Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000028693 (Nasp)
Chromosomal location
Chr 4: 116273657 - 116300556 (-)
Description
nuclear autoantigenic sperm protein (histone-binding) Gene [Source:MGI (curated);Acc:Nasp-001]
RefSeq_dna
NM_016777 NM_001081475 
RefSeq_peptide
NP_058057.3 NP_001074944.1 
UniGene
Mm.257181 Mm.401098 
MGI
MGI:1355328 
Uniprot/SWISSPROT
Q99MD9 
Uniprot/SPTREMBL
B1AU75 Q3TTH5 B1AU77 B1AU76 
Human Ortholog
ENSG00000132780 (NASP)
Omim not available
UniTrap UNI1110
Vector Insertion
Chr 4: 116299936 - 116300035
Public Clones CC0209 (sanger) CC0815 (sanger) P134B06 (ggtc) P102B04 (ggtc) P137H08 (ggtc)
H008G08 (ggtc) D014G07 (ggtc) W171F03 (ggtc) H003F08 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15787
Vector Insertion
Chr 4: 116299936 - 116300084
Public Clones not available
Private Clones OST473296 (lexicon) OST112948 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34436
Vector Insertion
Chr 4: 116299936 - 116300557
Public Clones IST15026G3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16731
Vector Insertion
Chr 4: 116295420 - 116299936
Public Clones (sanger) D029A11 (ggtc) P137H08 (ggtc) D014G07 (ggtc) P102F08 (ggtc)
5SD096F04 (ggtc) P119B04 (ggtc) H008G08 (ggtc) 3SD096F04 (ggtc) D016F11 (ggtc)
PST22129-NR (escells) IST14528C5 (tigm) IST10758G9 (tigm)
Private Clones OST455409 (lexicon) OST420774 (lexicon) OST43922 (lexicon)
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11645
Vector Insertion
Chr 4: 116291586 - 116295371
Public Clones (sanger) H003F08 (ggtc) P078D09 (ggtc) PST23465-NR (escells) PST19125-NR (escells)
Private Clones OST351458 (lexicon) OST209923 (lexicon) OST68145 (lexicon) OST67988 (lexicon)
OST13724 (lexicon)
Severity of mutation (?) Insertion after 5% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1664
Vector Insertion
Chr 4: 116286934 - 116291586
Public Clones CJ0877 (sanger) CJ0869 (sanger) TEA205 (baygenomics)
Private Clones OST41697 (lexicon)
Severity of mutation (?) Insertion after 10% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5924
Vector Insertion
Chr 4: 116283983 - 116284576
Public Clones YHB010 (baygenomics) YHB011 (baygenomics) CSH175 (baygenomics) XG150 (baygenomics)
PST11008-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 18% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5688
Vector Insertion
Chr 4: 116278369 - 116283007
Public Clones CSI625 (baygenomics) H010H05 (ggtc) H006F04 (ggtc) PST11659-NL (escells)
PST8586-NR (escells) PST14790-NR (escells) PST11440-NR (escells) PST443-1 (escells)
PST12735-NL (escells) PST7730-NR (escells) PST15407-NL (escells)
Private Clones not available
Severity of mutation (?) Insertion after 60% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10703
Vector Insertion
Chr 4: 116277600 - 116278288
Public Clones H009D09 (ggtc) H010H08 (ggtc) H009A06 (ggtc) H010H03 (ggtc) H010D08 (ggtc)
H007D10 (ggtc) H009D12 (ggtc) H011D05 (ggtc) H005E02 (ggtc) H005F02 (ggtc)
H010H05 (ggtc) H008B07 (ggtc) H010G03 (ggtc) H011E04 (ggtc) H010A12 (ggtc)
H006H09 (ggtc) H011C09 (ggtc) H006C03 (ggtc) H010G11 (ggtc) H007H10 (ggtc)
H010F12 (ggtc) H006F04 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 63% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18363
Vector Insertion
Chr 4: 116276957 - 116277345
Public Clones not available
Private Clones OST424933 (lexicon)
Severity of mutation (?) Insertion after 70% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19855
Vector Insertion
Chr 4: 116275550 - 116276499
Public Clones not available
Private Clones OST378784 (lexicon)
Severity of mutation (?) Insertion after 86% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10814
Vector Insertion
Chr 4: 116275409 - 116275492
Public Clones P134E10 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 88% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9088
Vector Insertion
Chr 4: 116274826 - 116275330
Public Clones XK218 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 91% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000030456
Sequence
AGCTCTTGCGTTTCCATCCGTTAAGACTGAGAGGACATAGGGAATACCTGTCACCTTCTCGG - UNI1110 - - UNI15787 - - UNI34436 -

 GCAGTGTTCTGCCCACTGGCCCACCACCTCAGGGGAACGATGGCCACAGAGTCTACAGCCGCTGCTGCCATCGCCGCGGAGCTGGTTTCCGCTGACAA 

- UNI1110 - - UNI15787 - - UNI16731 - - UNI34436 - AATTGAAGATGCTCCTGCTCCTTCTACCTCGGCAGATAAAATGGAGAG 

- UNI1664 - - UNI11645 - TCTGGATGTGGATAGTGAAGCTAAGAAACTACTGGGATTAGGACAGAAACATCTGGTGATGGGTGACATTCCAGC

AGCTGTTAATGCATTCCAGGAAGCAGCTAGTCTTTT - UNI1664 - AGGTAAGAAGTATGGAGAAACGGCTAATGAGTGTGGAGAAGCCTTCTTTTT

TTATGGGAAGTCACTTCTGGAGTTAGCCAG - UNI1664 - AATGGAGAATGGAGTGTTGGGAAATGCCTTAGAAGGAGTGCATGTAGAAGAGGAAGA

AGGAGAAAAAACAGAAGATGAATCTTTGGTAGAAAATAATGATAATGTAGATG - UNI5924 - AGGAAGCAAGGGAAGAGTTGAGAGAACAGGTTTA

TGACGCCATGGGAGAAAAAGAAGCCAAAAAAGCAGAAGGCAAGTCTCTGACAAAGCCTGAAACTGATAAAGAACAGGAAAGTGAAGTGGAGAAGGGTGGA

AGAGAAGACATGGATATAAGTGAGCCTGAAGAGAAGCTCCAGGAAACAGTTGAACCGACTTCAAAGCAGTTAACTGAATCCTCTGAAGAGGCAAAAGAAG

CAGCAATACCAGGACTGAATGAAGATGAGGTCGCTTCTGGGAAGACAGAGCAGGAATCATTGTGTACTGAGAAAGGAAAATCAATTTCAGGAGCTTATGT

TCAAAATAAAGAATTCAGAGAAACAGTGGAGGAGGGAGAGGAAATAATAAGCTTAGAGAAAAAGCCAAAAGAAACTTCAGAAGATCAGCCTATCAGGGCT

GCAGAAAAGCAGGGCACTTTAATGAAGGTGGTAGAAATAGAAGCTGAAATAGACCCTCAAGTCAAGTCAGCGGATGTGGGAGGGGAGGAGCCAAAAGATC

AGGTAGCTACCTCTGAGAGTGAACTAGGTAAGGCTGTTCTTATGGAACTGTCAGGGCAAGATGTTGAAGCATCACCAGTCGTGGCTGCAGAGGCCGGAGC

TGAAGTCTCTGAGAAGCCAGGGCAGGAGATTACAGTTATTCCCAACAATGGTCCAGTTGTTGGACAATCAACTGTAGGAGATCAGACTCCTAGTGAACCA

CAGACTTCTGCAGAAAGACTGACAGAAACTAAAGATGGCTCAAGTGTAGAGGAGGTCAAGGCAGAGCTGGTTCCTGAACAGGAGGAAGCTATGCTACCTG

TAGAAGAGTCTGAGGCAGCTGGAGATGGGGTTGAGACCAAGGTAGCCCAGAGGGCCACGGAGAAAGCACCTGAAGACAAATTTAAGATAGCTGCTAATGA

AGAGACACAAGAGAGAGACGAACAGATGAAAGAGGGTGAAG - UNI5688 - AAACTGAAGGCTCAGAGGAAGAGGACAGAGAAAATGACAAGGCTGA

AGAAACACCAAATGAATCAGTTCTTGAAAAAAAG - UNI10703 - TCTCTTCAAGAAAATGAAGAGGAGGAGATAGGGAATTTGGAACTTGCCTGGG

ATATGCTGGATTTAGCCAAGATCATTTTTAAGAG GCAAGAAACAAAAGAAGCCCAGCTTTATGCTGCACAAGCCCATCTTAAACTTGGAGAAGTTAGTG

TTGAATCTG - UNI18363 - AGAATTATATCCAAGCTGTGGAGGAGTTTCAGGCTTGCCTAAGCCTGCAAGAACAATATTTGGAAGCTCACGATCGT

CTCCTTGCAGAGACTCACTACCAATTAGGTTTGGCCTATGGTTACAACTCTCAGTATGATGAAGCAGTAGCACAGTTTGGCAAATCTATCGATGTCATTG

AAAAGAGAATGG CTGTACTCCATGAGCAGATGAAGGAGGCCGAAGGATCGTTTACTGAATATGAGAAAGAAATTGAGGAGCTGAAAGAACTGCTACCTG

AAATTCGAGAGAAGATAGAAGACGCAAAGGAATCTCAGCGGAGTGGGAATGTAGCCGAACTGGCACTGAAAGCTACTCTG - UNI19855 - GTGGAG

AGCTCTACTTCCGGTTTCACTCCTAGTGGAGCTGGTGCCTCAGTATCCATG - UNI10814 - ATTGCCAGTAGAAAACCAACAGATGGCGCTTCCTC

ATCAAATTGTGTGACTGATATTTCCCATCTTGTCAGAAAGAAG - UNI9088 - AGGAAACCAGAGGAAGAGAGTCCCCGGAAGGATGATGCAAAGAA

AGCTAAACAAGAGCCAGAGGTGAATGGAGGCAGTGGGGATGCTGTCTCCAGTGGAAAGGAAGTTTCAGAAAACATGGAGGCCGAG GCTGAGAATCAGGC

TGAGAGCCAAACAGCAGAGGGGACCGTGGAGTCTGCAGCTACAATTAAAAGCACTGCATGTTAAGAGGCGAGCAGAACCTTCCTCCTGAGGGAAAGTGGT

TTTGTACATAATGTATTTTTTCACTTTTGGGGATTCTTTTTGTATAACTCCAATAAAGATTGTAGGCAACAGCTGAGGCTTTGATGGCTTTTTTTCTTAA

ATATTGGTGGAATGCTTTGGGGCACTCTACATTTCTTGTGTGTACATGTTTGTGTTTTGCTATTGCACAACCCACTTCCTGTCTAATGTGGAGGTGATCA

AGTGTGGCTAGAAGCCCTTCATCTTCTACTGGTGCTATGTTCTATTTCCCAATACTTGGCTGAAATCAATTACTGTGTAAGCTTTCAGTGGTGCTGTCCT

TGGATGGGGTCTGCTAAATAAGAACTGGTAGAAATCAGTTTGGTGCTGAAAATGGATGATGGAATATGACCCAGGTCTTGGTTTGTCCCTATCTGCTGTT

CATCTGGTTTCCATTTAAGGCCATAATCCTATCCTGGGAAAACTGGTAGAAACCTGGGAAATTGTTCCTGAGGAAAACAGTTGTTAGACTCAGGCTCACA

CTGTAGTATAAGACACTGGGGGGAGAAAGTGTGTTATTTTCTGTATAGAAAGGTTACTATATGTCAATAAGTGGAATTGTTATATTGTCTGCAGTTTTGT

CTATAAAAATAAATATGCTAATTTTAAC
Translation
 - UNI1110 - - UNI15787 - - UNI34436 - MATESTAAAAIAAELVSADK - UNI1110 - - UNI15787 - - UNI16731 - - 

UNI34436 - KIEDAPAPSTSADKMES - UNI1664 - - UNI11645 - SLDVDSEAKKLLGLGQKHLVMGDIPAAVNAFQEAASLL - UNI16

64 - LGKKYGETANECGEAFFFYGKSLLELAR - UNI1664 - RMENGVLGNALEGVHVEEEEGEKTEDESLVENNDNVDE - UNI5924 - EEA

REELREQVYDAMGEKEAKKAEGKSLTKPETDKEQESEVEKGGREDMDISEPEEKLQETVEPTSKQLTESSEEAKEAAIPGLNEDEVASGKTEQESLCTEK

GKSISGAYVQNKEFRETVEEGEEIISLEKKPKETSEDQPIRAAEKQGTLMKVVEIEAEIDPQVKSADVGGEEPKDQVATSESELGKAVLMELSGQDVEAS

PVVAAEAGAEVSEKPGQEITVIPNNGPVVGQSTVGDQTPSEPQTSAERLTETKDGSSVEEVKAELVPEQEEAMLPVEESEAAGDGVETKVAQRATEKAPE

DKFKIAANEETQERDEQMKEGEE - UNI5688 - ETEGSEEEDRENDKAEETPNESVLEKK - UNI10703 - SLQENEEEEIGNLELAWDMLDLA

KIIFKR RQETKEAQLYAAQAHLKLGEVSVESE - UNI18363 - ENYIQAVEEFQACLSLQEQYLEAHDRLLAETHYQLGLAYGYNSQYDEAVAQFG

KSIDVIEKRMA AVLHEQMKEAEGSFTEYEKEIEELKELLPEIREKIEDAKESQRSGNVAELALKATL - UNI19855 - VESSTSGFTPSGAGASVS

M - UNI10814 - IASRKPTDGASSSNCVTDISHLVRKK - UNI9088 - RKPEEESPRKDDAKKAKQEPEVNGGSGDAVSSGKEVSENMEAE AE

NQAESQTAEGTVESAATIKSTAC
Transcript ENSMUST00000106474
Sequence
AGCTCTTGCGTTTCCATCCGTTAAGACTGAGAGGACATAGGGAATACCTGTCACCTTCTCGG - UNI1110 - - UNI15787 - - UNI34436 -

 GCAGTGTTCTGCCCACTGGCCCACCACCTCAGGGGAACGATGGCCACAGAGTCTACAGCCGCTGCTGCCATCGCCGCGGAGCTGGTTTCCGCTGACAA 

- UNI1110 - - UNI15787 - - UNI16731 - - UNI34436 - AATTGAAGATGCTCCTGCTCCTTCTACCTCGGCAGATAAAATGGAGAG 

- UNI1664 - - UNI11645 - TCTGGATGTGGATAGTGAAGCTAAGAAACTACTGGGATTAGGACAGAAACATCTGGTGATGGGTGACATTCCAGC

AGCTGTTAATGCATTCCAGGAAGCAGCTAGTCTTTT - UNI1664 - AATGGAGAATGGAGTGTTGGGAAATGCCTTAGAAGGAGTGCATGTAGAAGA

GGAAGAAGGAGAAAAAACAGAAGATGAATCTTTGGTAGAAAATAATGATAATGTAGATG - UNI5688 - - UNI5924 - AAACTGAAGGCTCAGA

GGAAGAGGACAGAGAAAATGACAAGGCTGAAGAAACACCAAATGAATCAGTTCTTGAAAAAAAG - UNI10703 - TCTCTTCAAGAAAATGAAGAGG

AGGAGATAGGGAATTTGGAACTTGCCTGGGATATGCTGGATTTAGCCAAGATCATTTTTAAGAG GCAAGAAACAAAAGAAGCCCAGCTTTATGCTGCAC

AAGCCCATCTTAAACTTGGAGAAGTTAGTGTTGAATCTG - UNI18363 - AGAATTATATCCAAGCTGTGGAGGAGTTTCAGGCTTGCCTAAGCCTG

CAAGAACAATATTTGGAAGCTCACGATCGTCTCCTTGCAGAGACTCACTACCAATTAGGTTTGGCCTATGGTTACAACTCTCAGTATGATGAAGCAGTAG

CACAGTTTGGCAAATCTATCGATGTCATTGAAAAGAGAATGG CTGTACTCCATGAGCAGATGAAGGAGGCCGAAGGATCGTTTACTGAATATGAGAAAG

AAATTGAGGAGCTGAAAGAACTGCTACCTGAAATTCGAGAGAAGATAGAAGACGCAAAGGAATCTCAGCGGAGTGGGAATGTAGCCGAACTGGCACTGAA

AGCTACTCTG - UNI19855 - GTGGAGAGCTCTACTTCCGGTTTCACTCCTAGTGGAGCTGGTGCCTCAGTATCCATG - UNI10814 - ATTGC

CAGTAGAAAACCAACAGATGGCGCTTCCTCATCAAATTGTGTGACTGATATTTCCCATCTTGTCAGAAAGAAG - UNI9088 - AGGAAACCAGAGGA

AGAGAGTCCCCGGAAGGATGATGCAAAGAAAGCTAAACAAGAGCCAGAGGTGAATGGAGGCAGTGGGGATGCTGTCTCCAGTGGAAAGGAAGTTTCAGAA

AACATGGAGGCCGAG GCTGAGAATCAGGCTGAGAGCCAAACAGCAGAGGGGACCGTGGAGTCTGCAGCTACAATTAAAAGCACTGCATGTTAAGAGGCG

AGCAGAACCTTCCTCCTGAGGGAAAGTGGTTTTGTACATAATGTATTTTTTCACTTTTGGGGATTCTTTTTGTATAACTCCAATAAAGATTGTAGGCAAC

AGCTGAGGCTTTGATGGCTTTTTTTCTTAAATATTGGTGGAATGCTTTGGGGCACTCTACATTTCTTGTGTGTACATGTTTGTGTTTTGCTATTGCACAA

CCCACTTCCTGTCTAATGTGGAGGTGATCAAGTGTGGCTAGAAGCCCTTCATCTTCTACTGGTGCTATGTTCTATTTCCCAATACTTGGCTGAAATCAAT

TACTGTGTAAGCTTTCAGTGGTGCTGTCCTTGGATGGGGTCTGCTAAATAAGAACTGGTAGAAATCAGTTTGGTGCTGAAAATGGATGATGGAATATGAC

CCAGGTCTTGGTTTGTCCCTATCTGCTGTTCATCTGGTTTCCATTTAAGGCCATAATCCTATCCTGGGAAAACTGGTAGAAACCTGGGAAATTGTTCCTG

AGGAAAACAGTTGTTAGACTCAGGCTCACACTGTAGTATAAGACACTGGGGGGAGAAAGTGTGTTATTTTCTGTATAGAAAGGTTACTATATGTCAATAA

GTGGAATTGTTATATTGTCTGCAGTTTTGTCTATAAAAATAAATATGCTAATTTTAAC
Translation
 - UNI1110 - - UNI15787 - - UNI34436 - MATESTAAAAIAAELVSADK - UNI1110 - - UNI15787 - - UNI16731 - - 

UNI34436 - KIEDAPAPSTSADKMES - UNI1664 - - UNI11645 - SLDVDSEAKKLLGLGQKHLVMGDIPAAVNAFQEAASLL - UNI16

64 - LMENGVLGNALEGVHVEEEEGEKTEDESLVENNDNVDE - UNI5688 - - UNI5924 - ETEGSEEEDRENDKAEETPNESVLEKK - UN

I10703 - SLQENEEEEIGNLELAWDMLDLAKIIFKR RQETKEAQLYAAQAHLKLGEVSVESE - UNI18363 - ENYIQAVEEFQACLSLQEQYL

EAHDRLLAETHYQLGLAYGYNSQYDEAVAQFGKSIDVIEKRMA AVLHEQMKEAEGSFTEYEKEIEELKELLPEIREKIEDAKESQRSGNVAELALKATL

 - UNI19855 - VESSTSGFTPSGAGASVSM - UNI10814 - IASRKPTDGASSSNCVTDISHLVRKK - UNI9088 - RKPEEESPRKDDAK

KAKQEPEVNGGSGDAVSSGKEVSENMEAE AENQAESQTAEGTVESAATIKSTAC
Transcript ENSMUST00000030457
Sequence
CTCCAATCTGCCATTTTCTCTACCTGAGTGAGTCTCTGCTGTCCGGAATTCTCTGGTTTTCTTCGCAGGCAGTGTTCTGCCCACTGGCCCACCACCTCAG

GGGAACGATGGCCACAGAGTCTACAGCCGCTGCTGCCATCGCCGCGGAGCTGGTTTCCGCTGACAA - UNI1110 - - UNI15787 - - UNI167

31 - - UNI34436 - AATTGAAGATGCTCCTGCTCCTTCTACCTCGGCAGATAAAATGGAGAG - UNI1664 - - UNI11645 - TCTGGATG

TGGATAGTGAAGCTAAGAAACTACTGGGATTAGGACAGAAACATCTGGTGATGGGTGACATTCCAGCAGCTGTTAATGCATTCCAGGAAGCAGCTAGTCT

TTT - UNI1664 - AGGTAAGAAGTATGGAGAAACGGCTAATGAGTGTGGAGAAGCCTTCTTTTTTTATGGGAAGTCACTTCTGGAGTTAGCCAG - 

UNI1664 - AATGGAGAATGGAGTGTTGGGAAATGCCTTAGAAGGAGTGCATGTAGAAGAGGAAGAAGGAGAAAAAACAGAAGATGAATCTTTGGTAGA

AAATAATGATAATGTAGATG - UNI5688 - - UNI5924 - AAACTGAAGGCTCAGAGGAAGAGGACAGAGAAAATGACAAGGCTGAAGAAACACC

AAATGAATCAGTTCTTGAAAAAAAG - UNI10703 - TCTCTTCAAGAAAATGAAGAGGAGGAGATAGGGAATTTGGAACTTGCCTGGGATATGCTGG

ATTTAGCCAAGATCATTTTTAAGAG GCAAGAAACAAAAGAAGCCCAGCTTTATGCTGCACAAGCCCATCTTAAACTTGGAGAAGTTAGTGTTGAATCTG

 - UNI18363 - AGAATTATATCCAAGCTGTGGAGGAGTTTCAGGCTTGCCTAAGCCTGCAAGAACAATATTTGGAAGCTCACGATCGTCTCCTTGCA

GAGACTCACTACCAATTAGGTTTGGCCTATGGTTACAACTCTCAGTATGATGAAGCAGTAGCACAGTTTGGCAAATCTATCGATGTCATTGAAAAGAGAA

TGG CTGTACTCCATGAGCAGATGAAGGAGGCCGAAGGATCGTTTACTGAATATGAGAAAGAAATTGAGGAGCTGAAAGAACTGCTACCTGAAATTCGAG

AGAAGATAGAAGACGCAAAGGAATCTCAGCGGAGTGGGAATGTAGCCGAACTGGCACTGAAAGCTACTCTG - UNI19855 - GTGGAGAGCTCTACT

TCCGGTTTCACTCCTAGTGGAGCTGGTGCCTCAGTATCCATG - UNI10814 - ATTGCCAGTAGAAAACCAACAGATGGCGCTTCCTCATCAAATTG

TGTGACTGATATTTCCCATCTTGTCAGAAAGAAG - UNI9088 - AGGAAACCAGAGGAAGAGAGTCCCCGGAAGGATGATGCAAAGAAAGCTAAACA

AGAGCCAGAGGTGAATGGAGGCAGTGGGGATGCTGTCTCCAGTGGAAAGGAAGTTTCAGAAAACATGGAGGCCGAG GCTGAGAATCAGGCTGAGAGCCA

AACAGCAGAGGGGACCGTGGAGTCTGCAGCTACAATTAAAAGCACTGCATGTTAAGAGGCGAGCAGAACCTTCCTCCTGAGGGAAAGTGGTTTTGTACAT

AATGTATTTTTTCACTTTTGGGGATTCTTTTTGTATAACTCCAATAAAGATTGTAGGCAACAGCTGAGGCTTTGATGGCTTTTTTTCTTAAATATTGGTG

GAATGCTTTGGGGCACTCTACATTTCTTGTGTGTACATGTTTGTGTTTTGCTATTGCACAACCCACTTCCTGTCTAATGTGGAGGTGATCAAGTGTGGCT

AGAAGCCCTTCATCTTCTACTGGTGCTATGTTCTATTTCCCAATACTTGGCTGAAATCAATTACTGTGTAAGCTTTCAGTGGTGCTGTCCTTGGATGGGG

TCTGCTAAATAAGAACTGGTAGAAATCAGTTTGGTGCTGAAAATGGATGATGGAATATGACCCAGGTCTTGGTTTGTCCCTATCTGCTGTTCATCTGGTT

TCCATTTAAGGCCATAATCCTATCCTGGGAAAACTGGTAGAAACCTGGGAAATTGTTCCTGAGGAAAACAGTTGTTAGACTCAGGCTCACACTGTAGTAT

AAGACACTGGGGGGAGAAAGTGTGTTATTTTCTGTATAGAAAGGTTACTATATGTCAATAAGTGGAATTGTTATATTGTCTGCAGTTTTGTCTATAAAAA

TAAATATGCTAATTTTAAC
Translation
MATESTAAAAIAAELVSADK - UNI1110 - - UNI15787 - - UNI16731 - - UNI34436 - KIEDAPAPSTSADKMES - UNI1664 

- - UNI11645 - SLDVDSEAKKLLGLGQKHLVMGDIPAAVNAFQEAASLL - UNI1664 - LGKKYGETANECGEAFFFYGKSLLELAR - UNI

1664 - RMENGVLGNALEGVHVEEEEGEKTEDESLVENNDNVDE - UNI5688 - - UNI5924 - ETEGSEEEDRENDKAEETPNESVLEKK - 

UNI10703 - SLQENEEEEIGNLELAWDMLDLAKIIFKR RQETKEAQLYAAQAHLKLGEVSVESE - UNI18363 - ENYIQAVEEFQACLSLQEQ

YLEAHDRLLAETHYQLGLAYGYNSQYDEAVAQFGKSIDVIEKRMA AVLHEQMKEAEGSFTEYEKEIEELKELLPEIREKIEDAKESQRSGNVAELALKA

TL - UNI19855 - VESSTSGFTPSGAGASVSM - UNI10814 - IASRKPTDGASSSNCVTDISHLVRKK - UNI9088 - RKPEEESPRKDD

AKKAKQEPEVNGGSGDAVSSGKEVSENMEAE AENQAESQTAEGTVESAATIKSTAC
Transcript ENSMUST00000081182
Sequence
CTACCTGAGTGAGTCTCTGCTGTCCGGAATTCTCTGGTTTTCTTCGCAGGCAGTGTTCTGCCCACTGGCCCACCACCTCAGGGGAACGATGGCCACAGAG

TCTACAGCCGCTGCTGCCATCGCCGCGGAGCTGGTTTCCGCTGACAA - UNI1110 - - UNI15787 - - UNI16731 - - UNI34436 - A

ATTGAAGATGCTCCTGCTCCTTCTACCTCGGCAGATAAAATGGAGAG - UNI1664 - - UNI11645 - TCTGGATGTGGATAGTGAAGCTAAGAA

ACTACTGGGATTAGGACAGAAACATCTGGTGATGGGTGACATTCCAGCAGCTGTTAATGCATTCCAGGAAGCAGCTAGTCTTTT - UNI1664 - AAT

GGAGAATGGAGTGTTGGGAAATGCCTTAGAAGGAGTGCATGTAGAAGAGGAAGAAGGAGAAAAAACAGAAGATGAATCTTTGGTAGAAAATAATGATAAT

GTAGATG - UNI5688 - - UNI5924 - AAACTGAAGGCTCAGAGGAAGAGGACAGAGAAAATGACAAGGCTGAAGAAACACCAAATGAATCAGTT

CTTGAAAAAAAG - UNI10703 - TCTCTTCAAGAAAATGAAGAGGAGGAGATAGGGAATTTGGAACTTGCCTGGGATATGCTGGATTTAGCCAAGAT

CATTTTTAAGAG GCAAGAAACAAAAGAAGCCCAGCTTTATGCTGCACAAGCCCATCTTAAACTTGGAGAAGTTAGTGTTGAATCTG - UNI18363 -

 AGAATTATATCCAAGCTGTGGAGGAGTTTCAGGCTTGCCTAAGCCTGCAAGAACAATATTTGGAAGCTCACGATCGTCTCCTTGCAGAGACTCACTACC

AATTAGGTTTGGCCTATGGTTACAACTCTCAGTATGATGAAGCAGTAGCACAGTTTGGCAAATCTATCGATGTCATTGAAAAGAGAATGG CTGTACTCC

ATGAGCAGATGAAGGAGGCCGAAGGATCGTTTACTGAATATGAGAAAGAAATTGAGGAGCTGAAAGAACTGCTACCTGAAATTCGAGAGAAGATAGAAGA

CGCAAAGGAATCTCAGCGGAGTGGGAATGTAGCCGAACTGGCACTGAAAGCTACTCTG - UNI19855 - GTGGAGAGCTCTACTTCCGGTTTCACTC

CTAGTGGAGCTGGTGCCTCAGTATCCATG - UNI10814 - ATTGCCAGTAGAAAACCAACAGATGGCGCTTCCTCATCAAATTGTGTGACTGATATT

TCCCATCTTGTCAGAAAGAAG - UNI9088 - AGGAAACCAGAGGAAGAGAGTCCCCGGAAGGATGATGCAAAGAAAGCTAAACAAGAGCCAGAGGTG

AATGGAGGCAGTGGGGATGCTGTCTCCAGTGGAAAGGAAGTTTCAGAAAACATGGAGGCCGAG GCTGAGAATCAGGCTGAGAGCCAAACAGCAGAGGGG

ACCGTGGAGTCTGCAGCTACAATTAAAAGCACTGCATGTTAAGAGGCGAGCAGAACCTTCCTCCTGAGGGAAAGTGGTTTTGTACATAATGTATTTTTTC

ACTTTTGGGGATTCTTTTTGTATAACTCCAATAAAGATTGTAGGCAACA
Translation
MATESTAAAAIAAELVSADK - UNI1110 - - UNI15787 - - UNI16731 - - UNI34436 - KIEDAPAPSTSADKMES - UNI1664 

- - UNI11645 - SLDVDSEAKKLLGLGQKHLVMGDIPAAVNAFQEAASLL - UNI1664 - LMENGVLGNALEGVHVEEEEGEKTEDESLVENND

NVDE - UNI5688 - - UNI5924 - ETEGSEEEDRENDKAEETPNESVLEKK - UNI10703 - SLQENEEEEIGNLELAWDMLDLAKIIFKR 

RQETKEAQLYAAQAHLKLGEVSVESE - UNI18363 - ENYIQAVEEFQACLSLQEQYLEAHDRLLAETHYQLGLAYGYNSQYDEAVAQFGKSIDVIE

KRMA AVLHEQMKEAEGSFTEYEKEIEELKELLPEIREKIEDAKESQRSGNVAELALKATL - UNI19855 - VESSTSGFTPSGAGASVSM - UNI

10814 - IASRKPTDGASSSNCVTDISHLVRKK - UNI9088 - RKPEEESPRKDDAKKAKQEPEVNGGSGDAVSSGKEVSENMEAE AENQAESQT

AEGTVESAATIKSTAC

For any suggestions or comments, please send an email to unitrap@crg.es