Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000028973 (Abcb8)
Chromosomal location
Chr 5: 23899494 - 23915872 (+)
Description
ATP-binding cassette, sub-family B (MDR/TAP), member 8 Gene [Source:MGI (curated);Acc:Abcb8-001]
RefSeq_dna
NM_029020 
RefSeq_peptide
NP_083296.2 
UniGene
Mm.283914 
MGI
MGI:1351667 
Uniprot/SPTREMBL
Q9JL40 Q8C695 Q8C7W4 Q9CXJ4 
Human Ortholog
ENSG00000197150 (ABCB8)
Omim not available
UniTrap UNI33273
Vector Insertion
Chr 5: 23899521 - 23899973
Public Clones IST11634B7 (tigm) IST13937B4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI862
Vector Insertion
Chr 5: 23900402 - 23905730
Public Clones CB0216 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33722
Vector Insertion
Chr 5: 23900402 - 23905730
Public Clones IST11826H5 (tigm) IST12234E10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000035362
Sequence
CAGACCTGGCTTCAATGTGCTCAAGGACTTCACCCTGAAGCTGCCCTCTGG AAGATTGTGGCTCTTGTGGGCCAGTCTGGGGGAG GAAAGACCACAGT

TGCCTCCTTGCTGGAACGCTTCTATGACCCTGAAGCTGGCTCGGTGACGTTGGATGGGCATGACCTGCGAACTCTCAACCCCTCCTGGCTCCGGGGCCAG

GTCATAGGTTTCATCAGCCAG GAGCCAGTCCTGTTTGCAACAACCATCATGGAGAATATCCGATTTGGGAAGCTGGATGCTTCCGATGAAGAGGTGTAC

ACAGCTGCACGAGAAGCCAATGCCCACGAGTTCATCAGCAGCTTCCCCGATGGCTACAGCACTGTGGTTG GCTGGGACCCACGAAGAACTCCTTAA
Translation
QTWLQCAQGLHPEAALW KIVALVGQSGGG GKTTVASLLERFYDPEAGSVTLDGHDLRTLNPSWLRGQVIGFISQ EPVLFATTIMENIRFGKLDASDE

EVYTAAREANAHEFISSFPDGYSTVVG GWDPRRTP
Transcript ENSMUST00000115074
Sequence
GGTTGTCGGGATGGGGCCATAGCGAACATGGAACCCTCGGTAGGATAAGTGTGAGATTGCCGTTGCTGGCTGCCCCTATCTTATTGCCTCAACATGTTGG

TGCACTTATTTCGGTTCGGAATCCGGGGTGGCCCAGTTCCAGGATGGTCGCTACAATCCCTGCGCTTCCAGACGTTCTCTGCCGCCAG - UNI862 - 

- UNI33722 - GTCCTCAGATGACCGGCTCAGCTCACACCTCCTGCGGACTGTAGCCCAGCTCCGTGTACAGCTCCGGGCTCACCTCCCTCGAGCCCC

ACCAGCTTCCCACTGGAGCCCCTCTGCCTGGTGTTGGGTTGGGGGGACCTTGGTGGTCCCTGCAGTCCTGTGGCAGCATCCACGCCTCTGCCTTATAGCA

CTATGTGAGGCCAAAGAGTCCCCTCCTGCCCAGCCCACACGTGCCCCAGAGCTGCGCTTTAATTGGAAGCTCTTCTGGCATTTCCTTCACCCCCACCTGC

TGGCCTTGGGGGCAGCCATTGTG CTGGCCTTAGGTGCGGCACTAGTGAATGTGCAGATCCCCTTGCTCCTGGGCCAGCTGGTGGAGATTGTCGCCAAGT

ACACGAGGGACCACATGGGGAGTTTCGTGTCTGAGTCCCGTAAGCTCAGCGTCCAGCTGCTCCTACTGTACGGTGTTCAG GGACTGCTGACCTTTGGAT

ACCTAGTGCTGCTGTCCCACATTGGTGAGCGCATGGCCATGGACATGCGGAAAGCCCTTTTCAGCTCCCTGCTCCG GCAAGACATTGCTTTCTTTGATG

CCAAAAAGACAGGGCAGCTAGTGAGTCGCTTGACTACTGATGTGCAAGAATTCAAGTCATCCTTCAAGCTTGTCATCTCCCAG GGACTGCGCAGCTGCA

CCCAGGTGATTGGTAGCCTGGTGTCCCTGTCTATGCTGTCCCCTCGCCTTACCCTGATGCTGGCTGTCGTCACACCCGCCCTCATGGGAGTGGGCACCCT

GATGGGCTCAGGCCTCCGAAAGCTGTCTCGCCAGTGTCAGGAGCAG ATTGCCAGGGCAACAGGTGTAGCAGATGAGGCCCTTGGCAATGTTCGGACTGT

GCGGGCCTTCGCGATGGAGAAGAGGGAGGAGGA ACGCTATCAAGCAGAACTGGAGTCATGCTGCTGTAAAGCAGAAGAACTGGGCAGGGGCATCGCCTT

GTTCCAAGGGCTCTCCAACATCGCTTTCAACT GTATGGTCTTGGGCACCCTGTTCATTGGGGGCTCCCTTGTGGCTGGACAGCAGCTGAAAGGGGGAGA

CCTCATGTCCTTCCTGGTGGCTTCCCAGACAGTACAGAG GCTTTTTCAGGGCTGCCCTGGCCTCAGAGCTTTCCAAGGATGAGATGAAGAGCACTGCCC

CCCGATGCTGCTTGTGTGACTTTCCTCTCCCTGTCTAGCTGAGCCCCATCTACCCCATGCAGCAACCTGGAGCTCATCTGTCACCTTGGCCATAAGGCAG

CCTCAGTGGGCTGTCTCAGCGGGCTGCCCCGGCAGGCCTCAGTGAAACCCAAGCACTTCCTACTGTTGTTTCTACCTTGCTTTCCCTAGACATAGCAAAC

TTAAAAAAAAAAAAAAAACATAAATATATGTTATGATAAACAACTAAAGAGTGAATATGCTATAATAAATAAAGGGCAAAGACTTATTAG
Translation
MLVHLFRFGIRGGPVPGWSLQSLRFQTFSAAR - UNI862 - - UNI33722 - RSSDDRLSSHLLRTVAQLRVQLRAHLPRAPPASHWSPSAWCWV

GGTLVVPAVLWQHPRLCLIALCEAKESPPAQPTRAPELRFNWKLFWHFLHPHLLALGAAIV LALGAALVNVQIPLLLGQLVEIVAKYTRDHMGSFVSES

RKLSVQLLLLYGVQ GLLTFGYLVLLSHIGERMAMDMRKALFSSLLR RQDIAFFDAKKTGQLVSRLTTDVQEFKSSFKLVISQ GLRSCTQVIGSLVSL

SMLSPRLTLMLAVVTPALMGVGTLMGSGLRKLSRQCQEQ IARATGVADEALGNVRTVRAFAMEKREEE ERYQAELESCCCKAEELGRGIALFQGLSNI

AFNC CMVLGTLFIGGSLVAGQQLKGGDLMSFLVASQTVQR RLFQGCPGLRAFQG
Transcript ENSMUST00000115077
Sequence
TAATCCCAACACTGGGAAGGAAGGATG - UNI33273 - GGAGCATAGAGATTGTCTGGAACAACTCTAGAGAAAGGGCTCAAGGTCAGAAGCGCCAG

GACGTCCTCTAATGTGAGAATGAACGTCGCACAACCTCTGACCCGCACCTGACTTCAGGCCACTGAGCAAATAGCTAGAGCTGCTTCTGCTCGGTCCCGC

CTACAGCCAACATTTTATCCAATCACAGCTTGCAGCAAGACTGATGTGTCTTTTCTCCAATCATCGCTGAGAATGGGAAGGGGTTGTCGGGATGGGGCCA

TAGCGAACATGGAACCCTCGGTAGGATAAGTGTGAGATTGCCGTTGCTGGCTGCCCCTATCTTATTGCCTCAACATGTTGGTGCACTTATTTCGGTTCGG

AATCCGGGGTGGCCCAGTTCCAGGATGGTCGCTACAATCCCTGCGCTTCCAGACGTTCTCTGCCGCCAG - UNI862 - - UNI33722 - GTCCTC

AGATGACCGGCTCAGCTCACACCTCCTGCGGACTGTAGCCCAGCTCCGTGTACAGCTCCGGGCTCACCTCCCTCGAGCCCCACCAGCTTCCCACTGGAGC

CCCTCTGCCTGGTGTTGGGTTGGGGGGACCTTGGTGGTCCCTGCAGTCCTGTGGCAGCATCCACGCCTCTGCCTTATAGCACTATGTGAGGCCAAAGAGT

CCCCTCCTGCCCAGCCCACACGTGCCCCAGAGCTGCGCTTTAATTGGAAGCTCTTCTGGCATTTCCTTCACCCCCACCTGCTGGCCTTGGGGGCAGCCAT

TGTG CTGGCCTTAGGTGCGGCACTAGTGAATGTGCAGATCCCCTTGCTCCTGGGCCAGCTGGTGGAGATTGTCGCCAAGTACACGAGGGACCACATGGG

GAGTTTCGTGTCTGAGTCCCGTAAGCTCAGCGTCCAGCTGCTCCTACTGTACGGTGTTCAG GGACTGCTGACCTTTGGATACCTAGTGCTGCTGTCCCA

CATTGGTGAGCGCATGGCCATGGACATGCGGAAAGCCCTTTTCAGCTCCCTGCTCCG GCAAGACATTGCTTTCTTTGATGCCAAAAAGACAGGGCAGCT

AGTGAGTCGCTTGACTACTGATGTGCAAGAATTCAAGTCATCCTTCAAGCTTGTCATCTCCCAG GGACTGCGCAGCTGCACCCAGGTGATTGGTAGCCT

GGTGTCCCTGTCTATGCTGTCCCCTCGCCTTACCCTGATGCTGGCTGTCGTCACACCCGCCCTCATGGGAGTGGGCACCCTGATGGGCTCAGGCCTCCGA

AAGCTGTCTCGCCAGTGTCAGGAGCAG ATTGCCAGGGCAACAGGTGTAGCAGATGAGGCCCTTGGCAATGTTCGGACTGTGCGGGCCTTCGCGATGGAG

AAGAGGGAGGAGGA ACGCTATCAAGCAGAACTGGAGTCATGCTGCTGTAAAGCAGAAGAACTGGGCAGGGGCATCGCCTTGTTCCAAGGGCTCTCCAAC

ATCGCTTTCAACT GTATGGTCTTGGGCACCCTGTTCATTGGGGGCTCCCTTGTGGCTGGACAGCAGCTGAAAGGGGGAGACCTCATGTCCTTCCTGGTG

GCTTCCCAGACAGTACAGAG GTCTATGGCCAGCCTCTCTGTCCTGTTTGGTCAG GTGGTACGTGGGCTGAGTGCGGGAGCCCGAGTCTTCGAATACAT

GGCCCTGAGCCCTGTCATCCCATTGACCGGGGGCTACTGCATCCCCAACAAGGACATTCGTGGTTCCATCACCTTCCAAAATGTCACCTTCAG CTACCC

CTGCAGACCTGGCTTCAATGTGCTCAAGGACTTCACCCTGAAGCTGCCCTCTGGCAAGATTGTGGCTCTTGTGGGCCAGTCTGGGGGAG GAAAGACCAC

AGTTGCCTCCTTGCTGGAACGCTTCTATGACCCTGAAGCTGGCTCGGTGACGTTGGATGGGCATGACCTGCGAACTCTCAACCCCTCCTGGCTCCGGGGC

CAGGTCATAGGTTTCATCAGCCAG GAGCCAGTCCTGTTTGCAACAACCATCATGGAGAATATCCGATTTGGGAAGCTGGATGCTTCCGATGAAGAGGTG

TACACAGCTGCACGAGAAGCCAATGCCCACGAGTTCATCAGCAGCTTCCCCGATGGCTACAGCACTGTGGTTG GTGAGCGGGGCACAACCTTGTCTGGT

GGCCAGAAGCAGCGCCTAGCCATCGCACGTGCCCTCATCAAGCAGCCCACAGTGCTGATCCTGGACGAGGCCACCAGTGCGCTAGATGCAGAATCCGAGA

GGGTGGTACAGGAGGCCCTGGACCGGGCCAGTGCTGGCCGCACCGTGTTGGTCATTGCCCACCGGCTTAGTACTGTCCGTGCAGCCCACTCCATCATTGT

CATGGCCAATGGCCAAGTCTGTGAG GCTGGGACCCACGAAGAACTCCTTAAAAAAGGCGGGCTCTATTCAGAGCTTATCCGGAGACAAACCCTGGACGC

CTCACTGACCTCAACCCCTCCTGCAGAGAAGCCTGAAGACCCCAAAAGCTGCCAGTCCAAAGCCTGAGAGGCCCCCTGGGGTCAGGTCACTGCAAGACAT

CAGTCTGAGGCTGGAGCTCTGCTGGGGACAGAGCCCTTGGAAGGCCAGTGTGCTGGAGTGTGGCCTGCACTACTGCCCCCTTAAAGGAGCTGGGCTCAAC

AGCTGGGGTGGGAAATGGCTCTCCGCCCACCTGCTCTGACCATCCTGACTCAGCTCTGTGGTCACGGGATGTACACAGTGAGACAGAGTCCCTGGACACC

TCTGCTTGACCCTCTCAGGCTGGCCTGGTTCTGCCCAACACTCAGTTGTTTGGGCCCTCACTCCAGGAGACTGGCCAGGCCTGGTAGAATGGGTTGTAAT

CCCAGCACTTGGGAGACAGAAGTGGGAGGGTCAAGAGTTCAAGGCCATCCTGGGCTAAATAGTGAGACCCTCTCTCAACAAAAAGAAAAACCTAAATAAA

GAGGAAAAATTTTCAAAGAGGCCGAGGCTGTAGCTTAGTAGCAGAGTGCGTGCCTGCCCTATGTGAGGGGCCTAGACATAATCCTTAGTACTGCAAATAA

GAAATAAAACCCAGGGTTGGAGTGTAA
Translation
 - UNI33273 - MLVHLFRFGIRGGPVPGWSLQSLRFQTFSAAR - UNI862 - - UNI33722 - RSSDDRLSSHLLRTVAQLRVQLRAHLPRA

PPASHWSPSAWCWVGGTLVVPAVLWQHPRLCLIALCEAKESPPAQPTRAPELRFNWKLFWHFLHPHLLALGAAIV LALGAALVNVQIPLLLGQLVEIVA

KYTRDHMGSFVSESRKLSVQLLLLYGVQ GLLTFGYLVLLSHIGERMAMDMRKALFSSLLR RQDIAFFDAKKTGQLVSRLTTDVQEFKSSFKLVISQ G

LRSCTQVIGSLVSLSMLSPRLTLMLAVVTPALMGVGTLMGSGLRKLSRQCQEQ IARATGVADEALGNVRTVRAFAMEKREEE ERYQAELESCCCKAEE

LGRGIALFQGLSNIAFNC CMVLGTLFIGGSLVAGQQLKGGDLMSFLVASQTVQR RSMASLSVLFGQ VVRGLSAGARVFEYMALSPVIPLTGGYCIPN

KDIRGSITFQNVTFS SYPCRPGFNVLKDFTLKLPSGKIVALVGQSGGG GKTTVASLLERFYDPEAGSVTLDGHDLRTLNPSWLRGQVIGFISQ EPVL

FATTIMENIRFGKLDASDEEVYTAAREANAHEFISSFPDGYSTVVG GERGTTLSGGQKQRLAIARALIKQPTVLILDEATSALDAESERVVQEALDRAS

AGRTVLVIAHRLSTVRAAHSIIVMANGQVCE AGTHEELLKKGGLYSELIRRQTLDASLTSTPPAEKPEDPKSCQSKA
Transcript ENSMUST00000073076
Sequence
GGGAGCATAGAGATTGTCTGGAACAACTCTAGAGAAAGGGCTCAAGGTCAGAAGCGCCAGGACGTCCTCTAATGTGAGAATGAACGTCGCACAACCTCTG

ACCCGCACCTGACTTCAGGCCACTGAGCAAATAGCTAGAGCTGCTTCTGCTCGGTCCCGCCTACAGCCAACATTTTATCCAATCACAGCTTGCAGCAAGA

CTGATGTGTCTTTTCTCCAATCATCGCTGAGAATGGGAAGGGGTTGTCGGGATGGGGCCATAGCGAACATGGAACCCTCGGTAGGATAAGTGTGAGATTG

CCGTTGCTGGCTGCCCCTATCTTATTGCCTCAACATGTTGGTGCACTTATTTCGGTTCGGAATCCGGGGTGGCCCAGTTCCAGGATGGTCGCTACAATCC

CTGCGCTTCCAGACGTTCTCTGCCGCCAG - UNI862 - - UNI33722 - GTCCTCAGATGACCGGCTCAGCTCACACCTCCTGCGGACTGTAGCC

CAGCTCCGTGTACAGCTCCGGGCTCACCTCCCTCGAGCCCCACCAGCTTCCCACTGGAGCCCCTCTGCCTGGTGTTGGGTTGGGGGGACCTTGGTGGTCC

CTGCAGTCCTGTGGCAGCATCCACGCCTCTGCCTTATAGCACTATGTGAGGCCAAAGAGTCCCCTCCTGCCCAGCCCACACGTGCCCCAGAGCTGCGCTT

TAATTGGAAGCTCTTCTGGCATTTCCTTCACCCCCACCTGCTGGCCTTGGGGGCAGCCATTGTG CTGGCCTTAGGTGCGGCACTAGTGAATGTGCAGAT

CCCCTTGCTCCTGGGCCAGCTGGTGGAGATTGTCGCCAAGTACACGAGGGACCACATGGGGAGTTTCGTGTCTGAGTCCCGTAAGCTCAGCGTCCAGCTG

CTCCTACTGTACGGTGTTCAG GGACTGCTGACCTTTGGATACCTAGTGCTGCTGTCCCACATTGGTGAGCGCATGGCCATGGACATGCGGAAAGCCCTT

TTCAGCTCCCTGCTCCG GCAAGACATTGCTTTCTTTGATGCCAAAAAGACAGGGCAGCTAGTGAGTCGCTTGACTACTGATGTGCAAGAATTCAAGTCA

TCCTTCAAGCTTGTCATCTCCCAG GGACTGCGCAGCTGCACCCAGGTGATTGGTAGCCTGGTGTCCCTGTCTATGCTGTCCCCTCGCCTTACCCTGATG

CTGGCTGTCGTCACACCCGCCCTCATGGGAGTGGGCACCCTGATGGGCTCAGGCCTCCGAAAGCTGTCTCGCCAGTGTCAGGAGCAG ATTGCCAGGGCA

ACAGGTGTAGCAGATGAGGCCCTTGGCAATGTTCGGACTGTGCGGGCCTTCGCGATGGAGAAGAGGGAGGAGGA ACGCTATCAAGCAGAACTGGAGTCA

TGCTGCTGTAAAGCAGAAGAACTGGGCAGGGGCATCGCCTTGTTCCAAGGGCTCTCCAACATCGCTTTCAACT GTATGGTCTTGGGCACCCTGTTCATT

GGGGGCTCCCTTGTGGCTGGACAGCAGCTGAAAGGGGGAGACCTCATGTCCTTCCTGGTGGCTTCCCAGACAGTACAGAG GTCTATGGCCAGCCTCTCT

GTCCTGTTTGGTCAG GTGGTACGTGGGCTGAGTGCGGGAGCCCGAGTCTTCGAATACATGGCCCTGAGCCCTGTCATCCCATTGACCGGGGGCTACTGC

ATCCCCAACAAGGACATTCGTGGTTCCATCACCTTCCAAAATGTCACCTTCAG CTACCCCTGCAGACCTGGCTTCAATGTGCTCAAGGACTTCACCCTG

AAGCTGCCCTCTGGCAAGATTGTGGCTCTTGTGGGCCAGTCTGGGGGAG GAAAGACCACAGTTGCCTCCTTGCTGGAACGCTTCTATGACCCTGAAGCT

GGCTCGGTGACGTTGGATGGGCATGACCTGCGAACTCTCAACCCCTCCTGGCTCCGGGGCCAGGTCATAGGTTTCATCAGCCAG GAGCCAGTCCTGTTT

GCAACAACCATCATGGAGAATATCCGATTTGGGAAGCTGGATGCTTCCGATGAAGAGGTGTACACAGCTGCACGAGAAGCCAATGCCCACGAGTTCATCA

GCAGCTTCCCCGATGGCTACAGCACTGTGGTTG GTGAGCGGGGCACAACCTTGTCTGGTGGCCAGAAGCAGCGCCTAGCCATCGCACGTGCCCTCATCA

AGCAGCCCACAGTGCTGATCCTGGACGAGGCCACCAGTGCGCTAGATGCAGAATCCGAGAGGGTGGTACAGGAGGCCCTGGACCGGGCCAGTGCTGGCCG

CACCGTGTTGGTCATTGCCCACCGGCTTAGTACTGTCCGTGCAGCCCACTCCATCATTGTCATGGCCAATGGCCAAGTCTGTGAG GCTGGGACCCACGA

AGAACTCCTTAAAAAAGGCGGGCTCTATTCAGAGCTTATCCGGAGACAAACCCTGGACGCCTCACTGACCTCAACCCCTCCTGCAGAGAAGCCTGAAGAC

CCCAAAAGCTGCCAGTCCAAAGCCTGAGAGGCCCCCTGGGGTCAGGTCACTGCAAGACATCAGTCTGAGGCTGGAGCTCTGCTGGGGACAGAGCCCTTGG

AAGGCCAGTGTGCTGGAGTGTGGCCTGCACTACTGCCCCCTTAAAGGAGCTGGGCTCAACAGCTGGGGTGGGAAATGGCTCTCCGCCCACCTGCTCTGAC

CATCCTGACTCAGCTCTGTGGTCACGGGATGTACACAGTGAGACAGAGTCCCTGGACACCTCTGCTTGACCCTCTCAGGCTGGCCTGGTTCTGCCCAACA

CTCAGTTGTTTGGGCCCTCACTCCAGGAGACTGGCCAGGCCTGGTAGAATGGGTTGTAATCCCAGCACTTGGGAGACAGAAGTGGGAGGGTCAAGAGTTC

AAGGCCATCCTGGGCTAAATAGTGAGACCCTCTCTCAACAAAAAGAAAAACCTAAATAAAGAGGAAAAATTTTCAAAG
Translation
MLVHLFRFGIRGGPVPGWSLQSLRFQTFSAAR - UNI862 - - UNI33722 - RSSDDRLSSHLLRTVAQLRVQLRAHLPRAPPASHWSPSAWCWV

GGTLVVPAVLWQHPRLCLIALCEAKESPPAQPTRAPELRFNWKLFWHFLHPHLLALGAAIV LALGAALVNVQIPLLLGQLVEIVAKYTRDHMGSFVSES

RKLSVQLLLLYGVQ GLLTFGYLVLLSHIGERMAMDMRKALFSSLLR RQDIAFFDAKKTGQLVSRLTTDVQEFKSSFKLVISQ GLRSCTQVIGSLVSL

SMLSPRLTLMLAVVTPALMGVGTLMGSGLRKLSRQCQEQ IARATGVADEALGNVRTVRAFAMEKREEE ERYQAELESCCCKAEELGRGIALFQGLSNI

AFNC CMVLGTLFIGGSLVAGQQLKGGDLMSFLVASQTVQR RSMASLSVLFGQ VVRGLSAGARVFEYMALSPVIPLTGGYCIPNKDIRGSITFQNVTF

S SYPCRPGFNVLKDFTLKLPSGKIVALVGQSGGG GKTTVASLLERFYDPEAGSVTLDGHDLRTLNPSWLRGQVIGFISQ EPVLFATTIMENIRFGKL

DASDEEVYTAAREANAHEFISSFPDGYSTVVG GERGTTLSGGQKQRLAIARALIKQPTVLILDEATSALDAESERVVQEALDRASAGRTVLVIAHRLST

VRAAHSIIVMANGQVCE AGTHEELLKKGGLYSELIRRQTLDASLTSTPPAEKPEDPKSCQSKA

For any suggestions or comments, please send an email to unitrap@crg.es