Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000028910 (Mecr)
Chromosomal location
Chr 4: 131399409 - 131423683 (+)
Description
mitochondrial trans-2-enoyl-CoA reductase Gene [Source:MGI (curated);Acc:Mecr-001]
RefSeq_dna
NM_025297 
RefSeq_peptide
NP_079573.1 
UniGene
Mm.192706 
MGI
MGI:1349441 
Uniprot/SWISSPROT
Q9DCS3 
Uniprot/SPTREMBL
A2A846 A2A845 
Human Ortholog
ENSG00000116353 (MECR)
Omim not available
UniTrap UNI27233
Vector Insertion
Chr 4: 131418832 - 131418907
Public Clones not available
Private Clones OST66153 (lexicon)
Severity of mutation (?) Insertion after 68% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000030742
Sequence
GGAAGCAGCATGTTGGTCAGCCAGCGAGTGACAGGGGCGCGAGCCCGGGCACCTCAGCTTGCGGGTCTCCTCGAGGCTTGGTACCGCCACGGCCGGACCA

CATCCTCCTACTCCGCTCTCTCTGAGCCGTCACGGGTGCGGGCGCTGGTCTATGGCAACCATGGGGATCCAGCCAAGGTCGTCCA GCTGAAGAACCTGG

AGCTCACTGCTGTGGAAGGATCTGACGTCCACGTGAGGATGCTGGCAGCCCCTATCAATCCATCTGACATAAATATGATCCAAG GGAACTATGGCCTCC

TTCCCAAGCTGCCTGCTGTTGGAGGGAACGAAGGCGTTGGGCAGGTGATAGCGGTGGGCAGCAGTGTGTCTGCATTGAAGCCAGGAGATTGGGTGATCCC

AGCAAATGCGGGTTTGG GAACCTGGCGGACTGAGGCGGTGTTCAGTGAGGAAGCACTGATTGGAATCCCTAAGGACATTCCTCTCCAGAGCGCTGCCAC

CCTAGGTGTCAACCCCTGCACAGCCTACAGGATGTTGGTGGACTTTGAACAGCTGCAGCCAG GGGACTCTGTCATCCAGAATGCATCCAACAGTGGAGT

GGGCCAAGCAGTCATTCAGATCGCCTCAGCCCTTCGCCTAAAGACCATCAACGTTGTCCGAGACAG ACCCGACATCAAGAAGCTAACTGACAGACTGAA

GGATCTAGGAGCTGATTATGTCCTCACAGAGGAAGAGCTAAGGATGCCCGAGACAAAAACCATCTTCAAG - UNI27233 - GACCTGCCGCTGCCCC

GATTGGCTCTCAACTGTGTTGGTGGGAAGAGTTCTACAGAGCTGCTCCGGCACCTAGC - UNI27233 - GCCCGGAGGAACCATGGTGACCTATGGG

GGAATGGCCAAACAGCCTGTAACAGCCTCTGTG AGTCTGCTCATTTTTAAGGACCTCAAACTTCGGGGCTTTTGGTTGTCCCAGTGGAAGAAGAACCAC

AGTCCAG ATGAGTTCAAGGAGCTGATTCTCACTCTCTGCAACCTCATCCGCCAAGGCCGGCTCACAGCCCCATCCTGTTCTGAGGTTCCACTGCAGGGC

TACCAGCAGGCTTTGGAAGCCTCCATGAAGCCTTTTGTGTCTTCGAAGCAGATTCTCACCATGTGATTGCTCCAGAGGACCAGGAGGAAAGCAGGAGAGG

CAAGACTGGCTGTCTGCTGGCCCCTCCATGAGAACCCCAGCCTTCCCAGACTGCCTCACCCATATTGTCTCTTCCTACCAGGAGGGTGGGGGACCAACTC

TAGGCTCCCTAATAAACCCTTAACTTCCCG
Translation
MLVSQRVTGARARAPQLAGLLEAWYRHGRTTSSYSALSEPSRVRALVYGNHGDPAKVVQ QLKNLELTAVEGSDVHVRMLAAPINPSDINMIQG GNYGL

LPKLPAVGGNEGVGQVIAVGSSVSALKPGDWVIPANAGLG GTWRTEAVFSEEALIGIPKDIPLQSAATLGVNPCTAYRMLVDFEQLQPG GDSVIQNAS

NSGVGQAVIQIASALRLKTINVVRDR RPDIKKLTDRLKDLGADYVLTEEELRMPETKTIFK - UNI27233 - DLPLPRLALNCVGGKSSTELLRHL

A - UNI27233 - APGGTMVTYGGMAKQPVTASV SLLIFKDLKLRGFWLSQWKKNHSPD DEFKELILTLCNLIRQGRLTAPSCSEVPLQGYQQALE

ASMKPFVSSKQILTM
Transcript ENSMUST00000105983
Sequence
GGAAGCAGCATGTTGGTCAGCCAGCGAGTGACAGGGGCGCGAGCCCGGGCACCTCAGCTTGCGGGTCTCCTCGAGGCTTGGTACCGCCACGGCCGGACCA

CATCCTCCTACTCCGCTCTCTCTGAGCCGTCACGGGTGCGGGCGCTGGTCTATGGCAACCATGGGGATCCAGCCAAGGTCGTCCA TGCTGGAGTTACAG

GAACTGGCCTAACTACCTGTGACATGAGTGCTGAGGACCGGAAGTCTGGTCCTTGTGTTCCACACAGAACTCTGAGAGCTGCTAGAAG GCTGAAGAACC

TGGAGCTCACTGCTGTGGAAGGATCTGACGTCCACGTGAGGATGCTGGCAGCCCCTATCAATCCATCTGACATAAATATGATCCAAG GGAACTATGGCC

TCCTTCCCAAGCTGCCTGCTGTTGGAGGGAACGAAGGCGTTGGGCAGGTGATAGCGGTGGGCAGCAGTGTGTCTGCATTGAAGCCAGGAGATTGGGTGAT

CCCAGCAAATGCGGGTTTGG GAACCTGGCGGACTGAGGCGGTGTTCAGTGAGGAAGCACTGATTGGAATCCCTAAGGACATTCCTCTCCAGAGCGCTGC

CACCCTAGGTGTCAACCCCTGCACAGCCTACAGGATGTTGGTGGACTTTGAACAGCTGCAGCCAG GGGACTCTGTCATCCAGAATGCATCCAACAGTGG

AGTGGGCCAAGCAGTCATTCAGATCGCCTCAGCCCTTCGCCTAAAGACCATCAACGTTGTCCGAGACAG ACCCGACATCAAGAAGCTAACTGACAGACT

GAAGGATCTAGGAGCTGATTATGTCCTCACAGAGGAAGAGCTAAGGATGCCCGAGACAAAAACCATCTTCAAG - UNI27233 - GACCTGCCGCTGC

CCCGATTGGCTCTCAACTGTGTTGGTGGGAAGAGTTCTACAGAGCTGCTCCGGCACCTAGC - UNI27233 - GCCCGGAGGAACCATGGTGACCTAT

GGGGGAATGGCCAAACAGCCTGTAACAGCCTCTGTG AGTCTGCTCATTTTTAAGGACCTCAAACTTCGGGGCTTTTGGTTGTCCCAGTGGAAGAAGAAC

CACAGTCCAG ATGAGTTCAAGGAGCTGATTCTCACTCTCTGCAACCTCATCCGCCAAGGCCGGCTCACAGCCCCATCCTGTTCTGAGGTTCCACTGCAG

GGCTACCAGCAGGCTTTGGAAGCCTCCATGAAGCCTTTTGTGTCTTCGAAGCAGATTCTCACCATGTGATTGCTCCAGAGGACCAGGAGGAAAGCAGGAG

AGGCAAGACTGGCTGTCTGCTGGCCCCTCCATGAGAACCCCAGCCTTCCCAGACTGCCTCACCCATATTGTCTCTTCCTACCAGGAGGGTGGGGGACCAA

CTCTAGGCTCCCTAATAAACCCTTAACTTCCCG
Translation
MLVSQRVTGARARAPQLAGLLEAWYRHGRTTSSYSALSEPSRVRALVYGNHGDPAKVVH HAGVTGTGLTTCDMSAEDRKSGPCVPHRTLRAARR RLKN

LELTAVEGSDVHVRMLAAPINPSDINMIQG GNYGLLPKLPAVGGNEGVGQVIAVGSSVSALKPGDWVIPANAGLG GTWRTEAVFSEEALIGIPKDIPL

QSAATLGVNPCTAYRMLVDFEQLQPG GDSVIQNASNSGVGQAVIQIASALRLKTINVVRD  - UNI27233 -  - UNI27233 -   

For any suggestions or comments, please send an email to unitrap@crg.es