Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000029001 (Fbxo44)
Chromosomal location
Chr 4: 147526910 - 147533989 (-)
Description
F-box protein 44 Gene [Source:MGI (curated);Acc:Fbxo44-001]
RefSeq_dna
NM_173401 
RefSeq_peptide
NP_775577.1 
UniGene
Mm.401783 Mm.220327 
MGI
MGI:1354744 
Uniprot/SWISSPROT
Q8BK26 
Uniprot/SPTREMBL
A2A7H6 B2KFV8 A2A7H4 A2A7H5 
Human Ortholog
ENSG00000132879 (FBXO44)
Omim not available
UniTrap UNI22881
Vector Insertion
Chr 4: 147532933 - 147533851
Public Clones not available
Private Clones OST282148 (lexicon) OST40039 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33252
Vector Insertion
Chr 4: 147528530 - 147530391
Public Clones IST11998H3 (tigm) IST13897H11 (tigm) IST12980D9 (tigm) IST12441H6 (tigm)
IST12998E12 (tigm) IST13678E8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 74% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000105705
Sequence
GACAGAAGGAGGGGAGCAGTGAGCGCCCCAGCAAGGAGACGTTTGGCGGGCAGTAGGCAGGTCTGCCTTCCGGGCCACGCAGGCTCGGGCTGTACAGCCC

CACGGCCTGGCAGGATCGCTCAGCGCGACGGATCGCAG - UNI22881 - GAGCTGGCTAGGAGACGCCACCATGGCAGTAGGCAACATCAACGAGCT

GCCAGAGAACATCCTGCTGGAACTGTTCATCCACATCCCAGCTCGCCAACTGCTGCTGCGCTGCCGACCGGTCTGCAGCCTCTGGCGAGACCTCATTGAC

CTGGTTACACTCTGGAAGCGCAAGTGCCTTCAAGAGGGCTTCATCACCGAGGACTGGGACCAGCCTGTGGCTGACTGGAAGATCTTCTACTTCCTGCGCA

GCCTCCAGAGGAACCTCCTTCACAACCCTTGTGCTGAAG AGGGATTTGAGTTCTGGAGCCTGGACGTGAACGGAGGCGATGAATGGAAGGTAGAGGATC

TCTCTAAAGACCAGCGAAAGGAATTCCCCAATGACCAG - UNI33252 - GTTTGCAGCCAGGCCAGACTGCGGGTCCAAGTACCAGCTGTGCGTCCA

ACTCCTGTCGTCAGCCCACGCACCACTGGGAACCTTCCAGCCGGACCCGGTGATGATTCAGCAGAAAAGCGATGCCAAGTGGAGGGAG - UNI33252 

- GTTTCACACACATTCTCCAACTATCCTCCCGGCGTCCGCTACATCTGGTTTCAGCACGGAGGCGTGGACACTCACTACTGGGCCGGCTGGTACGGCCC

GAGAGTCACAAACAGCAGCATCACCATCGGGCCCCCGCTGCCCTGATGCCTCCTGAGCCCCAGTCCTCAGAGCCCTAATTAGTAAACAGTCAGAAAGGGC

CAGGCTTGGGAAGGGGAGGTGGAAACTCCCAGACCTCATTGTTAGCCTTTGCCCCCAGCTGCCTGTGTGTGGAGTTTCTAATGTCTGGGCCACCCTCCTC

TCTAGCTCTCCAGCAAAGCTGCCCCTCTAAGGGTGCAGTGCCTGAGGATAGGCAGATACAACAGGTCTCCATACTTCTCATGCTTGCCTAGACCTGTTTC

TACCCCTGACCTCTCTCCTTGTTCTCCTCAAGGGCCCTGGAGAGCAGGGACAGACAACATATCTGACAGGCTTGGGGACTGCCTTTAATGATGTCATAAG

GCAGATCTAGGATAGAAGGCTCTGCTGGCCAGTCCTTAGCCTGGTGGTCAGCTGCTGTACGCTCTCTGCTTTGGCTTTAAAGTCAGGCCTGGTACCAGAT

AGGCAGGATCAGACTATCTTTGTCATCCTACCAATGAGTGCAGGACTCCCCAGAAGACTCCGGATGAGAGGCCAGATGAGGGGTAGGATGGACCAGGGTT

TTGAGTGGAAGGACCTGGCCAAGTCCTCTGTGGCTTGAAGATGCCCCAGCCCCATCGGTGGGAGCGTCAATTCACACACTACCCCCTTGACCCTAGCACC

ACTCCATCCCTCCTGTTACATAGCCAAATAAAATGTTTCCAGCCTC
Translation
 - UNI22881 - MAVGNINELPENILLELFIHIPARQLLLRCRPVCSLWRDLIDLVTLWKRKCLQEGFITEDWDQPVADWKIFYFLRSLQRNLLHNPC

AEE EGFEFWSLDVNGGDEWKVEDLSKDQRKEFPNDQ - UNI33252 - VCSQARLRVQVPAVRPTPVVSPRTTGNLPAGPGDDSAEKRCQVEGG - 

UNI33252 - GFTHILQLSSRRPLHLVSARRRGHSLLGRLVRPESHKQQHHHRAPAALMPPEPQSSEP
Transcript ENSMUST00000057907
Sequence
GACAGAAGGAGGGGAGCAGTGAGCGCCCCAGCAAGGAGACGTTTGGCGGGCAGTAGGCAGGTCTGCCTTCCGGGCCACGCAGGCTCGGGCTGTACAGCCC

CACGGCCTGGCAGGATCGCTCAGCGCGACGGATCGCAG - UNI22881 - GAGCTGGCTAGGAGACGCCACCATGGCAGTAGGCAACATCAACGAGCT

GCCAGAGAACATCCTGCTGGAACTGTTCATCCACATCCCAGCTCGCCAACTGCTGCTGCGCTGCCGACCGGTCTGCAGCCTCTGGCGAGACCTCATTGAC

CTGGTTACACTCTGGAAGCGCAAGTGCCTTCAAGAGGGCTTCATCACCGAGGACTGGGACCAGCCTGTGGCTGACTGGAAGATCTTCTACTTCCTGCGCA

GCCTCCAGAGGAACCTCCTTCACAACCCTTGTGCTGAAG AGGGATTTGAGTTCTGGAGCCTGGACGTGAACGGAGGCGATGAATGGAAGGTAGAGGATC

TCTCTAAAGACCAGCGAAAGGAATTCCCCAATGACCAGGTCAAGAAATACTTCGTGACTTCCTATTA CACCTGCCTCAAGTCCCAGGTGGTGGACCTCA

AGGCTGAAGGGTATTGGGAGGAGCTGATGGACACCACCCGGCCGGACATCGAGGTCAAGGACTG - UNI33252 - GTTTGCAGCCAGGCCAGACTGC

GGGTCCAAGTACCAGCTGTGCGTCCAACTCCTGTCGTCAGCCCACGCACCACTGGGAACCTTCCAGCCGGACCCGGTGATGATTCAGCAGAAAAGCGATG

CCAAGTGGAGGGAG - UNI33252 - GTTTCACACACATTCTCCAACTATCCTCCCGGCGTCCGCTACATCTGGTTTCAGCACGGAGGCGTGGACACT

CACTACTGGGCCGGCTGGTACGGCCCGAGAGTCACAAACAGCAGCATCACCATCGGGCCCCCGCTGCCCTGATGCCTCCTGAGCCCCAGTCCTCAGAGCC

CTAATTAGTAAACAGTCAGAAAGGGCCAGGCTTGGGAAGGGGAGGTGGAAACTCCCAGACCTCATTGTTAGCCTTTGCCCCCAGCTGCCTGTGTGTGGAG

TTTCTAATGTCTGGGCCACCCTCCTCTCTAGCTCTCCAGCAAAGCTGCCCCTCTAAGGGTGCAGTGCCTGAGGATAGGCAGATACAACAGGTCTCCATAC

TTCTCATGCTTGCCTAGACCTGTTTCTACCCCTGACCTCTCTCCTTGTTCTCCTCAAGGGCCCTGGAGAGCAGGGACAGACAACATATCTGACAGGCTTG

GGGACTGCCTTTAATGATGTCATAAGGCAGATCTAGGATAGAAGGCTCTGCTGGCCAGTCCTTAGCCTGGTGGTCAGCTGCTGTACGCTCTCTGCTTTGG

CTTTAAAGTCAGGCCTGGTACCAGATAGGCAGGATCAGACTATCTTTGTCATCCTACCAATGAGTGCAGGACTCCCCAGAAGACTCCGGATGAGAGGCCA

GATGAGGGGTAGGATGGACCAGGGTTTTGAGTGGAAGGACCTGGCCAAGTCCTCTGTGGCTTGAAGATGCCCCAGCCCCATCGGTGGGAGCGTCAATTCA

CACACTACCCCCTTGACCCTAGCACCACTCCATCCCTCCTGTTACATAGCCAAATAAAATGTTTCCAGCCTC
Translation
 - UNI22881 - MAVGNINELPENILLELFIHIPARQLLLRCRPVCSLWRDLIDLVTLWKRKCLQEGFITEDWDQPVADWKIFYFLRSLQRNLLHNPC

AEE EGFEFWSLDVNGGDEWKVEDLSKDQRKEFPNDQVKKYFVTSYY YTCLKSQVVDLKAEGYWEELMDTTRPDIEVKDW - UNI33252 - WFAAR

PDCGSKYQLCVQLLSSAHAPLGTFQPDPVMIQQKSDAKWRE - UNI33252 - VSHTFSNYPPGVRYIWFQHGGVDTHYWAGWYGPRVTNSSITIGPP

LP
Transcript ENSMUST00000105704
Sequence
GACAGAAGGAGGGGAGCAGTGAGCGCCCCAGCAAGGAGACGTTTGGCGGGCAGTAGGCAGGTCTGCCTTCCGGGCCACGCAGGCTCGGGCTGTACAGCCC

CACGGCCTGGCAGGATCGCTCAGCGCGACGGATCGCAG - UNI22881 - GAGCTGGCTAGGAGACGCCACCATGGCAGTAGGCAACATCAACGAGCT

GCCAGAGAACATCCTGCTGGAACTGTTCATCCACATCCCAGCTCGCCAACTGCTGCTGCGCTGCCGACCGGTCTGCAGCCTCTGGCGAGACCTCATTGAC

CTGGTTACACTCTGGAAGCGCAAGTGCCTTCAAGAGGGCTTCATCACCGAGGACTGGGACCAGCCTGTGGCTGACTGGAAGATCTTCTACTTCCTGCGCA

GCCTCCAGAGGAACCTCCTTCACAACCCTTGTGCTGAAG AGGGATTTGAGTTCTGGAGCCTGGACGTGAACGGAGGCGATGAATGGAAGGTAGAGGATC

TCTCTAAAGACCAGCGAAAGGAATTCCCCAATGACCAGGTCAAGAAATACTTCGTGACTTCCTATTA CACCTGCCTCAAGTCCCAGGTGGTGGACCTCA

AGGCTGAAGGGTATTGGGAGGAGCTGATGGACACCACCCGGCCGGACATCGAGGTCAAGGACTG - UNI33252 - GTTTGCAGCCAGGCCAGACTGC

GGGTCCAAGTACCAGCTGTGCGTCCAACTCCTGTCGTCAGCCCACGCACCACTGGGAACCTTCCAGCCGGACCCGGTGATGATTCAGCAGAAAAGCGATG

CCAAGTGGAGGGAG - UNI33252 - GGTCTCATGTAG
Translation
 - UNI22881 - MAVGNINELPENILLELFIHIPARQLLLRCRPVCSLWRDLIDLVTLWKRKCLQEGFITEDWDQPVADWKIFYFLRSLQRNLLHNPC

AEE EGFEFWSLDVNGGDEWKVEDLSKDQRKEFPNDQVKKYFVTSYY YTCLKSQVVDLKAEGYWEELMDTTRPDIEVKDW - UNI33252 - WFAAR

PDCGSKYQLCVQLLSSAHAPLGTFQPDPVMIQQKSDAKWRE - UNI33252 - GLM

For any suggestions or comments, please send an email to unitrap@crg.es