Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000028953 (Abcf2)
Chromosomal location
Chr 5: 24071161 - 24083217 (-)
Description
ATP-binding cassette, sub-family F (GCN20), member 2 Gene [Source:MGI Symbol;Acc:MGI:1351657]
RefSeq_dna
NM_013853 
RefSeq_peptide
NP_038881.1 
UniGene
Mm.21629 
MGI
MGI:1351657 
Uniprot/SWISSPROT
Q99LE6 
Uniprot/SPTREMBL
Q3UVI9 
Human Ortholog
ENSG00000033050 (ABCF2)
Omim not available
UniTrap UNI22902
Vector Insertion
Chr 5: 24082546 - 24083164
Public Clones (sanger) D039H11 (ggtc)
Private Clones OST281648 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9296
Vector Insertion
Chr 5: 24080198 - 24082336
Public Clones XH063 (baygenomics) PST12133-NR (escells) PST11538-NR (escells) PST84-1 (escells)
PST0084-NR (escells)
Private Clones OST450236 (lexicon)
Severity of mutation (?) Insertion after 9% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7637
Vector Insertion
Chr 5: 24074134 - 24074384
Public Clones RRR650 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 66% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000030795
Sequence
GGAGGAGCTCAAGGAGCAGCTCTGTTGCGACAGAGGCCGAGCGGCGAGGCCCC - UNI22902 - ACTCCTGAAAGGACTGTAACTACCCCTGTGGCT

CATCACCATGCCTTCCGACCTGGCCAAGAAGAAGGCAGCCAAAAAGAAGGAGGCTGCCAAAGCCCGACAGCGACCCAGAAAGGGACATGAAGAAAATGGA

GATGCTGTCACAGAACCTCAGGTGGCAGAAGAGAAAATCGAGGAGGCCAATGGCAGAGAGACCACAGGAGATGGAG - UNI9296 - AAGTAGATTTG

CTGACCAAGGAGCTGGAGGACTTTGAGATGAAGAAAGCTGCTGCTCGAGCTGTCACCGGTGTCCTGGCTTCTCACCCCAACAGTACTGATGTCCACATTA

TCAACCTCTCCCTTACCTTTCATGGTCAAGAGCTGCTCAGCGACACCAAACTGGAATTAAACTCAGGCCGGCGCTATGGCCTCATTGGCTTAAATGGAAT

TG GAAAGTCCATGCTGCTCTCGGCTATTGGGAAACGTGAAGTGCCCATCCCAGAGCACATCGACATCTACCATCTGACTCGTGAGATGCCTCCTAGCGA

AAAAACACCCTTGCAGTGTGTGATGGAGGTGGACACAGAGCGGGCCATGCTGGAGAGAGAGGCTGAGCGGTTAGCACATGAGGATGCGGAGTGTGAAAAG

CTCATGGAGCTCTATGAACGGCTGGAAGAGCTGGATGCTGACAAAGCTGAGATGAGGGCCTCAAGGATCTTACATGGATTGGGCTTCACACCTGCTATGC

AGCGCAAGAAGCTGAAAGACTTCAGTGGTGGCTGGCGGATGAGAGTTGCTCTTGCTAG AGCCCTCTTTATTCGGCCCTTCATGCTGCTTCTGGACGAGC

CTACCAACCACCTGGACCTCGATGCTTGTGTGTGGCTGGAAGAGGAACTTAAGAC TTTCAAGCGCATCCTGGTCCTGGTGTCCCATTCCCAGGACTTCC

TGAATGGGGTCTGTACCAATATCATCCATATGCACAACAAGAAACTCAAGTATTACACG GGTAATTATGATCAGTATGTGAAGACACGGCTGGAGTTGG

AAGAGAACCAGATGAAGAGGTTTCACTGGGAGCAGGACCAGATCGCACACATGAAG AACTACATTGCCAGGTTTGGCCATGGCAGTGCCAAGCTGGCCC

GGCAGGCCCAAAGCAAAGAGAAAACACTACAGAAAATGATGGCATCCGGACTGACAGAAAGGGTTGTGAGTGACAAG ACGCTGTCATTTTATTTCCCAC

CGTGCGGTAAGATCCCACCACCTGTCATTATGGTGCAGAACGTGAGCTTCAAATATACGAAAGACGGG - UNI7637 - CCTTGCATCTACAATAATC

TAGAATTTGGTATTGATCTTGACACACGAGTGGCTCTGGTAGGACCCAATGGAGCAGGGAAGTCCACTCTGCTGAAGCTGCTAACCGGAGAG CTTCTGC

CTACAGATGGAATGATCCGGAAGCATTCTCATGTCAAGATAGGGCGTTACCATCAG CACTTACAGGAGCAGCTGGACCTTGACCTTTCACCATTGGAAT

ACATGATGAAGTGCTATCCAGAGATCAAGGAGAAGGAGGAGATGAGGAAGATCATTGGGAGATACGGCCTCACTGGGAAACAGCAG GTGAGCCCAATCC

GGAACCTGTCGGATGGGCAGAAGTGCCGAGTGTGCCTGGCCTGGCTGGCCTGGCAGAACCCTCACATGCTCTTTCTGGACGAGCCTACCAATCACCTGGA

CATCGAGACCATTGATGCTCTGGCAGATGCCATCAATGAGTTTGAGGGTGGAATGATGCTAGTCAGCCATGACTTCAGACTCATCCAGCAG GTTGCACA

GGAGATTTGGGTCTGTGAGAAACAGACAATCACCAAGTGGCCTGGAGACATCCTGGCCTACAAGGAGCACCTCAAGTCCAAGCTGGTAGATGAGGAGCCC

CAGCTCACCAAGAGGACCCACAATGTGTGAGCCCTCAGCCAGGCTTGGGTCAGGAATGCCACCTGGAGACTGCCAGCTGACACCTGACCAGCCACTCAGG

ACAGGACCCTGGGGCTGCACTCCTGCACTGCTGCAATACTGCCCTCAGCCTCTCCCCTCAGCCTGCCTTCGCTGCATCATATCTCCAGCTGGACAGCACC

TGTCCGTTTTCCCACCCTCCTTCCATTTGGGTCTGTCTGTCTGGACTCGGCTGGCTGTTCTCTCCAGACCCTTGCTGGTTACCTTGCCCTGAAAGATGCA

GCCAGGGGTACCTGGGTTAACCCAAGGGCCCAAGCCCTGGTCTGGCCCTGGAAGGATTCAAGAGCCTCATTTTATGGGTTTCGGTGATGTTGGAGAAATA

CTGCCAGCCCATCAACCCCGTTCCTTATTGCTTCTGGTTTGGAGCTCTGGGCCAGGGCCTAGTCCTGGTCAGTATTTTAATAATTATTTAACAGTGTAGA

TCTATGTGTCATCTACCAAGTGTCCAATAAAAGAGGAAGCTACAGACCCCCTC
Translation
 - UNI22902 - MPSDLAKKKAAKKKEAAKARQRPRKGHEENGDAVTEPQVAEEKIEEANGRETTGDGE - UNI9296 - EVDLLTKELEDFEMKK

AAARAVTGVLASHPNSTDVHIINLSLTFHGQELLSDTKLELNSGRRYGLIGLNGIG GKSMLLSAIGKREVPIPEHIDIYHLTREMPPSEKTPLQCVMEV

DTERAMLEREAERLAHEDAECEKLMELYERLEELDADKAEMRASRILHGLGFTPAMQRKKLKDFSGGWRMRVALAR RALFIRPFMLLLDEPTNHLDLDA

CVWLEEELKT TFKRILVLVSHSQDFLNGVCTNIIHMHNKKLKYYT GNYDQYVKTRLELEENQMKRFHWEQDQIAHMK NYIARFGHGSAKLARQAQSK

EKTLQKMMASGLTERVVSDK TLSFYFPPCGKIPPPVIMVQNVSFKYTKDG - UNI7637 - PCIYNNLEFGIDLDTRVALVGPNGAGKSTLLKLLTG

E LLPTDGMIRKHSHVKIGRYHQ HLQEQLDLDLSPLEYMMKCYPEIKEKEEMRKIIGRYGLTGKQQ VSPIRNLSDGQKCRVCLAWLAWQNPHMLFLDE

PTNHLDIETIDALADAINEFEGGMMLVSHDFRLIQQ VAQEIWVCEKQTITKWPGDILAYKEHLKSKLVDEEPQLTKRTHNV

For any suggestions or comments, please send an email to unitrap@crg.es