Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000028977 (Casz1)
Chromosomal location
Chr 4: 148178501 - 148328998 (+)
Description
castor homolog 1, zinc finger (Drosophila) Gene [Source:MGI (curated);Acc:Casz1-004]
RefSeq_dna
NM_027195 
RefSeq_peptide
NP_081471.2 
UniGene
Mm.393949 Mm.436388 Mm.233879 
MGI
MGI:1196251 
Uniprot/SWISSPROT
Q9CWL2 
Uniprot/SPTREMBL
B1AS46 B1AS47 B2KFS8 B2KFT0 Q8BWG3 Q8CI82 B2KFS9 
Human Ortholog
ENSG00000130940 (CASZ1)
Omim not available
UniTrap UNI17447
Vector Insertion
Chr 4: 148178624 - 148212374
Public Clones (ggtc) IST14316H7 (tigm) IST14977C9 (tigm) IST12309H6 (tigm) IST14666H2 (tigm)
IST14662F1 (tigm) IST14241D1 (tigm) IST10452B6 (tigm) IST14138C10 (tigm)
IST14517D10 (tigm) IST14405A4 (tigm) IST13439B6 (tigm) IST14580B6 (tigm)
Private Clones OST442775 (lexicon) OST379311 (lexicon) OST345600 (lexicon) OST292131 (lexicon)
OST214875 (lexicon) OST207288 (lexicon) OST201961 (lexicon) OST182564 (lexicon)
OST179214 (lexicon) OST168480 (lexicon) OST153043 (lexicon) OST143905 (lexicon)
OST109421 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20147
Vector Insertion
Chr 4: 148212530 - 148264430
Public Clones (sanger) D060C05 (ggtc) D157D05 (ggtc) D111G08 (ggtc) 5SE307F02 (ggtc)
D113D08 (ggtc) D089C01 (ggtc) IST14398A10 (tigm) IST14826E5 (tigm)
IST14767C6 (tigm) IST13376F8 (tigm) IST11537H12 (tigm) IST13099A12 (tigm)
IST10692D8 (tigm) IST14778C3 (tigm) IST13525E8 (tigm) IST11791A10 (tigm)
IST12001A7 (tigm) IST12138C7 (tigm) IST10148F7 (tigm) IST14966H6 (tigm)
IST13131F3 (tigm) IST11654A7 (tigm) IST14042G1 (tigm) IST14601G3 (tigm)
IST14560B4 (tigm) IST12307D11 (tigm) IST14200A3 (tigm) IST12511A8 (tigm)
IST10194D4 (tigm) IST11747H7 (tigm) IST10673D9 (tigm) IST12849G4 (tigm)
IST12138F6 (tigm) IST12923A9 (tigm) IST11261B5 (tigm) IST12412E9 (tigm)
IST13276G10 (tigm) IST12068C2 (tigm) IST14645E12 (tigm) IST10046E7 (tigm)
IST14267G1 (tigm) IST14828G11 (tigm) IST14926F5 (tigm) IST14346D12 (tigm)
IST14473H11 (tigm) IST11065C2 (tigm) IST14901E5 (tigm) IST11105F11 (tigm)
IST14509E5 (tigm) IST14560B2 (tigm) IST12693A10 (tigm) IST14553H9 (tigm)
IST12566E8 (tigm) IST12820C10 (tigm) IST13958C5 (tigm)
Private Clones OST371400 (lexicon) OST232265 (lexicon) OST185995 (lexicon) OST179542 (lexicon)
OST67649 (lexicon) OST67647 (lexicon) OST46639 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31806
Vector Insertion
Chr 4: 148264486 - 148275813
Public Clones IST10414E10 (tigm) IST14457D12 (tigm) IST12024A9 (tigm) IST10788E8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29935
Vector Insertion
Chr 4: 148275853 - 148302607
Public Clones (sanger) D188B08 (ggtc) D101D10 (ggtc) IST14976G2 (tigm) IST10827F6 (tigm)
IST11595B7 (tigm) IST10163A8 (tigm) IST12753F5 (tigm) IST11633G4 (tigm)
IST11491E3 (tigm) IST11335B1 (tigm) IST14615E4 (tigm) IST14854G8 (tigm)
IST10912C9 (tigm) IST11792C7 (tigm) IST15037G10 (tigm) IST14841B10 (tigm)
IST12667G12 (tigm) IST13108C1 (tigm) IST13768H7 (tigm) IST11038H11 (tigm)
IST14590A9 (tigm) IST14904C8 (tigm) IST10241A5 (tigm) IST10038C1 (tigm)
IST12668G11 (tigm) IST12417D1 (tigm) IST11028C11 (tigm) IST12335H9 (tigm)
IST12271C9 (tigm) IST13447E9 (tigm) IST13247F2 (tigm) IST10401G9 (tigm)
IST12893E9 (tigm) IST11859E4 (tigm) IST10153H11 (tigm) IST11958E1 (tigm)
IST10091E9 (tigm) IST10131H9 (tigm) IST13333B4 (tigm) IST10794H2 (tigm)
IST14609B8 (tigm) IST12832E4 (tigm) IST12368G12 (tigm) IST13042F4 (tigm)
IST12596G10 (tigm) IST10323C8 (tigm) IST11716H4 (tigm) IST14711D9 (tigm)
IST10787B11 (tigm) IST10038C1BBR1 (tigm) IST12827F12 (tigm) IST12288C3 (tigm)
IST12907H4 (tigm) IST10047C4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6535
Vector Insertion
Chr 4: 148303105 - 148303592
Public Clones CSE044 (baygenomics)
Private Clones OST446613 (lexicon) OST287492 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36095
Vector Insertion
Chr 4: 148303592 - 148306866
Public Clones IST14955E10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 10% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1351
Vector Insertion
Chr 4: 148311067 - 148311233
Public Clones CJ0565 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 28% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000122222
Sequence
GCATGCGCGCCCGCGGCGCTCCATCCCAAACACACACACATTTTTCCCCGGACTTGGAAAGTCACCCAAAGCCGCCCCAAGTGCAG - UNI17447 - 

GCACACAGACCTTGCTGACGGAAGGCAGACCCTCTCCATCTCACCTGCCCTCCAACTGCCTGAGCTACCCACTCCTCCTTCTCCGGGGGACCCTGCAGCT

CCCCGGTGGTGTGCATTGGAATGGACTTCGGACCTTGGACTCTTGGGATGCAAAG - UNI20147 - GATGAAGTGACCCCCACCCCCAACTGTGTTT

GAGGAATCTCTAGGACCCCGTGAG - UNI31806 - AGTTTGGGACCAAGGAGCGGAGAATGGATCTTGGAACAG - UNI6535 - - UNI29935

 - CTGAAAGCACCCGGTGCACCGACCCACCTGCAGGCAAGCCTCCAATGGCAGCCAAGCGCAAAGGCGGCCTGAAGCTCAACGCCATCTGTGCCAAGCT

CAGCCGACAGGTGGTCGTGGAGAAGGGAGCAGAGGCCGGCTCCCAAGCCGAAGGTAGCCCACTACATCCCCGGGACAAAGAGCGCAGTGGCCCTGAGTCT

GGGGTGAGCCGGGCTCCCCGAAGTGAAGAAGACAAGAGGCGGGCAGTGATCGAGAAATGGGTCAATGGAGAGTACTGTGAGGATCCCGCACCCACCCCAG

TGTTGGGGCGTATTGCCCGTGATCAGGAGCTGCCCCCAGAGGGTGTCTACATGGTCCAGCCACAGGGCTGCAGTGACGAAGAAGACCATGCAGAAGAGCC

CTCAAAAGATAACAGTGTCCTGGAGGAGAAGGAGTCAGATGGTACGGCTTCTAAAGATGACAGCGGCCCCAGCACCAGGCAGGCTTCAG - UNI6535 

- - UNI36095 - GAGAAACCTCCTCTCTGAGGGACTACGCTGCTTCCACCATGACCGAGTTCCTCGGCATGTTTGGCTACGATGACCAGAACACCAG

GGATGAGCTGGCCAAGAAGATCAGCTTTGAGAAGCCGCATGCAGGCTCCACCCCCGAGGTGGCTGCCTCTTCCATGTTGCCCTCCTCTGAGGATACCCTC

AGCAAGCGGGCGCGCTTCTCCAAATACGAGGAATACATCCGTAAGCTCAAGGCCGGCGAGCAACTTCCCTGGCCAGCCCACGGGAGCAAAGCCGAGGACC

GGGCAGGCAAGGAGGTGGTGGGTCCCTTACCCAGCCTACGGCTGCCCAGCAACACGGCCCACCTGGAAACCAAGGCCACCATCCTGCCACTGCCATCACA

CAGCAGTGTCCAGATGCAGAATCTGGTAGCTCGTGCTTCCAAGTATGACTTCTTCATCCACAAACTGAAGACAGGCGAGAACCTGAGGCCCCAGAATGGA

AGCACTTACAAGAAGCCATCCAAGTATGACCTGGAGAATGTCAAGTACTTGCACCTCTTCAAACCCGGGGAAGGCAGCCCTGACATGGGCGGGGCCATCG

CCTTCAAGACAGGCAAGGTGGGGCGCCCCTCTAAGTACGACGTTCGGGGCATCCAGAAGCCAGGCCCTACCAAGATTCCGCCCGCCCCCAGCCTGGTTCC

TACACCCCTCACCAATGTGCCCAGTGCTCCCAGCACCCCCGGACCAGGACCGGAGCCACCTGCCTCCTTGTCCTTCAACACTCCCGAGTACCTGAAGTCA

ACCTTTTCCAAAACAGACTCCATCACCACAGGAACTGTCTCCACTGTCAA GAACGGATTGCCCACAGATAAACCAGCTGTCACCGAAGATGTAAACATT

TACCAGAAATATATTGCCAG GTTCTCAGGAAGTCAGCACTGCGGTCACATCCACTGCGCCTACCAGTACCGTGAGCACTATCACTGCCTGGACCCGGAG

TGCAACTACCAG - UNI1351 - CGGTTCACAAGCAAGCAGGATGTGATCCGACATTACAACATGCACAAGAAGCGCGACAACTCCCTGCAGCACGGC

TTCATGCGCTTCAGCCCGCTGGACGACTGCAGTGTCTACTACCACGGCTGCCACCTCAATGGGAAGAGCACCCACTACCACTGCATGCAG - UNI1351

 - GTGGGATGTAACAAGGTATACACAAGTACGTCGGATGTGATGACTCACGAGAACTTCCACAAGAAGAACACCCAGCTCATCAACGATGGCTTCCAGC

GCTTCCGAGCCACGGAGGACTGCGGCACAGCTGACTGTCAGTTCTATGGACAGAAGACCACACACTTCCACTGCAG GCGCCCTGGCTGCACATTCACCT

TCAAGAACAAGTGTGACATCGAGAAGCACAAGAGCTACCACATCAAGGATGATGCCTACGCCAAGGACGGCTTCAAGAAGTTCTACAAGTACGAGGAGTG

CAAATACGAGGGCTGCATGTACAGCAAGGCCACCAACCATTTCCACTGCATCCGCGCCGGCTGCGGCTTCACCTTCACCTCCACCAGCCAGATGACCTCA

CACAAGCGCAAGCACGAGCGGCGGCACATCCGGTCCTCGGGGGCCCTGGGGCTGCCGGCCTCCCTGCTGGGCGCCAAGGACACGGAGCACGAGGAATCCA

GCAACGATGACCTCGTGGACTTCTCTGCCCTGAGCAGCAAGAACTCCAGCCTGAGCGCCTCCCCCACCAGCCAGCAATCGTCCGCATCCCTGGCCGCTGC

GGCTGCCGCCACCACTGCTGAGGCCATCCCCAGTGCCACCAAGCCTCCCAATAGCAAGATGGCAGGCCTGCTGCCCCAGGGCCTGTCTGGTTCCATCCCC

TTAGCACTGGCCCTCTCTAACTCAGGCCTGCCCACCACCACACCCTATTTCCCTCTGCTTCCTAACCGTGGGAGCGCCTCATTGCCTGTGGGATCTCCAG

GGCTCCTGGGCTCCATGTCCTCTGGGGCCACAACCTCAGCAACCCCTGACATGCCGGCCCTGATGGCTTCCAGAGCTGGAGACTCGGCCCCCACGGCTGC

CACCTCTCTCTCGGTGCCCCCTGCCTCCATCATTGAGAGAATCTCTGCAAGCAAAGGCCTCATCTCACCCATGATGGCTAGACTGGCTGCGGCCGCCCTC

AAGCCCTCTGCCACCTTTGACCCAG GAAGTGGGCAGCAGCCCACCCCCACCAAGTTCCCCCAGGCCCAGGTGAAGCAGGAGCCTGACAGTGCTGGCACC

CCAGGTCCCCACGAGGCCTCCCAAGACCGCAGTCTAGACCTGACCGTGAAGGATCCCAG TAATGAATCAAATGGCCACGCAGTCTCGGCAAATTCATCT

CTTTTATCCTCGCTTATGAATAAG ATGTCTCAGGGCAACCCCAGCCTCGAAAGCTTCCTGAGCATCAAGACAGAAGCGGAGGGGAGCCCCGCCGGGGAG

CCCTCGCCTTTCTTGGGCAAGGCCGTGAAGGCACTAGTTCAAGAGAAGCTGTCAGAGCCTTGGAAGGTGTATCTCCGCAG GTTTGGTACCAAGGACTTC

TGTGATGCCCAGTGTGACTTCCTCCACAAGGCGCATTTCCATTGTGTAGTGGAGGAGTGCGGTGCGCTTTTCAGCACCTTGGACGGAGCCATCAAACATG

CAAA CTTCCACTTCCGGACAGAGGGAGGAACAGCAAAAGGAACCCCAGAGGCTTCCTTCCCGACCTCTGCTGCTGAGACCAAACCTCCCTTGGCACCCT

CGTCCCTGCCAGCACCTCCTGGCACCATGGTCGCTGGATCTTCTCTGGAGGGGCCTGCTCCCAGCCCGGTCTCTGTGCCCTCCACCCCCACCCTGCTCGC

CTGGAAGCAGCTGGCTTCCACCATACCCCAGATGCCTCAGATTCCCTCCTCAGTGCCTCACCTGCCCACCTCGCCCCTGGCGACGACGTCTCTAGAGAGC

GCCAAGCCTCAGGTCAAACCCGGGTTCCTCCAGTTCCAGGACAA CGATCCATGCCTGGCGACGGACTGCAAATACGCCAGCAAGTTCCACTTCCACTGT

CTCTTCGGGAACTGCAAGTACGTCTGCAAGACCTCGGGCAAGGCTGAGTCCCACTGCTTGGACCACATCAACCCCAGCAACAGCCTGGTGAACGTGCGAG

ACCAGTTTGCTTACTACTCTCTACAGTGCCTGTGTCCCAACCAG CACTGTGAGTTCCGGATGCGTGGACACTACCACTGCCTCCGGACGGGCTGCTACT

TTGTCACCAACATCACCACCAAACTTCCATGGCATATAAAGAAGCATGAGAAGGCTGAACGACGGGCAGCCAACGGGTTCAAATACTTCACCAAGCGCGA

GGAGTGCGGAAGACTAG GCTGCAAGTACAACCAGGTGAACAGCCACTTCCACTGCATCCGGGAAGGTTGTCAGTTCTCCTTTCTCCTCAAGCACCAGAT

GACCTCGCATGCCCGGAAGCACATGCGGAGGATGCTGGGGAAGAACTTTGACCGAGTGCCCCCATCCCAG GGTCCCCCGAGCCTAATGGATGCCGAGAC

AGACGAGGGCATGGACTATACAGGCTGTAGCCCTGGAGCGGCGTCCTCAGAGTCTTCCACCATGGACCGTAGCTGTTCCAGCACCCCTGTGGGCAATGAG

AGCACAGCTGCAG GGAACACCATCTCCATGCCGACAGCCTCGGGGGCCAAAAAGCGCTTTTGGATCATCGAGGACATGTCTCCCTTTGGCAAGCGAAGG

AAGACAGCCTCGTCTCGGAAGATGCTGGACGAGGGCATGATGCTGGAGGGTTTCCGGCGCTTTGACCTCTATGAGGACTGCAAGGATACAGCCTGCCAGT

TCTCACTCAAGGTCACCCACTACCACTGCACGCGGGAAAACTGCGGCTACAAGTTTTGCGGACGCACGCACATGTACAAGCACGCACAGCACCACGACCG

CGTGGACAACCTGGTGCTGGACGACTTCAAGCGCTTCAAGGCCTCCCTCAGCTGCCACTTCGCCGACTGCCCGTTCTCGGGCACCAGCACGCACTTCCAC

TGCCTGCGCTGCCGCTTCCGTTGCACAGACAGCACCAAGGTCACTGCGCACCGCAAGCACCACGGCAAGCAGGACGTGATCAGCGCCGCTGGCTTCTGCC

AGTTCAGCTCGAGCGCCGACTGCGCAGTGCCCGACTGCAAGTACAAGCTCAAGTGCTCGCACTTCCACTGCACCTATCCGGGCTGTCGCCACACAGTGGT

GGGCATGTCGCAGATGGACTCGCACAAGCGCAAGCACGAGAAGCAGGAGCGAGGGGAGCCTCCCGCAGCCTCTCCGGGTGCGCCTGTCAACCTGGACGGC

TCCCTCACGCTGGCCGCCGAGCAGGGCTCGCTGCTCTTCCTGCAGACAGCGGCTGCGGGCCTAGGCCTGCTCGGGGACACGGGGGACCCCGGCCCACCTG

TCACCGCCTCCGGGACTCGGGACGGCCCCGCTGCGCCCACCCCCGCTGCCGCCGCCACCACCACCACCACCACCACAGCCACAGCCACAGCCACCGCTGG

GGAGTCCTCCCAAGAGGACGACGAGGAGCTGGAGCTGCCGGAGGAGGAGGCCGAGGACGACGACGAGGATGACGATGAAGAGGACGACGACGACGAGGAT

GATGATGATGATGACGACGACGAGGACCTGCGCACCGACTCGGAGGAGTCGTTGCCCGAGGCTGCGGGCGAGGCGGGCGCGCGGACCCCGCTGGCAGCCC

TGGGTGGCCCCGGCCCTGCGCCCACCGCCGCATCACCCTAGCCGCCGCGCCACCCCAGCCCCCTCTAGAACTGCTCTGTATGTGAACCCCTGTGTACAGA

CCCCGCTGGGCCGCCCCAGGGAGTGAGGCGCCCTGGCCCCGCCGGTGCTTCCGGACCCCGAGTCCGTCTCAGGGCGAGGCGGGGACCCCTCTGGTGCTTC

GGGCCGCCCGCGCCCTCCCCGCCCGCCCGAGCGGGTGTTCAGGGAATAGCAGGTGCTGTGTCGGGGTGGCAGCACTGACCTGCACTCCTCTCGGTACCCA

CTCGCGAGGTCCTTGTTTGCTCAGGGGCTCCCCGCGGGGGTCACCGGGTTGTGGGGGCGGCAGGCTCCTGTAGCATCTGGTTCTCTCCCCCCCCCCCGCC

CCAATGCAGCTAAGACCTCCTCCTGGCTCAGGGGAGGGCCGGCCGAAGACGGTCAGCATCAGCACGGGTGACACTACAGGGACATGGAGGGAATCTCATG

GAATCAGCAGCAAGCCGGCATCCCCGCCCCCAAGCTGTGGTCCAGGTCTGGTGACACTCAGGCCCCAGCCCACCCTCCAGCGAATTTGAGGCTGTGGCCC

AAAGGCAGGCACAGCTGGTGGGGGCCTGGAGGTGAGGGTCTCAGCCACTGGTGCAAACAGGAAGGCTGCGACTGGTTTTGGCTTTAATAATCAAAATGGA

AAAAAAATCCAAGAAAGTTGTACAGTATTTTTCCTGTAAAGGTTATTATTCTACATAGAACAAAAAGAGAAGGGGGAAAACGGAAAAAAACAAAAAAAAC

TAAAACAAAAAAAACAAAAAAACAAAAAAAAAAGCAGGCGAGTGCGGGGGGAGCCTCGCCTCGCCTTCAGCCCAGCCCTGGGATTGGGGACCCGAGTGCA

ATTGCTCCTGTGGAATTGTTGTGCATTTACTTTCAAGGCCTCGGTTTGAGGCGTTGTCCTCACACTAGCACTGATGGGGGCTGCGGGATTCCAACTTTTA

ACTTGAATTTTGTAGAGACAAGGAAAAAAAAAAAGACTATTCTCTTGATACAAGTTTGTAGCTAATTTAACATTTGAGGGTTTTTCTGTTGGTTATGCGT

GTGGCTTTATAGGGCTTTTTTTTCTCTTTCTCTCTCTCTCTCGTTCCAGTTTTGTTTTATTATTTTATTTGGGATGCTTTCGTGCAGGTGCAGCCCACCC

AGATCTGGTTCCTTTTCCAAAATACCCCTTTCCCGGAGGCAATGAGGCCACTTAGACTCTGCACAGGGCTCACCTGCAGGCACTTACTTGGCCAGAGGCT

GCTCCAGATTCTGGTAGGGGCAGGCTGTCTGAGGCCGGCCTTGTGGGGTAAACCTGTGCACTCCAGGTTCTGGCTAGTGCCAGGCTGGAAGAAACCAGGC

CAATTCGGCAAGTAATGGAAGGGCCGGGAGTTGCCAGCAGGAAGCCCCGCCCATAGGTCTTTAAATGGGGTCTGCCCAAATGGGGCAGTGGTTTTCTTTA

TCTGTATCAGAGTGTATGTATGTGTGTGAGAGTGTGTATCTGTGTATGTGTGTGTGTGTGTCCCCTCTTGGCTGCCCACAGCCAGAAAGCCAGGACCATC

TAAACTGGAGAGGGAGCAGGGAGGGTACAGCTGAGAGATGAGGGTACCCAACAGGCAACGCGCTGATTGCTAACCGGCCCTGCCAGAGCCTCCATGCTGC

TGAGAGTTCGTTCGCCCAGATTCTAACCTACCACAGGACTCTGCCTCTGTGGAAGGAGTTTTGTAAAGGAAAAGAAAAACAAAACACAACAAAACAAAAT

AAAAAAAAATTTCAATGTAGCAAAATCAAATAAAAAATTATAAAAGGAAAAAAAAAAGCCGCGGAGAGTGCGCAGTCTAGCCTTTTGTAAGCCTCATATT

GCACATTAGGACTATAAGCCATTGCTAGCTCATCTTGAATTTTAATGTGTAATTTTTGTTTTATTTTCTTTCTGTGAGGAAAACGATGCCTGACCCACCA

ATGCTCTTTTTAATGTTTTATAACTATGTATGTGTATATATATAAATATAAAAGTAATATGTATGCACATATGTGTGTATATATCTATATGTATATACAT

ATATAGATATATAGAGATATATAGAGAGGTTTTGAGACAAAAAAAAAAAAAAATGCAGACCATGAAACCGACCTGAACAGCGCGCGCTCTGATTACTTGA

ATCTGGTCTCCTCGGCACCTGGTTATTAAGAACTGAATATTTTTCCACTTGAATTTAGTGCTATTAGAAATTTAATATATGTGTTTTATTTATTTGATTT

TTTTTTGCATGACTGATGCAAGGTTTGACATTTTCACTCAATAAAAACTGGAAAAAAAA
Translation
 - UNI17447 -  - UNI20147 -  - UNI31806 - MDLGTA - UNI6535 - - UNI29935 - AESTRCTDPPAGKPPMAAKRKGGLKL

NAICAKLSRQVVVEKGAEAGSQAEGSPLHPRDKERSGPESGVSRAPRSEEDKRRAVIEKWVNGEYCEDPAPTPVLGRIARDQELPPEGVYMVQPQGCSDE

EDHAEEPSKDNSVLEEKESDGTASKDDSGPSTRQASG - UNI6535 - - UNI36095 - GETSSLRDYAASTMTEFLGMFGYDDQNTRDELAKKIS

FEKPHAGSTPEVAASSMLPSSEDTLSKRARFSKYEEYIRKLKAGEQLPWPAHGSKAEDRAGKEVVGPLPSLRLPSNTAHLETKATILPLPSHSSVQMQNL

VARASKYDFFIHKLKTGENLRPQNGSTYKKPSKYDLENVKYLHLFKPGEGSPDMGGAIAFKTGKVGRPSKYDVRGIQKPGPTKIPPAPSLVPTPLTNVPS

APSTPGPGPEPPASLSFNTPEYLKSTFSKTDSITTGTVSTVK KNGLPTDKPAVTEDVNIYQKYIAR RFSGSQHCGHIHCAYQYREHYHCLDPECNYQ 

- UNI1351 - RFTSKQDVIRHYNMHKKRDNSLQHGFMRFSPLDDCSVYYHGCHLNGKSTHYHCMQ - UNI1351 - VGCNKVYTSTSDVMTHENFH

KKNTQLINDGFQRFRATEDCGTADCQFYGQKTTHFHCR RRPGCTFTFKNKCDIEKHKSYHIKDDAYAKDGFKKFYKYEECKYEGCMYSKATNHFHCIRA

GCGFTFTSTSQMTSHKRKHERRHIRSSGALGLPASLLGAKDTEHEESSNDDLVDFSALSSKNSSLSASPTSQQSSASLAAAAAATTAEAIPSATKPPNSK

MAGLLPQGLSGSIPLALALSNSGLPTTTPYFPLLPNRGSASLPVGSPGLLGSMSSGATTSATPDMPALMASRAGDSAPTAATSLSVPPASIIERISASKG

LISPMMARLAAAALKPSATFDPG GSGQQPTPTKFPQAQVKQEPDSAGTPGPHEASQDRSLDLTVKDPS SNESNGHAVSANSSLLSSLMNK MSQGNPS

LESFLSIKTEAEGSPAGEPSPFLGKAVKALVQEKLSEPWKVYLRR RFGTKDFCDAQCDFLHKAHFHCVVEECGALFSTLDGAIKHAN NFHFRTEGGTA

KGTPEASFPTSAAETKPPLAPSSLPAPPGTMVAGSSLEGPAPSPVSVPSTPTLLAWKQLASTIPQMPQIPSSVPHLPTSPLATTSLESAKPQVKPGFLQF

QDN NDPCLATDCKYASKFHFHCLFGNCKYVCKTSGKAESHCLDHINPSNSLVNVRDQFAYYSLQCLCPNQ HCEFRMRGHYHCLRTGCYFVTNITTKLP

WHIKKHEKAERRAANGFKYFTKREECGRLG GCKYNQVNSHFHCIREGCQFSFLLKHQMTSHARKHMRRMLGKNFDRVPPSQ GPPSLMDAETDEGMDYT

GCSPGAASSESSTMDRSCSSTPVGNESTAAG GNTISMPTASGAKKRFWIIEDMSPFGKRRKTASSRKMLDEGMMLEGFRRFDLYEDCKDTACQFSLKVT

HYHCTRENCGYKFCGRTHMYKHAQHHDRVDNLVLDDFKRFKASLSCHFADCPFSGTSTHFHCLRCRFRCTDSTKVTAHRKHHGKQDVISAAGFCQFSSSA

DCAVPDCKYKLKCSHFHCTYPGCRHTVVGMSQMDSHKRKHEKQERGEPPAASPGAPVNLDGSLTLAAEQGSLLFLQTAAAGLGLLGDTGDPGPPVTASGT

RDGPAAPTPAAAATTTTTTTATATATAGESSQEDDEELELPEEEAEDDDEDDDEEDDDDEDDDDDDDDEDLRTDSEESLPEAAGEAGARTPLAALGGPGP

APTAASP
Transcript ENSMUST00000094464
Sequence
GCATGCGCGCCCGCGGCGCTCCATCCCAAACACACACACATTTTTCCCCGGACTTGGAAAGTCACCCAAAGCCGCCCCAAGTGCAG - UNI17447 - 

GCACACAGACCTTGCTGACGGAAGGCAGACCCTCTCCATCTCACCTGCCCTCCAACTGCCTGAGCTACCCACTCCTCCTTCTCCGGGGGACCCTGCAGCT

CCCCGGTGGTGTGCATTGGAATGGACTTCGGACCTTGGACTCTTGGGATGCAAAG - UNI20147 - GATGAAGTGACCCCCACCCCCAACTGTGTTT

GAGGAATCTCTAGGACCCCGTGAG - UNI31806 - AGTTTGGGACCAAGGAGCGGAGAATGGATCTTGGAACAG - UNI6535 - - UNI29935

 - CTGAAAGCACCCGGTGCACCGACCCACCTGCAGGCAAGCCTCCAATGGCAGCCAAGCGCAAAGGCGGCCTGAAGCTCAACGCCATCTGTGCCAAGCT

CAGCCGACAGGTGGTCGTGGAGAAGGGAGCAGAGGCCGGCTCCCAAGCCGAAGGTAGCCCACTACATCCCCGGGACAAAGAGCGCAGTGGCCCTGAGTCT

GGGGTGAGCCGGGCTCCCCGAAGTGAAGAAGACAAGAGGCGGGCAGTGATCGAGAAATGGGTCAATGGAGAGTACTGTGAGGATCCCGCACCCACCCCAG

TGTTGGGGCGTATTGCCCGTGATCAGGAGCTGCCCCCAGAGGGTGTCTACATGGTCCAGCCACAGGGCTGCAGTGACGAAGAAGACCATGCAGAAGAGCC

CTCAAAAGATAACAGTGTCCTGGAGGAGAAGGAGTCAGATGGTACGGCTTCTAAAGATGACAGCGGCCCCAGCACCAGGCAGGCTTCAG - UNI6535 

- - UNI36095 - GAGAAACCTCCTCTCTGAGGGACTACGCTGCTTCCACCATGACCGAGTTCCTCGGCATGTTTGGCTACGATGACCAGAACACCAG

GGATGAGCTGGCCAAGAAGATCAGCTTTGAGAAGCCGCATGCAGGCTCCACCCCCGAGGTGGCTGCCTCTTCCATGTTGCCCTCCTCTGAGGATACCCTC

AGCAAGCGGGCGCGCTTCTCCAAATACGAGGAATACATCCGTAAGCTCAAGGCCGGCGAGCAACTTCCCTGGCCAGCCCACGGGAGCAAAGCCGAGGACC

GGGCAGGCAAGGAGGTGGTGGGTCCCTTACCCAGCCTACGGCTGCCCAGCAACACGGCCCACCTGGAAACCAAGGCCACCATCCTGCCACTGCCATCACA

CAGCAGTGTCCAGATGCAGAATCTGGTAGCTCGTGCTTCCAAGTATGACTTCTTCATCCACAAACTGAAGACAGGCGAGAACCTGAGGCCCCAGAATGGA

AGCACTTACAAGAAGCCATCCAAGTATGACCTGGAGAATGTCAAGTACTTGCACCTCTTCAAACCCGGGGAAGGCAGCCCTGACATGGGCGGGGCCATCG

CCTTCAAGACAGGCAAGGTGGGGCGCCCCTCTAAGTACGACGTTCGGGGCATCCAGAAGCCAGGCCCTACCAAGATTCCGCCCGCCCCCAGCCTGGTTCC

TACACCCCTCACCAATGTGCCCAGTGCTCCCAGCACCCCCGGACCAGGACCGGAGCCACCTGCCTCCTTGTCCTTCAACACTCCCGAGTACCTGAAGTCA

ACCTTTTCCAAAACAGACTCCATCACCACAGGAACTGTCTCCACTGTCAA GAACGGATTGCCCACAGATAAACCAGCTGTCACCGAAGATGTAAACATT

TACCAGAAATATATTGCCAG GTTCTCAGGAAGTCAGCACTGCGGTCACATCCACTGCGCCTACCAGTACCGTGAGCACTATCACTGCCTGGACCCGGAG

TGCAACTACCAG - UNI1351 - CGGTTCACAAGCAAGCAGGATGTGATCCGACATTACAACATGCACAAGAAGCGCGACAACTCCCTGCAGCACGGC

TTCATGCGCTTCAGCCCGCTGGACGACTGCAGTGTCTACTACCACGGCTGCCACCTCAATGGGAAGAGCACCCACTACCACTGCATGCAG - UNI1351

 - GTGGGATGTAACAAGGTATACACAAGTACGTCGGATGTGATGACTCACGAGAACTTCCACAAGAAGAACACCCAGCTCATCAACGATGGCTTCCAGC

GCTTCCGAGCCACGGAGGACTGCGGCACAGCTGACTGTCAGTTCTATGGACAGAAGACCACACACTTCCACTGCAG GCGCCCTGGCTGCACATTCACCT

TCAAGAACAAGTGTGACATCGAGAAGCACAAGAGCTACCACATCAAGGATGATGCCTACGCCAAGGACGGCTTCAAGAAGTTCTACAAGTACGAGGAGTG

CAAATACGAGGGCTGCATGTACAGCAAGGCCACCAACCATTTCCACTGCATCCGCGCCGGCTGCGGCTTCACCTTCACCTCCACCAGCCAGATGACCTCA

CACAAGCGCAAGCACGAGCGGCGGCACATCCGGTCCTCGGGGGCCCTGGGGCTGCCGGCCTCCCTGCTGGGCGCCAAGGACACGGAGCACGAGGAATCCA

GCAACGATGACCTCGTGGACTTCTCTGCCCTGAGCAGCAAGAACTCCAGCCTGAGCGCCTCCCCCACCAGCCAGCAATCGTCCGCATCCCTGGCCGCTGC

GGCTGCCGCCACCACTGCTGAGGCCATCCCCAGTGCCACCAAGCCTCCCAATAGCAAGATGGCAGGCCTGCTGCCCCAGGGCCTGTCTGGTTCCATCCCC

TTAGCACTGGCCCTCTCTAACTCAGGCCTGCCCACCACCACACCCTATTTCCCTCTGCTTCCTAACCGTGGGAGCGCCTCATTGCCTGTGGGATCTCCAG

GGCTCCTGGGCTCCATGTCCTCTGGGGCCACAACCTCAGCAACCCCTGACATGCCGGCCCTGATGGCTTCCAGAGCTGGAGACTCGGCCCCCACGGCTGC

CACCTCTCTCTCGGTGCCCCCTGCCTCCATCATTGAGAGAATCTCTGCAAGCAAAGGCCTCATCTCACCCATGATGGCTAGACTGGCTGCGGCCGCCCTC

AAGCCCTCTGCCACCTTTGACCCAG GAAGTGGGCAGCAGCCCACCCCCACCAAGTTCCCCCAGGCCCAGGTGAAGCAGGAGCCTGACAGTGCTGGCACC

CCAGGTCCCCACGAGGCCTCCCAAGACCGCAGTCTAGACCTGACCGTGAAGGATCCCAG TAATGAATCAAATGGCCACGCAGTCTCGGCAAATTCATCT

CTTTTATCCTCGCTTATGAATAAG ATGTCTCAGGGCAACCCCAGCCTCGAAAGCTTCCTGAGCATCAAGACAGAAGCGGAGGGGAGCCCCGCCGGGGAG

CCCTCGCCTTTCTTGGGCAAGGCCGTGAAGGCACTAGTTCAAGAGAAGCTGTCAGAGCCTTGGAAGGTGTATCTCCGCAG GTTTGGTACCAAGGACTTC

TGTGATGCCCAGTGTGACTTCCTCCACAAGGCGCATTTCCATTGTGTAGTGGAGGAGTGCGGTGCGCTTTTCAGCACCTTGGACGGAGCCATCAAACATG

CAAA CTTCCACTTCCGGACAGAGGGAGGAACAGCAAAAGGAACCCCAGAGGCTTCCTTCCCGACCTCTGCTGCTGAGACCAAACCTCCCTTGGCACCCT

CGTCCCTGCCAGCACCTCCTGGCACCATGGTCGCTGGATCTTCTCTGGAGGGGCCTGCTCCCAGCCCGGTCTCTGTGCCCTCCACCCCCACCCTGCTCGC

CTGGAAGCAGCTGGCTTCCACCATACCCCAGATGCCTCAGATTCCCTCCTCAGTGCCTCACCTGCCCACCTCGCCCCTGGCGACGACGTCTCTAGAGAGC

GCCAAGCCTCAGGTCAAACCCGGGTTCCTCCAGTTCCAGGACAAGTGAGTCCCTCCATGAGCCGGCACCTGTCCCTGTGTCTTGGGAGTGGGTATGGCCA

GGGCAGCAAGGAGGCCCTGCTCCTCGCCTCGCAGAGTTACACTGGCTGCCCTCAGCCTCTGGGACTTAGTTTTCCAACTGTATGCTTGTACCGAGCAGCC

AGTAAGTGGGGGGATGAGGGCGCAAGCGACCTTACCCCCAGTGATCCGTTGGGATCCTTCAAGGACTGGCTGGGGTGAGCTAGGTATGGGGGTCCCTCAG

GAAACTTCCTGGTCCTACAAAAAGGCTGTGTTCCCTTGGGGTCACCTTGCTGGCCAGCTCTGTGGTGCATACCCAGGCTGAGTCAATAGGACAGGGAAGG

CATGGATGGGAGCAGGGCCTAGGCCCCTCAAAGTCCACACCGTGGTCAAGGGTGGAAGGAACCTTCTTCACTTAATGGTGGTGGCTTCTTGCGGCGAGAA

CGGTGACTTTGTATCATAAAGTGTGTGGCTTCCTGTTCTCAATAAAAAGTAATAAATTGGATTATTTATACCACCTG
Translation
 - UNI17447 -  - UNI20147 -  - UNI31806 - MDLGTA - UNI6535 - - UNI29935 - AESTRCTDPPAGKPPMAAKRKGGLKL

NAICAKLSRQVVVEKGAEAGSQAEGSPLHPRDKERSGPESGVSRAPRSEEDKRRAVIEKWVNGEYCEDPAPTPVLGRIARDQELPPEGVYMVQPQGCSDE

EDHAEEPSKDNSVLEEKESDGTASKDDSGPSTRQASG - UNI6535 - - UNI36095 - GETSSLRDYAASTMTEFLGMFGYDDQNTRDELAKKIS

FEKPHAGSTPEVAASSMLPSSEDTLSKRARFSKYEEYIRKLKAGEQLPWPAHGSKAEDRAGKEVVGPLPSLRLPSNTAHLETKATILPLPSHSSVQMQNL

VARASKYDFFIHKLKTGENLRPQNGSTYKKPSKYDLENVKYLHLFKPGEGSPDMGGAIAFKTGKVGRPSKYDVRGIQKPGPTKIPPAPSLVPTPLTNVPS

APSTPGPGPEPPASLSFNTPEYLKSTFSKTDSITTGTVSTVK KNGLPTDKPAVTEDVNIYQKYIAR RFSGSQHCGHIHCAYQYREHYHCLDPECNYQ 

- UNI1351 - RFTSKQDVIRHYNMHKKRDNSLQHGFMRFSPLDDCSVYYHGCHLNGKSTHYHCMQ - UNI1351 - VGCNKVYTSTSDVMTHENFH

KKNTQLINDGFQRFRATEDCGTADCQFYGQKTTHFHCR RRPGCTFTFKNKCDIEKHKSYHIKDDAYAKDGFKKFYKYEECKYEGCMYSKATNHFHCIRA

GCGFTFTSTSQMTSHKRKHERRHIRSSGALGLPASLLGAKDTEHEESSNDDLVDFSALSSKNSSLSASPTSQQSSASLAAAAAATTAEAIPSATKPPNSK

MAGLLPQGLSGSIPLALALSNSGLPTTTPYFPLLPNRGSASLPVGSPGLLGSMSSGATTSATPDMPALMASRAGDSAPTAATSLSVPPASIIERISASKG

LISPMMARLAAAALKPSATFDPG GSGQQPTPTKFPQAQVKQEPDSAGTPGPHEASQDRSLDLTVKDPS SNESNGHAVSANSSLLSSLMNK MSQGNPS

LESFLSIKTEAEGSPAGEPSPFLGKAVKALVQEKLSEPWKVYLRR RFGTKDFCDAQCDFLHKAHFHCVVEECGALFSTLDGAIKHAN NFHFRTEGGTA

KGTPEASFPTSAAETKPPLAPSSLPAPPGTMVAGSSLEGPAPSPVSVPSTPTLLAWKQLASTIPQMPQIPSSVPHLPTSPLATTSLESAKPQVKPGFLQF

QDK
Transcript ENSMUST00000030820
Sequence
CTGGAGGTTGGCACAG - UNI6535 - CTGAAAGCACCCGGTGCACCGACCCACCTGCAGGCAAGCCTCCAATGGCAGCCAAGCGCAAAGGCGGCCTG

AAGCTCAACGCCATCTGTGCCAAGCTCAGCCGACAGGTGGTCGTGGAGAAGGGAGCAGAGGCCGGCTCCCAAGCCGAAGGTAGCCCACTACATCCCCGGG

ACAAAGAGCGCAGTGGCCCTGAGTCTGGGGTGAGCCGGGCTCCCCGAAGTGAAGAAGACAAGAGGCGGGCAGTGATCGAGAAATGGGTCAATGGAGAGTA

CTGTGAGGATCCCGCACCCACCCCAGTGTTGGGGCGTATTGCCCGTGATCAGGAGCTGCCCCCAGAGGGTGTCTACATGGTCCAGCCACAGGGCTGCAGT

GACGAAGAAGACCATGCAGAAGAGCCCTCAAAAGATAACAGTGTCCTGGAGGAGAAGGAGTCAGATGGTACGGCTTCTAAAGATGACAGCGGCCCCAGCA

CCAGGCAGGCTTCAG - UNI6535 - - UNI36095 - GAGAAACCTCCTCTCTGAGGGACTACGCTGCTTCCACCATGACCGAGTTCCTCGGCATG

TTTGGCTACGATGACCAGAACACCAGGGATGAGCTGGCCAAGAAGATCAGCTTTGAGAAGCCGCATGCAGGCTCCACCCCCGAGGTGGCTGCCTCTTCCA

TGTTGCCCTCCTCTGAGGATACCCTCAGCAAGCGGGCGCGCTTCTCCAAATACGAGGAATACATCCGTAAGCTCAAGGCCGGCGAGCAACTTCCCTGGCC

AGCCCACGGGAGCAAAGCCGAGGACCGGGCAGGCAAGGAGGTGGTGGGTCCCTTACCCAGCCTACGGCTGCCCAGCAACACGGCCCACCTGGAAACCAAG

GCCACCATCCTGCCACTGCCATCACACAGCAGTGTCCAGATGCAGAATCTGGTAGCTCGTGCTTCCAAGTATGACTTCTTCATCCACAAACTGAAGACAG

GCGAGAACCTGAGGCCCCAGAATGGAAGCACTTACAAGAAGCCATCCAAGTATGACCTGGAGAATGTCAAGTACTTGCACCTCTTCAAACCCGGGGAAGG

CAGCCCTGACATGGGCGGGGCCATCGCCTTCAAGACAGGCAAGGTGGGGCGCCCCTCTAAGTACGACGTTCGGGGCATCCAGAAGCCAGGCCCTACCAAG

ATTCCGCCCGCCCCCAGCCTGGTTCCTACACCCCTCACCAATGTGCCCAGTGCTCCCAGCACCCCCGGACCAGGACCGGAGCCACCTGCCTCCTTGTCCT

TCAACACTCCCGAGTACCTGAAGTCAACCTTTTCCAAAACAGACTCCATCACCACAGGAACTGTCTCCACTGTCAA GAACGGATTGCCCACAGATAAAC

CAGCTGTCACCGAAGATGTAAACATTTACCAGAAATATATTGCCAG GTTCTCAGGAAGTCAGCACTGCGGTCACATCCACTGCGCCTACCAGTACCGTG

AGCACTATCACTGCCTGGACCCGGAGTGCAACTACCAG - UNI1351 - CGGTTCACAAGCAAGCAGGATGTGATCCGACATTACAACATGCACAAGA

AGCGCGACAACTCCCTGCAGCACGGCTTCATGCGCTTCAGCCCGCTGGACGACTGCAGTGTCTACTACCACGGCTGCCACCTCAATGGGAAGAGCACCCA

CTACCACTGCATGCAG - UNI1351 - GTGGGATGTAACAAGGTATACACAAGTACGTCGGATGTGATGACTCACGAGAACTTCCACAAGAAGAACAC

CCAGCTCATCAACGATGGCTTCCAGCGCTTCCGAGCCACGGAGGACTGCGGCACAGCTGACTGTCAGTTCTATGGACAGAAGACCACACACTTCCACTGC

AG GCGCCCTGGCTGCACATTCACCTTCAAGAACAAGTGTGACATCGAGAAGCACAAGAGCTACCACATCAAGGATGATGCCTACGCCAAGGACGGCTTC

AAGAAGTTCTACAAGTACGAGGAGTGCAAATACGAGGGCTGCATGTACAGCAAGGCCACCAACCATTTCCACTGCATCCGCGCCGGCTGCGGCTTCACCT

TCACCTCCACCAGCCAGATGACCTCACACAAGCGCAAGCACGAGCGGCGGCACATCCGGTCCTCGGGGGCCCTGGGGCTGCCGGCCTCCCTGCTGGGCGC

CAAGGACACGGAGCACGAGGAATCCAGCAACGATGACCTCGTGGACTTCTCTGCCCTGAGCAGCAAGAACTCCAGCCTGAGCGCCTCCCCCACCAGCCAG

CAATCGTCCGCATCCCTGGCCGCTGCGGCTGCCGCCACCACTGCTGAGGCCATCCCCAGTGCCACCAAGCCTCCCAATAGCAAGATGGCAGGCCTGCTGC

CCCAGGGCCTGTCTGGTTCCATCCCCTTAGCACTGGCCCTCTCTAACTCAGGCCTGCCCACCACCACACCCTATTTCCCTCTGCTTCCTAACCGTGGGAG

CGCCTCATTGCCTGTGGGATCTCCAGGGCTCCTGGGCTCCATGTCCTCTGGGGCCACAACCTCAGCAACCCCTGACATGCCGGCCCTGATGGCTTCCAGA

GCTGGAGACTCGGCCCCCACGGCTGCCACCTCTCTCTCGGTGCCCCCTGCCTCCATCATTGAGAGAATCTCTGCAAGCAAAGGCCTCATCTCACCCATGA

TGGCTAGACTGGCTGCGGCCGCCCTCAAGCCCTCTGCCACCTTTGACCCAG GAAGTGGGCAGCAGCCCACCCCCACCAAGTTCCCCCAGGCCCAGGTGA

AGCAGGAGCCTGACAGTGCTGGCACCCCAGGTCCCCACGAGGCCTCCCAAGACCGCAGTCTAGACCTGACCGTGAAGGATCCCAG TAATGAATCAAATG

GCCACGCAGTCTCGGCAAATTCATCTCTTTTATCCTCGCTTATGAATAAG ATGTCTCAGGGCAACCCCAGCCTCGAAAGCTTCCTGAGCATCAAGACAG

AAGCGGAGGGGAGCCCCGCCGGGGAGCCCTCGCCTTTCTTGGGCAAGGCCGTGAAGGCACTAGTTCAAGAGAAGCTGTCAGAGCCTTGGAAGGTGTATCT

CCGCAG GTTTGGTACCAAGGACTTCTGTGATGCCCAGTGTGACTTCCTCCACAAGGCGCATTTCCATTGTGTAGTGGAGGAGTGCGGTGCGCTTTTCAG

CACCTTGGACGGAGCCATCAAACATGCAAA CTTCCACTTCCGGACAGAGGGAGGAACAGCAAAAGGAACCCCAGAGGCTTCCTTCCCGACCTCTGCTGC

TGAGACCAAACCTCCCTTGGCACCCTCGTCCCTGCCAGCACCTCCTGGCACCATGGTCGCTGGATCTTCTCTGGAGGGGCCTGCTCCCAGCCCGGTCTCT

GTGCCCTCCACCCCCACCCTGCTCGCCTGGAAGCAGCTGGCTTCCACCATACCCCAGATGCCTCAGATTCCCTCCTCAGTGCCTCACCTGCCCACCTCGC

CCCTGGCGACGACGTCTCTAGAGAGCGCCAAGCCTCAGGTCAAACCCGGGTTCCTCCAGTTCCAGGACAAGTGAGTCCCTCCATGAGCCGGCACCTGTCC

CTGTGTCTTGGGAGTGGGTATGGCCAGGGCAGCAAGGAGGCCCTGCTCCTCGCCTCGCAGAGTTACACTGGCTGCCCTCAGCCTCTGGGACTTAGTTTTC

CAACTGTATGCTTGTACCGAGCAGCCAGTAAGTGGGGGGATGAGGGCGCAAGCGACCTTACCCCCAGTGATCCGTTGGGATCCTTCAAGGACTGGCTGGG

GTGAGCTAGGTATGGGGGTCCCTCAGGAAACTTCCTGGTCCTACAAAAAGGCTGTGTTCCCTTGGGGTCACCTTGCTGGCCAGCTCTGTGGTGCATACCC

AGGCTGAGTCAATAGGACAGGGAAGGCATGGATGGGAGCAGGGCCTAGGCCCCTCAAAGTCCACACCGTGGTCAAGGGTGGAAGGAACCTTCTTCACTTA

ATGGTGGTGGCTTCTTGCGGCGAGAACGGTGACTTTGTATCATAAAGTGTGTGGCTTCCTGTTCTCAATAAAAAGTAATAAATTGGATTATTTATACCAC

CTG
Translation
LEVGTA - UNI6535 - AESTRCTDPPAGKPPMAAKRKGGLKLNAICAKLSRQVVVEKGAEAGSQAEGSPLHPRDKERSGPESGVSRAPRSEEDKRRA

VIEKWVNGEYCEDPAPTPVLGRIARDQELPPEGVYMVQPQGCSDEEDHAEEPSKDNSVLEEKESDGTASKDDSGPSTRQASG - UNI6535 - - UNI

36095 - GETSSLRDYAASTMTEFLGMFGYDDQNTRDELAKKISFEKPHAGSTPEVAASSMLPSSEDTLSKRARFSKYEEYIRKLKAGEQLPWPAHGSK

AEDRAGKEVVGPLPSLRLPSNTAHLETKATILPLPSHSSVQMQNLVARASKYDFFIHKLKTGENLRPQNGSTYKKPSKYDLENVKYLHLFKPGEGSPDMG

GAIAFKTGKVGRPSKYDVRGIQKPGPTKIPPAPSLVPTPLTNVPSAPSTPGPGPEPPASLSFNTPEYLKSTFSKTDSITTGTVSTVK KNGLPTDKPAVT

EDVNIYQKYIAR RFSGSQHCGHIHCAYQYREHYHCLDPECNYQ - UNI1351 - RFTSKQDVIRHYNMHKKRDNSLQHGFMRFSPLDDCSVYYHGCH

LNGKSTHYHCMQ - UNI1351 - VGCNKVYTSTSDVMTHENFHKKNTQLINDGFQRFRATEDCGTADCQFYGQKTTHFHCR RRPGCTFTFKNKCDIE

KHKSYHIKDDAYAKDGFKKFYKYEECKYEGCMYSKATNHFHCIRAGCGFTFTSTSQMTSHKRKHERRHIRSSGALGLPASLLGAKDTEHEESSNDDLVDF

SALSSKNSSLSASPTSQQSSASLAAAAAATTAEAIPSATKPPNSKMAGLLPQGLSGSIPLALALSNSGLPTTTPYFPLLPNRGSASLPVGSPGLLGSMSS

GATTSATPDMPALMASRAGDSAPTAATSLSVPPASIIERISASKGLISPMMARLAAAALKPSATFDPG GSGQQPTPTKFPQAQVKQEPDSAGTPGPHEA

SQDRSLDLTVKDPS SNESNGHAVSANSSLLSSLMNK MSQGNPSLESFLSIKTEAEGSPAGEPSPFLGKAVKALVQEKLSEPWKVYLRR RFGTKDFCD

AQCDFLHKAHFHCVVEECGALFSTLDGAIKHAN NFHFRTEGGTAKGTPEASFPTSAAETKPPLAPSSLPAPPGTMVAGSSLEGPAPSPVSVPSTPTLLA

WKQLASTIPQMPQIPSSVPHLPTSPLATTSLESAKPQVKPGFLQFQDK
Transcript ENSMUST00000060495
Sequence
GGGAGCGAAAAATCCGGGATCCGGCAACTTCGGTCGCGCATGCGCGCCCGCGGCGCTCCATCCCAAACACACACACATTTTTCCCCGGACTTGGAAAGTC

ACCCAAAGCCGCCCCAAGTGCAG - UNI17447 - GCACACAGACCTTGCTGACGGAAGGCAGACCCTCTCCATCTCACCTGCCCTCCAACTGCCTGA

GCTACCCACTCCTCCTTCTCCGGGGGACCCTGCAGCTCCCCGGTGGTGTGCATTGGAATGGACTTCGGACCTTGGACTCTTGGGATGCAAAG - UNI20

147 - GATGAAGTGACCCCCACCCCCAACTGTGTTTGAGGAATCTCTAGGACCCCGTGAG - UNI31806 - AGTTTGGGACCAAGGAGCGGAGAAT

GGATCTTGGAACAG - UNI6535 - - UNI29935 - CTGAAAGCACCCGGTGCACCGACCCACCTGCAGGCAAGCCTCCAATGGCAGCCAAGCGCA

AAGGCGGCCTGAAGCTCAACGCCATCTGTGCCAAGCTCAGCCGACAGGTGGTCGTGGAGAAGGGAGCAGAGGCCGGCTCCCAAGCCGAAGGTAGCCCACT

ACATCCCCGGGACAAAGAGCGCAGTGGCCCTGAGTCTGGGGTGAGCCGGGCTCCCCGAAGTGAAGAAGACAAGAGGCGGGCAGTGATCGAGAAATGGGTC

AATGGAGAGTACTGTGAGGATCCCGCACCCACCCCAGTGTTGGGGCGTATTGCCCGTGATCAGGAGCTGCCCCCAGAGGGTGTCTACATGGTCCAGCCAC

AGGGCTGCAGTGACGAAGAAGACCATGCAGAAGAGCCCTCAAAAGATAACAGTGTCCTGGAGGAGAAGGAGTCAGATGGTACGGCTTCTAAAGATGACAG

CGGCCCCAGCACCAGGCAGGCTTCAG - UNI6535 - - UNI36095 - GAGAAACCTCCTCTCTGAGGGACTACGCTGCTTCCACCATGACCGAGT

TCCTCGGCATGTTTGGCTACGATGACCAGAACACCAGGGATGAGCTGGCCAAGAAGATCAGCTTTGAGAAGCCGCATGCAGGCTCCACCCCCGAGGTGGC

TGCCTCTTCCATGTTGCCCTCCTCTGAGGATACCCTCAGCAAGCGGGCGCGCTTCTCCAAATACGAGGAATACATCCGTAAGCTCAAGGCCGGCGAGCAA

CTTCCCTGGCCAGCCCACGGGAGCAAAGCCGAGGACCGGGCAGGCAAGGAGGTGGTGGGTCCCTTACCCAGCCTACGGCTGCCCAGCAACACGGCCCACC

TGGAAACCAAGGCCACCATCCTGCCACTGCCATCACACAGCAGTGTCCAGATGCAGAATCTGGTAGCTCGTGCTTCCAAGTATGACTTCTTCATCCACAA

ACTGAAGACAGGCGAGAACCTGAGGCCCCAGAATGGAAGCACTTACAAGAAGCCATCCAAGTATGACCTGGAGAATGTCAAGTACTTGCACCTCTTCAAA

CCCGGGGAAGGCAGCCCTGACATGGGCGGGGCCATCGCCTTCAAGACAGGCAAGGTGGGGCGCCCCTCTAAGTACGACGTTCGGGGCATCCAGAAGCCAG

GCCCTACCAAGATTCCGCCCGCCCCCAGCCTGGTTCCTACACCCCTCACCAATGTGCCCAGTGCTCCCAGCACCCCCGGACCAGGACCGGAGCCACCTGC

CTCCTTGTCCTTCAACACTCCCGAGTACCTGAAGTCAACCTTTTCCAAAACAGACTCCATCACCACAGGAACTGTCTCCACTGTCAA GAACGGATTGCC

CACAGATAAACCAGCTGTCACCGAAGATGTAAACATTTACCAGAAATATATTGCCAG GTTCTCAGGAAGTCAGCACTGCGGTCACATCCACTGCGCCTA

CCAGTACCGTGAGCACTATCACTGCCTGGACCCGGAGTGCAACTACCAG - UNI1351 - CGGTTCACAAGCAAGCAGGATGTGATCCGACATTACAA

CATGCACAAGAAGCGCGACAACTCCCTGCAGCACGGCTTCATGCGCTTCAGCCCGCTGGACGACTGCAGTGTCTACTACCACGGCTGCCACCTCAATGGG

AAGAGCACCCACTACCACTGCATGCAG - UNI1351 - GTGGGATGTAACAAGGTATACACAAGTACGTCGGATGTGATGACTCACGAGAACTTCCAC

AAGAAGAACACCCAGCTCATCAACGATGGCTTCCAGCGCTTCCGAGCCACGGAGGACTGCGGCACAGCTGACTGTCAGTTCTATGGACAGAAGACCACAC

ACTTCCACTGCAG GCGCCCTGGCTGCACATTCACCTTCAAGAACAAGTGTGACATCGAGAAGCACAAGAGCTACCACATCAAGGATGATGCCTACGCCA

AGGACGGCTTCAAGAAGTTCTACAAGTACGAGGAGTGCAAATACGAGGGCTGCATGTACAGCAAGGCCACCAACCATTTCCACTGCATCCGCGCCGGCTG

CGGCTTCACCTTCACCTCCACCAGCCAGATGACCTCACACAAGCGCAAGCACGAGCGGCGGCACATCCGGTCCTCGGGGGCCCTGGGGCTGCCGGCCTCC

CTGCTGGGCGCCAAGGACACGGAGCACGAGGAATCCAGCAACGATGACCTCGTGGACTTCTCTGCCCTGAGCAGCAAGAACTCCAGCCTGAGCGCCTCCC

CCACCAGCCAGCAATCGTCCGCATCCCTGGCCGCTGCGGCTGCCGCCACCACTGCTGAGGCCATCCCCAGTGCCACCAAGCCTCCCAATAGCAAGATGGC

AGGCCTGCTGCCCCAGGGCCTGTCTGGTTCCATCCCCTTAGCACTGGCCCTCTCTAACTCAGGCCTGCCCACCACCACACCCTATTTCCCTCTGCTTCCT

AACCGTGGGAGCGCCTCATTGCCTGTGGGATCTCCAGGGCTCCTGGGCTCCATGTCCTCTGGGGCCACAACCTCAGCAACCCCTGACATGCCGGCCCTGA

TGGCTTCCAGAGCTGGAGACTCGGCCCCCACGGCTGCCACCTCTCTCTCGGTGCCCCCTGCCTCCATCATTGAGAGAATCTCTGCAAGCAAAGGCCTCAT

CTCACCCATGATGGCTAGACTGGCTGCGGCCGCCCTCAAGCCCTCTGCCACCTTTGACCCAG GAAGTGGGCAGCAGCCCACCCCCACCAAGTTCCCCCA

GGCCCAGGTGAAGCAGGAGCCTGACAGTGCTGGCACCCCAGGTCCCCACGAGGCCTCCCAAGACCGCAGTCTAGACCTGACCGTGAAGGATCCCAG TAA

TGAATCAAATGGCCACGCAGTCTCGGCAAATTCATCTCTTTTATCCTCGCTTATGAATAAG ATGTCTCAGGGCAACCCCAGCCTCGAAAGCTTCCTGAG

CATCAAGACAGAAGCGGAGGGGAGCCCCGCCGGGGAGCCCTCGCCTTTCTTGGGCAAGGCCGTGAAGGCACTAGTTCAAGAGAAGCTGTCAGAGCCTTGG

AAGGTGTATCTCCGCAG GTTTGGTACCAAGGACTTCTGTGATGCCCAGTGTGACTTCCTCCACAAGGCGCATTTCCATTGTGTAGTGGAGGAGTGCGGT

GCGCTTTTCAGCACCTTGGACGGAGCCATCAAACATGCAAA CTTCCACTTCCGGACAGAGGGAGGAACAGCAAAAGGAACCCCAGAGGCTTCCTTCCCG

ACCTCTGCTGCTGAGACCAAACCTCCCTTGGCACCCTCGTCCCTGCCAGCACCTCCTGGCACCATGGTCGCTGGATCTTCTCTGGAGGGGCCTGCTCCCA

GCCCGGTCTCTGTGCCCTCCACCCCCACCCTGCTCGCCTGGAAGCAGCTGGCTTCCACCATACCCCAGATGCCTCAGATTCCCTCCTCAGTGCCTCACCT

GCCCACCTCGCCCCTGGCGACGACGTCTCTAGAGAGCGCCAAGCCTCAGGTCAAACCCGGGTTCCTCCAGTTCCAGGACAA CGATCCATGCCTGGCGAC

GGACTGCAAATACGCCAGCAAGTTCCACTTCCACTGTCTCTTCGGGAACTGCAAGTACGTCTGCAAGACCTCGGGCAAGGCTGAGTCCCACTGCTTGGAC

CACATCAACCCCAGCAACAGCCTGGTGAACGTGCGAGACCAGTTTGCTTACTACTCTCTACAGTGCCTGTGTCCCAACCAG CACTGTGAGTTCCGGATG

CGTGGACACTACCACTGCCTCCGGACGGGCTGCTACTTTGTCACCAACATCACCACCAAACTTCCATGGCATATAAAGAAGCATGAGAAGGCTGAACGAC

GGGCAGCCAACGGGTTCAAATACTTCACCAAGCGCGAGGAGTGCGGAAGACTAG GCTGCAAGTACAACCAGGTGAACAGCCACTTCCACTGCATCCGGG

AAGGTTGTCAGTTCTCCTTTCTCCTCAAGCACCAGATGACCTCGCATGCCCGGAAGCACATGCGGAGGATGCTGGGGAAGAACTTTGACCGAGTGCCCCC

ATCCCAG GGTCCCCCGAGCCTAATGGATGCCGAGACAGACGAGGGCATGGACTATACAGGCTGTAGCCCTGGAGCGGCGTCCTCAGAGTCTTCCACCAT

GGACCGTAGCTGTTCCAGCACCCCTGTGGGCAATGAGAGCACAGCTGCAG GGAACACCATCTCCATGCCGACAGCCTCGGGGGCCAAAAAGCGCTTTTG

GATCATCGAGGACATGTCTCCCTTTGGCAAGCGAAGGAAGACAGCCTCGTCTCGGAAGATGCTGGACGAGGGCATGATGCTGGAGGGTTTCCGGCGCTTT

GACCTCTATGAGGACTGCAAGGATACAGCCTGCCAGTTCTCACTCAAGGTCACCCACTACCACTGCACGCGGGAAAACTGCGGCTACAAGTTTTGCGGAC

GCACGCACATGTACAAGCACGCACAGCACCACGACCGCGTGGACAACCTGGTGCTGGACGACTTCAAGCGCTTCAAGGCCTCCCTCAGCTGCCACTTCGC

CGACTGCCCGTTCTCGGGCACCAGCACGCACTTCCACTGCCTGCGCTGCCGCTTCCGTTGCACAGACAGCACCAAGGTCACTGCGCACCGCAAGCACCAC

GGCAAGCAGGACGTGATCAGCGCCGCTGGCTTCTGCCAGTTCAGCTCGAGCGCCGACTGCGCAGTGCCCGACTGCAAGTACAAGCTCAAGTGCTCGCACT

TCCACTGCACCTATCCGGGCTGTCGCCACACAGTGGTGGGCATGTCGCAGATGGACTCGCACAAGCGCAAGCACGAGAAGCAGGAGCGAGGGGAGCCTCC

CGCAGCCTCTCCGGGTGCGCCTGTCAACCTGGACGGCTCCCTCACGCTGGCCGCCGAGCAGGGCTCGCTGCTCTTCCTGCAGACAGCGGCTGCGGGCCTA

GGCCTGCTCGGGGACACGGGGGACCCCGGCCCACCTGTCACCGCCTCCGGGACTCGGGACGGCCCCGCTGCGCCCACCCCCGCTGCCGCCGCCACCACCA

CCACCACCACCACAGCCACAGCCACAGCCACCGCTGGGGAGTCCTCCCAAGAGGACGACGAGGAGCTGGAGCTGCCGGAGGAGGAGGCCGAGGACGACGA

CGAGGATGACGATGAAGAGGACGACGACGACGAGGATGATGATGATGATGACGACGACGAGGACCTGCGCACCGACTCGGAGGAGTCGTTGCCCGAGGCT

GCGGGCGAGGCGGGCGCGCGGACCCCGCTGGCAGCCCTGGGTGGCCCCGGCCCTGCGCCCACCGCCGCATCACCCTAG
Translation
 - UNI17447 -  - UNI20147 -  - UNI31806 -  - UNI6535 - - UNI29935 -  - UNI6535 - - UNI36095 -    - U

NI1351 -  - UNI1351 -     MSQGNPSLESFLSIKTEAEGSPAGEPSPFLGKAVKALVQEKLSEPWKVYLRR RFGTKDFCDAQCDFLHKAHFH

CVVEECGALFSTLDGAIKHAN NFHFRTEGGTAKGTPEASFPTSAAETKPPLAPSSLPAPPGTMVAGSSLEGPAPSPVSVPSTPTLLAWKQLASTIPQMP

QIPSSVPHLPTSPLATTSLESAKPQVKPGFLQFQDN NDPCLATDCKYASKFHFHCLFGNCKYVCKTSGKAESHCLDHINPSNSLVNVRDQFAYYSLQCL

CPNQ HCEFRMRGHYHCLRTGCYFVTNITTKLPWHIKKHEKAERRAANGFKYFTKREECGRLG GCKYNQVNSHFHCIREGCQFSFLLKHQMTSHARKHM

RRMLGKNFDRVPPSQ GPPSLMDAETDEGMDYTGCSPGAASSESSTMDRSCSSTPVGNESTAAG GNTISMPTASGAKKRFWIIEDMSPFGKRRKTASSR

KMLDEGMMLEGFRRFDLYEDCKDTACQFSLKVTHYHCTRENCGYKFCGRTHMYKHAQHHDRVDNLVLDDFKRFKASLSCHFADCPFSGTSTHFHCLRCRF

RCTDSTKVTAHRKHHGKQDVISAAGFCQFSSSADCAVPDCKYKLKCSHFHCTYPGCRHTVVGMSQMDSHKRKHEKQERGEPPAASPGAPVNLDGSLTLAA

EQGSLLFLQTAAAGLGLLGDTGDPGPPVTASGTRDGPAAPTPAAAATTTTTTTATATATAGESSQEDDEELELPEEEAEDDDEDDDEEDDDDEDDDDDDD

DEDLRTDSEESLPEAAGEAGARTPLAALGGPGPAPTAASP

For any suggestions or comments, please send an email to unitrap@crg.es