 (cmhd)
Private Clones OST375181 (lexicon) OST126580 (lexicon) OST123934 (lexicon)
Severity of mutation (?) Insertion after 44% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16934
Vector Insertion
Chr 4: 116968839 - 116972149
Public Clones not available
Private Clones OST452164 (lexicon)
Severity of mutation (?) Insertion after 47% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32743
Vector Insertion
Chr 4: 116961807 - 116968839
Public Clones IST11091E7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 53% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37080
Vector Insertion
Chr 4: 116961674 - 116961807
Public Clones CMHD-GT_510D1-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 53% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9659
Vector Insertion
Chr 4: 116961378 - 116961630
Public Clones (sanger) XG519 (baygenomics) D159B07 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 56% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14419
Vector Insertion
Chr 4: 116958455 - 116961378
Public Clones (sanger) FHCRC-GT-S13-8B1 (fhcrc) PST15568-NR (escells) PST18279-NL (escells)
Private Clones not available
Severity of mutation (?) Insertion after 56% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12384
Vector Insertion
Chr 4: 116958455 - 116958578
Public Clones W030E07 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 58% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21014
Vector Insertion
Chr 4: 116958117 - 116958533
Public Clones PST17196-NR (escells) PST21522-NR (escells)
Private Clones OST345878 (lexicon) OST276578 (lexicon) OST249606 (lexicon)
Severity of mutation (?) Insertion after 58% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI212
Vector Insertion
Chr 4: 116950709 - 116957983
Public Clones GC0638 (tigem) XE545 (baygenomics) W099A06 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 66% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28476
Vector Insertion
Chr 4: 116945961 - 116949975
Public Clones not available
Private Clones OST30132 (lexicon)
Severity of mutation (?) Insertion after 85% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22086
Vector Insertion
Chr 4: 116944076 - 116944981
Public Clones not available
Private Clones OST309143 (lexicon) OST107850 (lexicon)
Severity of mutation (?) Insertion after 96% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000116298
Sequence
ATGGACTTACACCGGGCAGCCTTCAAGATGGAGAACTCATCCTATCTTCCCAACCCTCTGGCGTCCCCAGCACTGATGGTCTTGGCGTCCACTGCCGAGG

CCAGCAGGGATGCCTCCATCCCTTGTCAGCAGCCACGACCCTTTGGTGTACCTGTCTCAGTAGACAAGGACGTTCACATTCCCTTCACCAATGGCTCCTA

CACCTTTGCCTCTATGTACCACCGGCAAGGTGGGGTGCCGGGCACTTTTGCCAATCGTGATTTCCCCCCTTCCTTACTACACCTCCACCCCCAGTTTGCT

CCCCCAAACCTAGATTGCACCCCAATCAGTATGCTAAATCACAGTGGTGTGGGGGCATTCCGTCCCTTCGCTTCCACGGAGGACAGGGAGAGCTATCAGT

CTGCCTTTACTCCAGCCAAGAGACTCAAGAACTGCCATGACACAGAGTCTCCCCACCTGCGCTTCTCCGATGCAGATGGCAAGGAATATGACTTTGGGAC

CCAGCTGCCATCCAGCTCCCCTGGCTCACTTAAGGTTGATGATACTGGGAAGAAGATCTTTGCTGTGTCTGGCCTCATCTCTGACCGGGAAACCTCCTCG

AGTCCAGAGGATCGGAATGACAGAT - UNI14594 - - UNI19527 - - UNI30557 - GTAAGAAGAAAGCAGTAGCGTTGTTTGACAGCCAA

GCCCCGCTCTGCCCCATCTGCCAAGTCCTGCTGAGGCCCAGCGAGTTGCAGGAACATATGGAGCAGGAACTGGAACAGCTGGCCCAGCTGCCTGCCAG -

 UNI20009 - CAAAAATTCCCTTCTGAAGGATGCCATGGCTCCGGGCACCCCCAAG - UNI16934 - - UNI32743 - TCCCTCCTGTTGTCT

GCTTCCATCAAGAGGGAAGGAGACTCTCCAACGGCTTCCCCACACTCTTCTGCCACGGAGGACCTGCACCACTCAGACAGATACCAG - UNI32743 -

 ACCTTCCTGCGAGTGCGAGCCAACCGGCAAACCCGACTGAATG - UNI9659 - - UNI12384 - - UNI14419 - CTCGGATTGGGAAAATG

AAACGGAGGAAGCAAGATGAAGGGCAG - UNI12384 - - UNI14419 - - UNI21014 - AGGGAAGGCTCCTGCATGGCTGAAGATGATGCT

GTGGACATCGAGCATGCGGACAGCAACCGCTTTGAGGAATATGAGTGGTGTGGGCAGAAGCGGATACGGGCCACCACACTCCTGGAAGGTGGCTTCCGAG

 - UNI212 - GCTCCGGCTTCGTCATGTGCAGTGGCAAAGAGAACCCAGACAGTGACGCTGACCTGGATGTGGATGGAGATGACACACTGGAGTATGG

GAAACCACA ATACACGGAGGCTGATGTCATCCCGTGCACAGGAGAAGAGCCTGGTGAAGCCAAGGAGAGAGAGGCACTCCGGGGCGCAGTCCTAAA TG

GTGGCCCTCCGAGCACCCGCATCACACCTGAGTTCTCTAAATGGGCCAGTGATG AGATGCCATCCACCAGCAATGGTGAAGGCAGCAAGCAGGAGGCCA

TGCAGAAGACCTGCAAGAACAGCGACATTGAGAA - UNI28476 - AATCACCGAAGAGTCAGCTGTAACTACATTTGAGGCTCTGAAGGCTCGGGTC

CGGGAGCTTGAACGGCAGCTATCTCGGGGGGACCGATACAAATGCCTCATCTGCATG GACTCTTACTCGATGCCTCTGACGTCGATCCAGTGTTGGCAT

GTGCACTGTGAAGAGTGTTGGCTGCGGACTCTG - UNI22086 - GGTGCCAAGAAGCTCTGCCCTCAGTGCAACACCATCACAGCCCCCGGAGACCT

GCGGAGGATCTACTTATGAGCTAGCTGTCTAGGCAGGCCTTGCCTCGAGCAACGCCCCTGCCCAGCCTCTGTGACAGTGACTCCCTCTCCCCTTGTACAT

ACTCTCACACAGGTTCCCCTTGTACATACATGCACATACACACCCAAACACACATAGAGGACTCTGGAGCCGCAGTGGGACAGCCCTGCCTGCTTGTTCT

TCTGAACTTGGGGACCATGCCTCTTTGGGCTCTGCTTCCAGGATGGTTTGGGAAGCATAGCAGGGCACGGCTCGGCTCCTGAGATCCATCCCCTAGACTG

ACTGACCGACAGACACACAAACACCAGACTGAAGCACATGTAATATAGACTGTGTATGTTTACAATGTTGTGTATAAATGGGACACTTTGCCCTCTACCA

CCTCCCCTTTGGTTGTATGATTTTCTTCTTTTTTAATGACTCCTGGAAGCAGTGCCCCTTCAGAGCTGGCTGGGAGCTTGGCTCAGCCACCTCTTAGGGT

GCCTGCCTCTGCCATGGCATCCTGTCCCTTTCCCATGTGCTCGGTGTTCAGTGGTGTATATTTCTTCTCCCAGACATGGGGCGTGTGCCCCAAGGGGTCT

GATCCCCTCCTTAGTCTTAGCTCATGGGGCGGCTCATGAGGAGCTGGGGGCAGGGTAGAATGGGACCGAGCAGGAACAGAGGCTGCAGTTGGGCTGGCTG

ACTGAGGGTGCCTGGCTGCCCAGCCTGCGGTAGCCGTGCTCCCTGCCCTCCTGTGGCCCTATGGTGTGATGCTGTGTCTGTATCTATGTGTCTATACAAA

GGTACTTGCCCTTTCCCTTTGTAAACTACATTTGACATGGATTAAAACAGT
Translation
MDLHRAAFKMENSSYLPNPLASPALMVLASTAEASRDASIPCQQPRPFGVPVSVDKDVHIPFTNGSYTFASMYHRQGGVPGTFANRDFPPSLLHLHPQFA

PPNLDCTPISMLNHSGVGAFRPFASTEDRESYQSAFTPAKRLKNCHDTESPHLRFSDADGKEYDFGTQLPSSSPGSLKVDDTGKKIFAVSGLISDRETSS

SPEDRNDRC - UNI14594 - - UNI19527 - - UNI30557 - CKKKAVALFDSQAPLCPICQVLLRPSELQEHMEQELEQLAQLPAS - UNI

20009 - SKNSLLKDAMAPGTPK - UNI16934 - - UNI32743 - SLLLSASIKREGDSPTASPHSSATEDLHHSDRYQ - UNI32743 - T

FLRVRANRQTRLNA - UNI9659 - - UNI12384 - - UNI14419 - ARIGKMKRRKQDEGQ - UNI12384 - - UNI14419 - - UNI

21014 - REGSCMAEDDAVDIEHADSNRFEEYEWCGQKRIRATTLLEGGFRG - UNI212 - GSGFVMCSGKENPDSDADLDVDGDDTLEYGKPQ Q

YTEADVIPCTGEEPGEAKEREALRGAVLN NGGPPSTRITPEFSKWASDE EMPSTSNGEGSKQEAMQKTCKNSDIEK - UNI28476 - KITEESAV

TTFEALKARVRELERQLSRGDRYKCLICM DSYSMPLTSIQCWHVHCEECWLRTL - UNI22086 - GAKKLCPQCNTITAPGDLRRIYL
Transcript ENSMUST00000030439
Sequence
GTGTGTGAGTGTGAGAGAATGTGTGCGTGCATGTGTGTGTGAGTGTGTGTGTGCGCGCGCGCGTGTGTGTGCGCCTCCGAGTCCCTGGGAGAGTGGAGGC

TCATTCACTGATTAGAGCCAGCGCTGAGAGGCAGCACTGCTCTTCTCTCACACCAACAGAGTCTCTTGATCTGTACATGCAATCCCAGGCAGCTCGCGAG

CACAAACCCGGGGCCAGCCGCCTGCTGCTGCTGCTGCTGCCGCTGCCGCCACCACCGCCGCCGCTGCCCCCGCCGGCTCTGCGCACCCGGGACTTTTCAT

GCACCACACTCTCCGTCTTCTTACCTTGGTGTCCTGAAAAGTGCGATCGTTCTCCCCAGGAATTTCCACG - UNI14594 - GTCTTCGAAGGGCATG

ATTCCCCAGTAATAATCCTCGCCCTGATCCAAGGTGCAGGTCGCCCTCCCTTCCAGGGAAGACTGCTTCTTGTGTGACACCGGCCATCGAAAGAGACTCC

GATGGACTTACACCGGGCAGCCTTCAAGATGGAGAACTCATCCTATCTTCCCAACCCTCTGGCGTCCCCAGCACTGATGGTCTTGGCGTCCACTGCCGAG

GCCAGCAGGGATGCCTCCATCCCTTGTCAGCAGCCACGACCCTTTGGTGTACCTGTCTCAGTAGACAAGGACGTTCACATTCCCTTCACCAATGGCTCCT

ACACCTTTGCCTCTATGTACCACCGGCAAGGTGGGGTGCCGGGCACTTTTGCCAATCGTGATTTCCCCCCTTCCTTACTACACCTCCACCCCCAGTTTGC

TCCCCCAAACCTAGATTGCACCCCAATCAGTATGCTAAATCACAGTGGTGTGGGGGCATTCCGTCCCTTCGCTTCCACGGAGGACAGGGAGAGCTATCAG

TCTGCCTTTACTCCAGCCAAGAGACTCAAGAACTGCCATGACACAGAGTCTCCCCACCTGCGCTTCTCCGATGCAGATGGCAAGGAATATGACTTTGGGA

CCCAGCTGCCATCCAGCTCCCCTGGCTCACTTAAGGTTGATGATACTGGGAAGAAGATCTTTGCTGTGTCTGGCCTCATCTCTGACCGGGAAACCTCCTC

GAGTCCAGAGGATCGGAATGACAGAT - UNI14594 - - UNI19527 - - UNI30557 - GTAAGAAGAAAGCAGTAGCGTTGTTTGACAGCCA

AGCCCCGCTCTGCCCCATCTGCCAAGTCCTGCTGAGGCCCAGCGAGTTGCAGGAACATATGGAGCAGGAACTGGAACAGCTGGCCCAGCTGCCTGCCAG 

- UNI20009 - CAAAAATTCCCTTCTGAAGGATGCCATGGCTCCGGGCACCCCCAAG - UNI16934 - - UNI32743 - TCCCTCCTGTTGTC

TGCTTCCATCAAGAGGGAAGGAGACTCTCCAACGGCTTCCCCACACTCTTCTGCCACGGAGGACCTGCACCACTCAGACAGATACCAG - UNI32743 

- ACCTTCCTGCGAGTGCGAGCCAACCGGCAAACCCGACTGAATG - UNI9659 - - UNI12384 - - UNI14419 - CTCGGATTGGGAAAAT

GAAACGGAGGAAGCAAGATGAAGGGCAG - UNI12384 - - UNI14419 - - UNI21014 - AGGGAAGGCTCCTGCATGGCTGAAGATGATGC

TGTGGACATCGAGCATGCGGACAGCAACCGCTTTGAGGAATATGAGTGGTGTGGGCAGAAGCGGATACGGGCCACCACACTCCTGGAAGGTGGCTTCCGA

G - UNI212 - GCTCCGGCTTCGTCATGTGCAGTGGCAAAGAGAACCCAGACAGTGACGCTGACCTGGATGTGGATGGAGATGACACACTGGAGTATG

GGAAACCACA ATACACGGAGGCTGATGTCATCCCGTGCACAGGAGAAGAGCCTGGTGAAGCCAAGGAGAGAGAGGCACTCCGGGGCGCAGTCCTAAA T

GGTGGCCCTCCGAGCACCCGCATCACACCTGAGTTCTCTAAATGGGCCAGTGATG AGATGCCATCCACCAGCAATGGTGAAGGCAGCAAGCAGGAGGCC

ATGCAGAAGACCTGCAAGAACAGCGACATTGAGAA - UNI28476 - AATCACCGAAGAGTCAGCTGTAACTACATTTGAGGCTCTGAAGGCTCGGGT

CCGGGAGCTTGAACGGCAGCTATCTCGGGGGGACCGATACAAATGCCTCATCTGCATG GACTCTTACTCGATGCCTCTGACGTCGATCCAGTGTTGGCA

TGTGCACTGTGAAGAGTGTTGGCTGCGGACTCTG - UNI22086 - GGTGCCAAGAAGCTCTGCCCTCAGTGCAACACCATCACAGCCCCCGGAGACC

TGCGGAGGATCTACTTATGAGCTAGCTGTCTAGGCAGGCCTTGCCTCGAGCAACGCCCCTGCCCAGCCTCTGTGACAGTGACTCCCTCTCCCCTTGTACA

TACTCTCACACAGGTTCCCCTTGTACATACATGCACATACACACCCAAACACACATAGAGGACTCTGGAGCCGCAGTGGGACAGCCCTGCCTGCTTGTTC

TTCTGAACTTGGGGACCATGCCTCTTTGGGCTCTGCTTCCAGGATGGTTTGGGAAGCATAGCAGGGCACGGCTCGGCTCCTGAGATCCATCCCCTAGACT

GACTGACCGACAGACACACAAACACCAGACTGAAGCACATGTAATATAGACTGTGTATGTTTACAATGTTGTGTATAAATGGGACACTTTGCCCTCTACC

ACCTCCCCTTTGGTTGTATGATTTTCTTCTTTTTTAATGACTCCTGGAAGCAGTGCCCCTTCAGAGCTGGCTGGGAGCTTGGCTCAGCCACCTCTTAGGG

TGCCTGCCTCTGCCATGGCATCCTGTCCCTTTCCCATGTGCTCGGTGTTCAGTGGTGTATATTTCTTCTCCCAGACATGGGGCGTGTGCCCCAAGGGGTC

TGATCCCCTCCTTAGTCTTAGCTCATGGGGCGGCTCATGAGGAGCTGGGGGCAGGGTAGAATGGGACCGAGCAGGAACAGAGGCTGCAGTTGGGCTGGCT

GACTGAGGGTGCCTGGCTGCCCAGCCTGCGGTAGCCGTGCTCCCTGCCCTCCTGTGGCCCTATGGTGTGATGCTGTGTCTGTATCTATGTGTCTATACAA

AGGTACTTGCCCTTTCCCTTTGTAAACTACATTTGACATGGATTAAAACAGTATAAACAAG
Translation
 - UNI14594 - MDLHRAAFKMENSSYLPNPLASPALMVLASTAEASRDASIPCQQPRPFGVPVSVDKDVHIPFTNGSYTFASMYHRQGGVPGTFANR

DFPPSLLHLHPQFAPPNLDCTPISMLNHSGVGAFRPFASTEDRESYQSAFTPAKRLKNCHDTESPHLRFSDADGKEYDFGTQLPSSSPGSLKVDDTGKKI

FAVSGLISDRETSSSPEDRNDRC - UNI14594 - - UNI19527 - - UNI30557 - CKKKAVALFDSQAPLCPICQVLLRPSELQEHMEQELE

QLAQLPAS - UNI20009 - SKNSLLKDAMAPGTPK - UNI16934 - - UNI32743 - SLLLSASIKREGDSPTASPHSSATEDLHHSDRYQ 

- UNI32743 - TFLRVRANRQTRLNA - UNI9659 - - UNI12384 - - UNI14419 - ARIGKMKRRKQDEGQ - UNI12384 - - UN

I14419 - - UNI21014 - REGSCMAEDDAVDIEHADSNRFEEYEWCGQKRIRATTLLEGGFRG - UNI212 - GSGFVMCSGKENPDSDADLDV

DGDDTLEYGKPQ QYTEADVIPCTGEEPGEAKEREALRGAVLN NGGPPSTRITPEFSKWASDE EMPSTSNGEGSKQEAMQKTCKNSDIEK - UNI28

476 - KITEESAVTTFEALKARVRELERQLSRGDRYKCLICM DSYSMPLTSIQCWHVHCEECWLRTL - UNI22086 - GAKKLCPQCNTITAPGD

LRRIYL
Transcript ENSMUST00000094853
Sequence
GAGTCATTACTACACTCCTTGGGAAGTACTGCTTCCAGGGCCTCCCAGCAGGGACTTGGAGATTGCCTTCCAGAAGGGGGAACTTGGAGGGCCCTGAGCT

CTTCACACATCCAACAGGGATCCTGACATCTCCAGGTGAAACAG - UNI19527 - - UNI30557 - GTAAGAAGAAAGCAGTAGCGTTGTTTGAC

AGCCAAGCCCCGCTCTGCCCCATCTGCCAAGTCCTGCTGAGGCCCAGCGAGTTGCAGGAACATATGGAGCAGGAACTGGAACAGCTGGCCCAGCTGCCTG

CCAG - UNI20009 - CAAAAATTCCCTTCTGAAGGATGCCATGGCTCCGGGCACCCCCAAG - UNI16934 - - UNI32743 - TCCCTCCTG

TTGTCTGCTTCCATCAAGAGGGAAGGAGACTCTCCAACGGCTTCCCCACACTCTTCTGCCACGGAGGACCTGCACCACTCAGACAGATACCAG - UNI3

2743 - ACCTTCCTGCGAGTGCGAGCCAACCGGCAAACCCGACTGAATG - UNI9659 - - UNI12384 - - UNI14419 - CTCGGATTGGG

AAAATGAAACGGAGGAAGCAAGATGAAGGGCAGGTATGTCCCCTGTGCAGCCGCCCCCTGGCAGGATCGGAGCAGGAGATGAGTAGGCATGTGGAGCACT

GCCTGGCTAAG - UNI12384 - - UNI14419 - - UNI21014 - AGGGAAGGCTCCTGCATGGCTGAAGATGATGCTGTGGACATCGAGCATG

CGGACAGCAACCGCTTTGAGGAATATGAGTGGTGTGGGCAGAAGCGGATACGGGCCACCACACTCCTGGAAGGTGGCTTCCGAG - UNI212 - GCTC

CGGCTTCGTCATGTGCAGTGGCAAAGAGAACCCAGACAGTGACGCTGACCTGGATGTGGATGGAGATGACACACTGGAGTATGGGAAACCACA ATACAC

GGAGGCTGATGTCATCCCGTGCACAGGAGAAGAGCCTGGTGAAGCCAAGGAGAGAGAGGCACTCCGGGGCGCAGTCCTAAA TGGTGGCCCTCCGAGCAC

CCGCATCACACCTGAGTTCTCTAAATGGGCCAGTGATG AGATGCCATCCACCAGCAATGGTGAAGGCAGCAAGCAGGAGGCCATGCAGAAGACCTGCAA

GAACAGCGACATTGAGAA - UNI28476 - AATCACCGAAGAGTCAGCTGTAACTACATTTGAGGCTCTGAAGGCTCGGGTCCGGGAGCTTGAACGGC

AGCTATCTCGGGGGGACCGATACAAATGCCTCATCTGCATG GACTCTTACTCGATGCCTCTGACGTCGATCCAGTGTTGGCATGTGCACTGTGAAGAGT

GTTGGCTGCGGACTCTG - UNI22086 - GGTGCCAAGAAGCTCTGCCCTCAGTGCAACACCATCACAGCCCCCGGAGACCTGCGGAGGATCTACTTA

TGAGCTAGCTGTCTAGGCAGGCCTTGCCTCGAGCAACGCCCCTGCCCAGCCTCTGTGACAGTGACTCCCTCTCCCCTTGTACATACTCTCACACAGGTTC

CCCTTGTACATACATGCACATACACACCCAAACACACATAGAGGACTCTGGAGCCGCAGTGGGACAGCCCTGCCTGCTTGTTCTTCTGAACTTGGGGACC

ATGCCTCTTTGGGCTCTGCTTCCAGGATGGTTTGGGAAGCATAGCAGGGCACGGCTCGGCTCCTGAGATCCATCCCCTAGACTGACTGACCGACAGACAC

ACAAACACCAGACTGAAGCACATGTAATATAGACTGTGTATGTTTACAATGTTGTGTATAAATGGGACACTTTGCCCTCT
Translation
 - UNI19527 - - UNI30557 - MEQELEQLAQLPAS - UNI20009 - SKNSLLKDAMAPGTPK - UNI16934 - - UNI32743 - SL

LLSASIKREGDSPTASPHSSATEDLHHSDRYQ - UNI32743 - TFLRVRANRQTRLNA - UNI9659 - - UNI12384 - - UNI14419 - 

ARIGKMKRRKQDEGQVCPLCSRPLAGSEQEMSRHVEHCLAK - UNI12384 - - UNI14419 - - UNI21014 - REGSCMAEDDAVDIEHADS

NRFEEYEWCGQKRIRATTLLEGGFRG - UNI212 - GSGFVMCSGKENPDSDADLDVDGDDTLEYGKPQ QYTEADVIPCTGEEPGEAKEREALRGAV

LN NGGPPSTRITPEFSKWASDE EMPSTSNGEGSKQEAMQKTCKNSDIEK - UNI28476 - KITEESAVTTFEALKARVRELERQLSRGDRYKCLI

CM DSYSMPLTSIQCWHVHCEECWLRTL - UNI22086 - GAKKLCPQCNTITAPGDLRRIYL
Transcript ENSMUST00000097914
Sequence
GATCAGGGCCAACATGGCCGCCGCCGGTGCTGGGAGCTGAGGTGCCGCCGCCGCCGGGCAGCCGGGGGGAATCCGCCCGCATCGCCGCCCTTGCCGGCCG

GGCTGCCGCGGAGCCCAAAGCGCCGGAGGCTGGAGCTGGGGCGGCACCGCGCGGCGGCCGCGGGCTCCCGTTAGAGCAGCCCGGGCGGCTATGCCGAGGG

CCCGGAGCGGCCGGCGGAGCAGGGGGGCCGACGGGAGGGAGGAA - UNI32743 - ACCTTCCTGCGAGTGCGAGCCAACCGGCAAACCCGACTGAAT

G - UNI9659 - - UNI12384 - - UNI14419 - CTCGGATTGGGAAAATGAAACGGAGGAAGCAAGATGAAGGGCAGGTATGTCCCCTGTGCA

GCCGCCCCCTGGCAGGATCGGAGCAGGAGATGAGTAGGCATGTGGAGCACTGCCTGGCTAAG - UNI12384 - - UNI14419 - - UNI21014 

- AGGGAAGGCTCCTGCATGGCTGAAGATGATGCTGTGGACATCGAGCATGCGGACAGCAACCGCTTTGAGGAATATGAGTGGTGTGGGCAGAAGCGGAT

ACGGGCCACCACACTCCTGGAAGGTGGCTTCCGAG - UNI212 - GCTCCGGCTTCGTCATGTGCAGTGGCAAAGAGAACCCAGACAGTGACGCTGAC

CTGGATGTGGATGGAGATGACACACTGGAGTATGGGAAACCACA ATACACGGAGGCTGATGTCATCCCGTGCACAGGAGAAGAGCCTGGTGAAGCCAAG

GAGAGAGAGGCACTCCGGGGCGCAGTCCTAAA TGGTGGCCCTCCGAGCACCCGCATCACACCTGAGTTCTCTAAATGGGCCAGTGATG AGATGCCATC

CACCAGCAATGGTGAAGGCAGCAAGCAGGAGGCCATGCAGAAGACCTGCAAGAACAGCGACATTGAGAA - UNI28476 - AATCACCGAAGAGTCAG

CTGTAACTACATTTGAGGCTCTGAAGGCTCGGGTCCGGGAGCTTGAACGGCAGCTATCTCGGGGGGACCGATACAAATGCCTCATCTGCATG GACTCTT

ACTCGATGCCTCTGACGTCGATCCAGTGTTGGCATGTGCACTGTGAAGAGTGTTGGCTGCGGACTCTG - UNI22086 - GGTGCCAAGAAGCTCTGC

CCTCAGTGCAACACCATCACAGCCCCCGGAGACCTGCGGAGGATCTACTTATGAGCTAGCTGTCTAGGCAGGCCTTGCCTCGAGCAACGCCCCTGCCCAG

CCTCTGTGACAGTGACTCCCTCTCCCCTTGTACATACTCTCACACAGGTTCCCCTTGTACATACATGCACATACACACCCAAACACACATAGAGGACTCT

GGAGCCGCAGTGGGACAGCCCTGCCTGCTTGTTCTTCTGAACTTGGGGACCATGCCTCTTTGGGCTCTGCTTCCAGGATGGTTTGGGAAGCATAGCAGGG

CACGGCTCGGCTCCTGAGATCCATCCCCTAGACTGACTGACCGACAGACACACAAACACCAGACTGAAGCACATGTAATATAGACTGTGTATGTTTACAA

TGTTGTGTATAAATGGGACACTTTGCCCTCTACCACCTCCCCTTTGGTTGTATGATTTTCTTCTTTTTTAATGACTCCTGGAAGCAGTGCCCCTTCAGAG

CTGGCTGGGAGCTTGGCTCAGCCACCTCTTAGGGTGCCTGCCTCTGCCATGGCATCCTGTCCCTTTCCCATGTGCTCGGTGTTCAGTGGTGTATATTTCT

TCTCCCAGACATGGGGCGTGTGCCCCAAGGGGTCTGATCCCCTCCTTAGTCTTAGCTCATGGGGCGGCTCATGAGGAGCTGGGGGCAGGGTAGAATGGGA

CCGAGCAGGAACAGAGGCTGCAGTTGGGCTGGCTGACTGAGGGTGCCTGGCTGCCCAGCCTGCGGTAGCCGTGCTCCCTGCCCTCCTGTGGCCCTATGGT

GTGATGCTGTGTCTGTATCTATGTGTCTATACAAAGGTACTTGCCCTTTCCCTTTGTAAACTACATTTGACATGGATTAAAACAGT
Translation
MPRARSGRRSRGADGREE - UNI32743 - TFLRVRANRQTRLNA - UNI9659 - - UNI12384 - - UNI14419 - ARIGKMKRRKQDEG

QVCPLCSRPLAGSEQEMSRHVEHCLAK - UNI12384 - - UNI14419 - - UNI21014 - REGSCMAEDDAVDIEHADSNRFEEYEWCGQKRI

RATTLLEGGFRG - UNI212 - GSGFVMCSGKENPDSDADLDVDGDDTLEYGKPQ QYTEADVIPCTGEEPGEAKEREALRGAVLN NGGPPSTRITP

EFSKWASDE EMPSTSNGEGSKQEAMQKTCKNSDIEK - UNI28476 - KITEESAVTTFEALKARVRELERQLSRGDRYKCLICM DSYSMPLTSIQ

CWHVHCEECWLRTL - UNI22086 - GAKKLCPQCNTITAPGDLRRIYL
Transcript ENSMUST00000102690
Sequence
GAATGAGGAACAAGCGACACAATTCCACTCGGGAGCTCAGCTTTGAATTTGCAGACTGCTGGGACCTCACTATACAAGTCGGCAGGGCGCTGAGAATGTT

TTTCTTCTAGTTTTTAATCAGTGCCCAGTAGTGTGAATGCAGCCTCTCTGCTGAGACTTGACAATGCAATGCGATCTGGAGTTCCCACGGCAACAGAACT

AACTCGTCCCAGGGCTCTTTGAGTTATCAGTCGGCCCACATTTCACAAAG - UNI12384 - - UNI14419 - CTCGGATTGGGAAAATGAAACGG

AGGAAGCAAGATGAAGGGCAG - UNI12384 - - UNI14419 - - UNI21014 - AGGGAAGGCTCCTGCATGGCTGAAGATGATGCTGTGGAC

ATCGAGCATGCGGACAGCAACCGCTTTGAGGAATATGAGTGGTGTGGGCAGAAGCGGATACGGGCCACCACACTCCTGGAAGGTGGCTTCCGAG - UNI

212 - GCTCCGGCTTCGTCATGTGCAGTGGCAAAGAGAACCCAGACAGTGACGCTGACCTGGATGTGGATGGAGATGACACACTGGAGTATGGGAAACC

ACA ATACACGGAGGCTGATGTCATCCCGTGCACAGGAGAAGAGCCTGGTGAAGCCAAGGAGAGAGAGGCACTCCGGGGCGCAGTCCTAAA TGGTGGCC

CTCCGAGCACCCGCATCACACCTGAGTTCTCTAAATGGGCCAGTGATG AGATGCCATCCACCAGCAATGGTGAAGGCAGCAAGCAGGAGGCCATGCAGA

AGACCTGCAAGAACAGCGACATTGAGAA - UNI28476 - AATCACCGAAGAGTCAGCTGTAACTACATTTGAGGCTCTGAAGGCTCGGGTCCGGGAG

CTTGAACGGCAGCTATCTCGGGGGGACCGATACAAATGCCTCATCTGCATG GACTCTTACTCGATGCCTCTGACGTCGATCCAGTGTTGGCATGTGCAC

TGTGAAGAGTGTTGGCTGCGGACTCTG - UNI22086 - GGTGCCAAGAAGCTCTGCCCTCAGTGCAACACCATCACAGCCCCCGGAGACCTGCGGAG

GATCTACTTATGAGCTAGCTGTCTAGGCAGGCCTTGCCTCGAGCAACGCCCCTGCCCAGCCTCTGTGACAGTGACTCCCTCTCCCCTTGTACATACTCTC

ACACAGGTTCCCCTTGTACATACATGCACATACACACCCAAACACACATAGAGGACTCTGGAGCCGCAGTGGGACAGCCCTGCCTGCTTGTTCTTCTGAA

CTTGGGGACCATGCCTCTTTGGGCTCTGCTTCCAGGATGGTTTGGGAAGCATAGCAGGGCACGGCTCGGCTCCTGAGATCCATCCCCTAGACTGACTGAC

CGACAGACACACAAACACCAGACTGAAGCACATGTAATATAGACTGTGTATGTTTACAATGTTGTGTATAAATGGGACACTTTGCCCTCTACCACCTCCC

CTTTGGTTGTATGATTTTCTTCTTTTTTAATGACTCCTGGAAGCAGTGCCCCTTCAGAGCTGGCTGGGAGCTTGGCTCAGCCACCTCTTAGGGTGCCTGC

CTCTGCCATGGCATCCTGTCCCTTTCCCATGTGCTCGGTGTTCAGTGGTGTATATTTCTTCTCCCAGACATGGGGCGTGTGCCCCAAGGGGTCTGATCCC

CTCCTTAGTCTTAGCTCATGGGGCGGCTCATGAGGAGCTGGGGGCAGGGTAGAATGGGACCGAGCAGGAACAGAGGCTGCAGTTGGGCTGGCTGACTGAG

GGTGCCTGGCTGCCCAGCCTGCGGTAGCCGTGCTCCCTGCCCTCCTGTGGCCCTATGGTGTGATGCTGTGTCTGTATCTATGTGTCTATACAAAGGTACT

TGCCCTTTCCCTTTGTAAACTACATTTGACATGGATTAAAACAGTATAAACAA
Translation
 - UNI12384 - - UNI14419 - MKRRKQDEGQ - UNI12384 - - UNI14419 - - UNI21014 - REGSCMAEDDAVDIEHADSNRFE

EYEWCGQKRIRATTLLEGGFRG - UNI212 - GSGFVMCSGKENPDSDADLDVDGDDTLEYGKPQ QYTEADVIPCTGEEPGEAKEREALRGAVLN N

GGPPSTRITPEFSKWASDE EMPSTSNGEGSKQEAMQKTCKNSDIEK - UNI28476 - KITEESAVTTFEALKARVRELERQLSRGDRYKCLICM D

SYSMPLTSIQCWHVHCEECWLRTL - UNI22086 - GAKKLCPQCNTITAPGDLRRIYL

For any suggestions or comments, please send an email to unitrap@crg.es