Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000028899 (Taf12)
Chromosomal location
Chr 4: 131830328 - 131849006 (+)
Description
TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor Gene [Source:MGI (curated);Acc:Taf12-001]
RefSeq_dna
NM_025579 
RefSeq_peptide
NP_079855.1 
UniGene
Mm.331926 
MGI
MGI:1913714 
Uniprot/SWISSPROT
Q8VE65 
Uniprot/SPTREMBL
Q3UT56 
Human Ortholog
ENSG00000120656 (TAF12)
Omim not available
UniTrap UNI10755
Vector Insertion
Chr 4: 131830403 - 131837908
Public Clones (sanger) D089E04 (ggtc) W202A06 (ggtc) D086G07 (ggtc) P145C09 (ggtc)
PST3102-NR (escells) IST14682F11 (tigm) IST10779H5 (tigm) IST11107E7 (tigm)
IST12064A3 (tigm) IST12065G10 (tigm) IST10147E4 (tigm) IST11033D9 (tigm)
IST10383E4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15891
Vector Insertion
Chr 4: 131837994 - 131838708
Public Clones P145C09 (ggtc)
Private Clones OST470888 (lexicon) OST464800 (lexicon) OST378244 (lexicon) OST355789 (lexicon)
OST334491 (lexicon) OST333545 (lexicon) OST309688 (lexicon) OST302805 (lexicon)
OST302183 (lexicon) OST254305 (lexicon) OST236996 (lexicon) OST180421 (lexicon)
OST165169 (lexicon) OST147781 (lexicon) OST143934 (lexicon) OST136264 (lexicon)
OST125674 (lexicon) OST125587 (lexicon) OST117570 (lexicon) OST48476 (lexicon)
OST42853 (lexicon) OST24377 (lexicon) OST23236 (lexicon) OST16023 (lexicon)
OST15446 (lexicon) OST6616 (lexicon) OST5004 (lexicon) OST1636 (lexicon)
OST1150 (lexicon)
Severity of mutation (?) Insertion after 11% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16877
Vector Insertion
Chr 4: 131838961 - 131840958
Public Clones not available
Private Clones OST452931 (lexicon) OST231019 (lexicon) OST86727 (lexicon)
Severity of mutation (?) Insertion after 50% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26202
Vector Insertion
Chr 4: 131841037 - 131845229
Public Clones not available
Private Clones OST130895 (lexicon) OST37618 (lexicon) OST13699 (lexicon) OST5822 (lexicon)
Severity of mutation (?) Insertion after 63% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6175
Vector Insertion
Chr 4: 131845345 - 131847777
Public Clones (sanger) CSG221 (baygenomics) XH079 (baygenomics) CSG141 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 81% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4783
Vector Insertion
Chr 4: 131847867 - 131848541
Public Clones AW0174 (sanger) (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 95% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23170
Vector Insertion
Chr 4: 131848541 - 131848628
Public Clones not available
Private Clones OST274103 (lexicon)
Severity of mutation (?) Insertion after 95% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000105963
Sequence
GGACCGGCTGCTGAGACGAAAGCTTCACTGGGGCAGTCTCCGCATATCATGGGGAGATAGACGCTGCTGCCT - UNI10755 - GTAGCTTTTGAAAA

TGGCTGCCTCTCATTACAGTGGGCTTACAGCAGTTGCTGATGTAATTAAAGATCTAGACACTCAGATAGCA - UNI15891 - CTGATTGGCCTTGGT

CCTCACAGCTCTAAAAAGAAGCAGGATCTTGACAAGCTCTATGAGTTGAAGTCTAAAGCTCGGCAGATTATGAACCAGTTTGGCCCTTCAGCGCTAATCA

ACCTCTCCAGTTTCTCATCTGTAAAACCAGAGCCAGCTAGCACCCCGCCACAAGGCTCCATGGCCAATAGCACCACCGTGGGGAAGATAGCAGGCACTCC

TGGGACAGGTGGTCGTCTCAGCCCTGAAAACAACCAG - UNI16877 - GTATTGACCAAGAAGAAATTACAAGACCTAGTAAGAGAAGTAGATCCTA

ATGAGCAGCTGGATGAAGATGTGGAAGAG - UNI26202 - ATGCTGCTACAGATCGCTGATGATTTTATTGAGAGTGTGGTGACAGCTGCCTGCCAG

CTTGCTCGGCACCGCAAGTCCAGCACCCTAGAGGTAAAAGACGTCCAGCTGCATCTAG - UNI6175 - AGCGCCAGTGGAACATGTGGATCCCAGGC

TTTGGCTCTGAGGAAATCCGACCCTACAAAAAAGCATGTACCACAGAGGCTCACAAACAG - UNI4783 - - UNI23170 - AGAATGGCACTGAT

CCGGAAAACAACCAAGAAATAACACAGGGAACGGTCAGGGAATGGACAACGTGTATTTGGAGATACTTGAGC
Translation
 - UNI10755 - MAASHYSGLTAVADVIKDLDTQIA - UNI15891 - LIGLGPHSSKKKQDLDKLYELKSKARQIMNQFGPSALINLSSFSSVKP

EPASTPPQGSMANSTTVGKIAGTPGTGGRLSPENNQ - UNI16877 - VLTKKKLQDLVREVDPNEQLDEDVEE - UNI26202 - MLLQIADDFI

ESVVTAACQLARHRKSSTLEVKDVQLHLE - UNI6175 - ERQWNMWIPGFGSEEIRPYKKACTTEAHKQ - UNI4783 - - UNI23170 - RM

ALIRKTTKK
Transcript ENSMUST00000030731
Sequence
GTCGGACCGGCTGCTGAGACGAAAGCTTCACTGGGGCAGTCTCCGCATATCATGGGGAGATAGACGCTGCTGCCT - UNI10755 - - UNI15891 

- CTGATTGGCCTTGGTCCTCACAGCTCTAAAAAGAAGCAGGATCTTGACAAGCTCTATGAGTTGAAGTCTAAAGCTCGGCAGATTATGAACCAGTTTGG

CCCTTCAGCGCTAATCAACCTCTCCAGTTTCTCATCTGTAAAACCAGAGCCAGCTAGCACCCCGCCACAAGGCTCCATGGCCAATAGCACCACCGTGGGG

AAGATAGCAGGCACTCCTGGGACAGGTGGTCGTCTCAGCCCTGAAAACAACCAG - UNI16877 - GTATTGACCAAGAAGAAATTACAAGACCTAGT

AAGAGAAGTAGATCCTAATGAGCAGCTGGATGAAGATGTGGAAGAG - UNI26202 - ATGCTGCTACAGATCGCTGATGATTTTATTGAGAGTGTGG

TGACAGCTGCCTGCCAGCTTGCTCGGCACCGCAAGTCCAGCACCCTAGAGGTAAAAGACGTCCAGCTGCATCTAG - UNI6175 - AGCGCCAGTGGA

ACATGTGGATCCCAGGCTTTGGCTCTGAGGAAATCCGACCCTACAAAAAAGCATGTACCACAGAGGCTCACAAACAG - UNI4783 - - UNI23170

 - AGAATGGCACTGATCCGGAAAACAACCAAGAAATAACACAGGGAACGGTCAGGGAATGGACAACGTGTATTTGGAGATACTTGAGCTGAGACCTCAG

CCATCTCATCCTTGGATTTTTTTTTAAATGCTTTACAGAGAAGCATATATTTTTTATTAACAGTGCAGCAATATCTATAATGACTGAGAAGATCTGCCAA

AAGAATAAAGCCTCCTGCCCACCTTCTGGTCCCTTTTCCCTGCCGTCTCAAAGAGAAGCAGTGTATCTACCAGAGAAGATTTTGCCTGTGGTTTATTATA

GAAGTGATTGGCTGTAGGAAGAGCATTTTGGTCGTGTTGGGTGAGACAGTGTTAGCAAGTTTGTAGAGGGTCTGTCTCCTCCTCCCCCCGTCCCTGTACT

TTGTAATGTCAGTGTTTCTATGAATATGAACTTGATTTGCTTTTCCAGAATAAAGGAGTTATTAATTG
Translation
 - UNI10755 - - UNI15891 - MNQFGPSALINLSSFSSVKPEPASTPPQGSMANSTTVGKIAGTPGTGGRLSPENNQ - UNI16877 - VLT

KKKLQDLVREVDPNEQLDEDVEE - UNI26202 - MLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHLE - UNI6175 - ERQWNMWIPGF

GSEEIRPYKKACTTEAHKQ - UNI4783 - - UNI23170 - RMALIRKTTKK

For any suggestions or comments, please send an email to unitrap@crg.es