Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000029016 (Clcn6)
Chromosomal location
Chr 4: 147380243 - 147412922 (-)
Description
chloride channel 6 Gene [Source:MGI (curated);Acc:Clcn6-001]
RefSeq_dna
NM_011929 
RefSeq_peptide
NP_036059.1 
UniGene
Mm.89987 
MGI
MGI:1347049 
Uniprot/SWISSPROT
O35454 
Uniprot/SPTREMBL
A2A7F6 Q8CIW8 Q8CJB1 Q3UM91 Q5DU51 
Human Ortholog
ENSG00000011021 (CLCN6)
Omim not available
UniTrap UNI26652
Vector Insertion
Chr 4: 147412083 - 147412789
Public Clones not available
Private Clones OST105612 (lexicon)
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1052
Vector Insertion
Chr 4: 147403562 - 147412022
Public Clones (sanger) AY0209 (sanger) E003G07 (ggtc) 5SE306G10 (ggtc) 3SE306G10 (ggtc)
IST13068F1 (tigm) IST11886A3 (tigm)
Private Clones OST468734 (lexicon) OST455452 (lexicon) OST345228 (lexicon) OST289106 (lexicon)
OST271274 (lexicon) OST258010 (lexicon) OST251852 (lexicon) OST250836 (lexicon)
OST193258 (lexicon) OST146108 (lexicon)
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24537
Vector Insertion
Chr 4: 147402725 - 147403495
Public Clones not available
Private Clones OST216138 (lexicon)
Severity of mutation (?) Insertion after 8% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11651
Vector Insertion
Chr 4: 147400709 - 147402658
Public Clones P077F10 (ggtc)
Private Clones OST132630 (lexicon)
Severity of mutation (?) Insertion after 11% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000105711
Sequence
GAGGGGGGTTGGCCTAGGTGGTCCGGAGCGGCAGCAAAGGAGGAAGATGGCGGGGTGCAGGGGGTCCGTGTGCTGCTGCTGCCGGTGGTGTTGCTGCTGC

GGTGAACGGGAGAGCCGCACCCCCGAGGAGCTG - UNI26652 - ACCATCCTTGGGGAGACACAGGAAGAAGAGGATGAGATTCTTCCAAGGAAAGA

CTATGAG - UNI1052 - AGTCTGGACTATGACCGCTGCATCAATGACCCTTACCTGGAGGTGTTGGAGACCATGGATAATAAG - UNI24537 - 

AAAGGGCGAAGATACGAGGCGGTGAAGTGGATGGTGGTGTTCGCCATTGGCGTCTGTACGGGGCTG - UNI11651 - GTGGGTCTCTTTGTGGACTT

TTCCGTGCGACTCTTCACCCAACTGAAGTTCGGAGTGGTTCAAACGT CCTCTGCAGCGGTGGAGGAATGCAGTCAGAAGGGCTGCCTTGCCCTGTCCCT

CCTGGAGCTCCTGGGCTTTAACTTGACCTTTGTCTTCCTGGCAAGCCTTCTTGTCTTGATAGAG CCAGTGGCAGCAGGTTCTGGAATCCCCGAGATCAA

GTGCTACCTGAATGGTGTGAAAGTGCCAGGAATTGTCCGGCTCCGGACCCTGCTCTGCAAAGTCTTTGGGGTGCTGTTCAGTGTGTCTGGAG GGCTCTT

TGTGGGGAAAGAAGGCCCCATGATCCACAGTGGTGCTGTGGTAGGAGCTGGCCTCCCTCAG TTCCAGAGCATCTCCTTACGGAAGATCCAGTTTAACTT

CCCCTACTTCCGCAGCGACAG AGACAAGCGTGACTTTGTGTCAGCGGGGGCAGCTGCTGGCGTTGCTGCAGCTTTTGGGGCCCCTATAGGGGGCACCTT

GTTCAGTCTGGAGGAGGGTTCATCCTTCTGGAACCAGGGGCTCACGTGGAAAGTG CTCTTCTGTTCCATGTCCGCCACCTTCACCCTCAACTTCTTCCG

CTCTGGGATTCAGTTTGGAAGTTGGGGTTCCTTCCAGCTGCCTGGATTGCTGAACTTTGGTGAATTTAAG TGCTCTGACTCTGATAAAAAATGTCATCT

CTGGACAGCTATGGATTTGGGTTTCTTCGTCGTGATGGGGGTCATTGGGGGCCTCCTGGGAGCCACATTCAACTGTCTGAACAAGAGGCTTGCAAAGTAC

CGTATGCGCAACGTGCACCCGAAACCTAAGCTCGTCAG AGTCTTAGAGAGCCTCTTGGTGTCCCTGGTGACCACTGTGGTGGTGTTTGTGGCCTCCATG

GTGTTAGGAGAATGCCGACAGATGTCTTCCACGAGTCAAACCGGTAATGGCTCATTCCAGCTCCAG GTCACATCAGAAGATGTGAATTCAACTATCAAG

GCTTTTTTCTGTCCCAATGACACTTACAATGACATGGCCACACTCTTCTTCAACTCCCAGGAGTCTGCCATCCTGCAGCTCTTCCATCAGGATG GGACT

TTCAGCCCCGTCACCCTGGCCTTATTCTTCATCCTCTATTTCCTGCTCGCATGCTGGACTTTTGGCACATCTGTCCCCAGTGGCCTCTTCGTGCCTTCCC

TGCTGTGTGGAGCAGCTTTTGGACGTTTAGTTGCCAATGTCCTGAAAAG CTACATTGGACTGGGCCACCTCTATTCTGGGACCTTTGCCCTGATTGGTG

CGGCAGCTTTCTTGGGTGGGGTTGTAAGGATGACCATCAGCCTCACAGTCATCCTGATCGAGTCTACAAATGAGATCACCTATGGGCTTCCGATCATGGT

CACTCTGATG GTGGCCAAGTGGACTGGAGACTTGTTCAACAAGGGCATTTATGACGTCCATATTGGGCTGAGAGGTGTGCCTCTTCTGGAGTGGGAGAC

AGACGTGGAAATGGACAA GCTGAGAGCCAGTGACATCATGGAGCCCAACCTGACGTACGTCTACCCGCACACTCGCATCCAGTCTCTGGTGAGCATCCT

GCGCACTACGGTCCACCATGCCTTCCCAGTGGTCACGGAGAACCGGGGCAACGAGAAGGAGTTCATGAAGGGCAACCAGCTCATAAGCAACAACATCAAG

TTCAAG AAATCCAGTATCCTGACCCGTGCTGGTGAGCAGCGCAAGCGGGGCCAGTCCATGAAGTCGTACCCTTCCAGCGAGCTGCGCAACGTGTGTGAT

GAGCATGTGGCTTCTGAGGAGCCGGCAGAGAAGGAGGACCTGCTACAGCAGATGCTGGAGAGGAG ATACACTCCCTACCCCAACCTATACCCTGACCAG

TCCCCGAGTGAAGACTGGACCATGGAGGAGCGTTTCCGTCCGCTGACCTTTCACGGCCTTGTCCTGCGCTCTCAGCTTGTCACCCTGCTTGTCCGAGGAG

TGTGCTATTCGGAAAGTCAGTCC AGTGCCAGCCAACCACGTCTTTCTTACGCTGAGATGGCTGAGGACTACCCGCGATACCCGGACATACATGACCTGG

ACCTCACACTGCTGAATCCCCGAATGATTGTG GATGTCACCCCATATATGAATCCTTCACCATTTACCGTCTCCCCCAACACCCATGTTTCTCAAGTGT

TCAACCTGTTCAGAACCATGGGCCTGCGCCACTTGCCTGTGGTGAATGCAGTAGGAGAG ATCGTGGGGATCATTACACGGCACAACCTGACAAATGAAT

TCCTGCAGGCCCGGCTGCGGCAGCATTACCAGACCCTCTGACAGTTGCACCCGGCTGAAGCCAGCCCACTCTCCCAGAGGTGCCTCTGCAGGTGGCCCGC

TCACTTACTGGCCCCCACAGCCGGCATGAAGGCTCCCACTCACCCGTTTGCTCAGATGCCTGGAGTCCTGGAAGATGGGGGTCAGAAGTTTTTGGGGATG

TGTTGAGTAGGAAGTTGGGGTTTTACTAACTTCCTCTGTAAGAATCTTCCATTCCCCAGCTCCCCTAAGGAGACGTCAGGGTGCCGTCGGGCTGGATCCT

AGGTGGACACTTGGTACCTCTCTGTTGCTGTTTCTTGGAGAGCCCAGCTCTTGCCCAGACCCTCCCGGGAAGGTGTTGGACTGAGGCAAACATTGAGGAT

GTTATTTGCATATCATGTTCATTACTAGGTTCAAGAATTGGGCACTAAGAACTGTTCCCCATGTTTGGGGAGGCCTGGGATCAGAACCAAGACTTCAGAT

ACATTCTGCCTCTTCATTGGCCCAACTTTCTTCTCCTTCTGTTTCCTAGGAGCGGGTTCATGCTCTGACCCCGTGGCTTGAATGTCTTTAGACTCATTCC

TGACCAGATCCTTGATGCACTAAAATTCCAGCTAACAGCCTTTGAAGCATTAAATCCCACCACAGGGGGACAGCTTCTCCCTTCTGTG
Translation
MAGCRGSVCCCCRWCCCCGERESRTPEEL - UNI26652 - TILGETQEEEDEILPRKDYE - UNI1052 - SLDYDRCINDPYLEVLETMDNK -

 UNI24537 - KGRRYEAVKWMVVFAIGVCTGL - UNI11651 - VGLFVDFSVRLFTQLKFGVVQTS SSAAVEECSQKGCLALSLLELLGFNLTF

VFLASLLVLIE PVAAGSGIPEIKCYLNGVKVPGIVRLRTLLCKVFGVLFSVSGG GLFVGKEGPMIHSGAVVGAGLPQ FQSISLRKIQFNFPYFRSDR

 RDKRDFVSAGAAAGVAAAFGAPIGGTLFSLEEGSSFWNQGLTWKV LFCSMSATFTLNFFRSGIQFGSWGSFQLPGLLNFGEFK CSDSDKKCHLWTAM

DLGFFVVMGVIGGLLGATFNCLNKRLAKYRMRNVHPKPKLVR RVLESLLVSLVTTVVVFVASMVLGECRQMSSTSQTGNGSFQLQ VTSEDVNSTIKAF

FCPNDTYNDMATLFFNSQESAILQLFHQDG GTFSPVTLALFFILYFLLACWTFGTSVPSGLFVPSLLCGAAFGRLVANVLKS SYIGLGHLYSGTFALI

GAAAFLGGVVRMTISLTVILIESTNEITYGLPIMVTLM VAKWTGDLFNKGIYDVHIGLRGVPLLEWETDVEMDK KLRASDIMEPNLTYVYPHTRIQSL

VSILRTTVHHAFPVVTENRGNEKEFMKGNQLISNNIKFK KSSILTRAGEQRKRGQSMKSYPSSELRNVCDEHVASEEPAEKEDLLQQMLERR RYTPYP

NLYPDQSPSEDWTMEERFRPLTFHGLVLRSQLVTLLVRGVCYSESQS SASQPRLSYAEMAEDYPRYPDIHDLDLTLLNPRMIV DVTPYMNPSPFTVSP

NTHVSQVFNLFRTMGLRHLPVVNAVGE IVGIITRHNLTNEFLQARLRQHYQTL
Transcript ENSMUST00000030879
Sequence
GAGGGGGGTTGGCCTAGGTGGTCCGGAGCGGCAGCAAAGGAGGAAGATGGCGGGGTGCAGGGGGTCCGTGTGCTGCTGCTGCCGGTGGTGTTGCTGCTGC

GGTGAACGGGAGAGCCGCACCCCCGAGGAGCTG - UNI26652 - ACCATCCTTGGGGAGACACAGGAAGAAGAGGATGAGATTCTTCCAAGGAAAGA

CTATGAG - UNI1052 - AGTCTGGACTATGACCGCTGCATCAATGACCCTTACCTGGAGGTGTTGGAGACCATGGATAATAAG - UNI24537 - 

AAAGGGCGAAGATACGAGGCGGTGAAGTGGATGGTGGTGTTCGCCATTGGCGTCTGTACGGGGCTG - UNI11651 - GTGGGTCTCTTTGTGGACTT

TTCCGTGCGACTCTTCACCCAACTGAAGTTCGGAGTGGTTCAAACGT CGGTGGAGGAATGCAGTCAGAAGGGCTGCCTTGCCCTGTCCCTCCTGGAGCT

CCTGGGCTTTAACTTGACCTTTGTCTTCCTGGCAAGCCTTCTTGTCTTGATAGAG CCAGTGGCAGCAGGTTCTGGAATCCCCGAGATCAAGTGCTACCT

GAATGGTGTGAAAGTGCCAGGAATTGTCCGGCTCCGGACCCTGCTCTGCAAAGTCTTTGGGGTGCTGTTCAGTGTGTCTGGAG GGCTCTTTGTGGGGAA

AGAAGGCCCCATGATCCACAGTGGTGCTGTGGTAGGAGCTGGCCTCCCTCAG TTCCAGAGCATCTCCTTACGGAAGATCCAGTTTAACTTCCCCTACTT

CCGCAGCGACAG AGACAAGCGTGACTTTGTGTCAGCGGGGGCAGCTGCTGGCGTTGCTGCAGCTTTTGGGGCCCCTATAGGGGGCACCTTGTTCAGTCT

GGAGGAGGGTTCATCCTTCTGGAACCAGGGGCTCACGTGGAAAGTG CTCTTCTGTTCCATGTCCGCCACCTTCACCCTCAACTTCTTCCGCTCTGGGAT

TCAGTTTGGAAGTTGGGGTTCCTTCCAGCTGCCTGGATTGCTGAACTTTGGTGAATTTAAG TGCTCTGACTCTGATAAAAAATGTCATCTCTGGACAGC

TATGGATTTGGGTTTCTTCGTCGTGATGGGGGTCATTGGGGGCCTCCTGGGAGCCACATTCAACTGTCTGAACAAGAGGCTTGCAAAGTACCGTATGCGC

AACGTGCACCCGAAACCTAAGCTCGTCAG AGTCTTAGAGAGCCTCTTGGTGTCCCTGGTGACCACTGTGGTGGTGTTTGTGGCCTCCATGGTGTTAGGA

GAATGCCGACAGATGTCTTCCACGAGTCAAACCGGTAATGGCTCATTCCAGCTCCAG GTCACATCAGAAGATGTGAATTCAACTATCAAGGCTTTTTTC

TGTCCCAATGACACTTACAATGACATGGCCACACTCTTCTTCAACTCCCAGGAGTCTGCCATCCTGCAGCTCTTCCATCAGGATG GGACTTTCAGCCCC

GTCACCCTGGCCTTATTCTTCATCCTCTATTTCCTGCTCGCATGCTGGACTTTTGGCACATCTGTCCCCAGTGGCCTCTTCGTGCCTTCCCTGCTGTGTG

GAGCAGCTTTTGGACGTTTAGTTGCCAATGTCCTGAAAAG CTACATTGGACTGGGCCACCTCTATTCTGGGACCTTTGCCCTGATTGGTGCGGCAGCTT

TCTTGGGTGGGGTTGTAAGGATGACCATCAGCCTCACAGTCATCCTGATCGAGTCTACAAATGAGATCACCTATGGGCTTCCGATCATGGTCACTCTGAT

G GTGGCCAAGTGGACTGGAGACTTGTTCAACAAGGGCATTTATGACGTCCATATTGGGCTGAGAGGTGTGCCTCTTCTGGAGTGGGAGACAGACGTGGA

AATGGACAA GCTGAGAGCCAGTGACATCATGGAGCCCAACCTGACGTACGTCTACCCGCACACTCGCATCCAGTCTCTGGTGAGCATCCTGCGCACTAC

GGTCCACCATGCCTTCCCAGTGGTCACGGAGAACCGGGGCAACGAGAAGGAGTTCATGAAGGGCAACCAGCTCATAAGCAACAACATCAAGTTCAAG AA

ATCCAGTATCCTGACCCGTGCTGGTGAGCAGCGCAAGCGGGGCCAGTCCATGAAGTCGTACCCTTCCAGCGAGCTGCGCAACGTGTGTGATGAGCATGTG

GCTTCTGAGGAGCCGGCAGAGAAGGAGGACCTGCTACAGCAGATGCTGGAGAGGAG ATACACTCCCTACCCCAACCTATACCCTGACCAGTCCCCGAGT

GAAGACTGGACCATGGAGGAGCGTTTCCGTCCGCTGACCTTTCACGGCCTTGTCCTGCGCTCTCAGCTTGTCACCCTGCTTGTCCGAGGAGTGTGCTATT

CGGAAAGTCAGTCC AGTGCCAGCCAACCACGTCTTTCTTACGCTGAGATGGCTGAGGACTACCCGCGATACCCGGACATACATGACCTGGACCTCACAC

TGCTGAATCCCCGAATGATTGTG GATGTCACCCCATATATGAATCCTTCACCATTTACCGTCTCCCCCAACACCCATGTTTCTCAAGTGTTCAACCTGT

TCAGAACCATGGGCCTGCGCCACTTGCCTGTGGTGAATGCAGTAGGAGAG ATCGTGGGGATCATTACACGGCACAACCTGACAAATGAATTCCTGCAGG

CCCGGCTGCGGCAGCATTACCAGACCCTCTGACAGTTGCACCCGGCTGAAGCCAGCCCACTCTCCCAGAGGTGCCTCTGCAGGTGGCCCGCTCACTTACT

GGCCCCCACAGCCGGCATGAAGGCTCCCACTCACCCGTTTGCTCAGATGCCTGGAGTCCTGGAAGATGGGGGTCAGAAGTTTTTGGGGATGTGTTGAGTA

GGAAGTTGGGGTTTTACTAACTTCCTCTGTAAGAATCTTCCATTCCCCAGCTCCCCTAAGGAGACGTCAGGGTGCCGTCGGGCTGGATCCTAGGTGGACA

CTTGGTACCTCTCTGTTGCTGTTTCTTGGAGAGCCCAGCTCTTGCCCAGACCCTCCCGGGAAGGTGTTGGACTGAGGCAAACATTGAGGATGTTATTTGC

ATATCATGTTCATTACTAGGTTCAAGAATTGGGCACTAAGAACTGTTCCCCATGTTTGGGGAGGCCTGGGATCAGAACCAAGACTTCAGATACATTCTGC

CTCTTCATTGGCCCAACTTTCTTCTCCTTCTGTTTCCTAGGAGCGGGTTCATGCTCTGACCCCGTGGCTTGAATGTCTTTAGACTCATTCCTGACCAGAT

CCTTGATGCACTAAAATTCCAGCTAACAGCCTTTGAAGCATTAAATCCCACCACAGGGGGACAGCTTCTCCCTTCTGTG
Translation
MAGCRGSVCCCCRWCCCCGERESRTPEEL - UNI26652 - TILGETQEEEDEILPRKDYE - UNI1052 - SLDYDRCINDPYLEVLETMDNK -

 UNI24537 - KGRRYEAVKWMVVFAIGVCTGL - UNI11651 - VGLFVDFSVRLFTQLKFGVVQTS SVEECSQKGCLALSLLELLGFNLTFVFL

ASLLVLIE PVAAGSGIPEIKCYLNGVKVPGIVRLRTLLCKVFGVLFSVSGG GLFVGKEGPMIHSGAVVGAGLPQ FQSISLRKIQFNFPYFRSDR RD

KRDFVSAGAAAGVAAAFGAPIGGTLFSLEEGSSFWNQGLTWKV LFCSMSATFTLNFFRSGIQFGSWGSFQLPGLLNFGEFK CSDSDKKCHLWTAMDLG

FFVVMGVIGGLLGATFNCLNKRLAKYRMRNVHPKPKLVR RVLESLLVSLVTTVVVFVASMVLGECRQMSSTSQTGNGSFQLQ VTSEDVNSTIKAFFCP

NDTYNDMATLFFNSQESAILQLFHQDG GTFSPVTLALFFILYFLLACWTFGTSVPSGLFVPSLLCGAAFGRLVANVLKS SYIGLGHLYSGTFALIGAA

AFLGGVVRMTISLTVILIESTNEITYGLPIMVTLM VAKWTGDLFNKGIYDVHIGLRGVPLLEWETDVEMDK KLRASDIMEPNLTYVYPHTRIQSLVSI

LRTTVHHAFPVVTENRGNEKEFMKGNQLISNNIKFK KSSILTRAGEQRKRGQSMKSYPSSELRNVCDEHVASEEPAEKEDLLQQMLERR RYTPYPNLY

PDQSPSEDWTMEERFRPLTFHGLVLRSQLVTLLVRGVCYSESQS SASQPRLSYAEMAEDYPRYPDIHDLDLTLLNPRMIV DVTPYMNPSPFTVSPNTH

VSQVFNLFRTMGLRHLPVVNAVGE IVGIITRHNLTNEFLQARLRQHYQTL
Transcript ENSMUST00000094479
Sequence
GAGGGGGGTTGGCCTAGGTGGTCCGGAGCGGCAGCAAAGGAGGAAGATGGCGGGGTGCAGGGGGTCCGTGTGCTGCTGCTGCCGGTGGTGTTGCTGCTGC

GGTGAACGGGAGAGCCGCACCCCCGAGGAGCTG - UNI26652 - ACCATCCTTGGGGAGACACAGGAAGAAGAGGATGAGATTCTTCCAAGGAAAGA

CTATGAG - UNI1052 - AGTCTGGACTATGACCGCTGCATCAATGACCCTTACCTGGAGGTGTTGGAGACCATGGATAATAAG - UNI24537 - 

AAAGGGCGAAGATACGAGGCGGTGAAGTGGATGGTGGTGTTCGCCATTGGCGTCTGTACGGGGCTG - UNI11651 - GTGGGTCTCTTTGTGGACTT

TTCCGTGCGACTCTTCACCCAACTGAAGTTCGGAGTGGTTCAAACGT CGGTGGAGGAATGCAGTCAGAAGGGCTGCCTTGCCCTGTCCCTCCTGGAGCT

CCTGGGCTTTAACTTGACCTTTGTCTTCCTGGCAAGCCTTCTTGTCTTGATAGAG CCAGTGGCAGCAGGTTCTGGAATCCCCGAGATCAAGTGCTACCT

GAATGGTGTGAAAGTGCCAGGAATTGTCCGGCTCCGGACCCTGCTCTGCAAAGTCTTTGGGGTGCTGTTCAGTGTGTCTGGAG GGCTCTTTGTGGGGAA

AGAAGGCCCCATGATCCACAGTGGTGCTGTGGTAGGAGCTGGCCTCCCTCAG TTCCAGAGCATCTCCTTACGGAAGATCCAGTTTAACTTCCCCTACTT

CCGCAGCGACAG AGACAAGCGTGACTTTGTGTCAGCGGGGGCAGCTGCTGGCGTTGCTGCAGCTTTTGGGGCCCCTATAGGGGGCACCTTGTTCAGTCT

GGAGGAGGGTTCATCCTTCTGGAACCAGGGGCTCACGTGGAAAGTG CTCTTCTGTTCCATGTCCGCCACCTTCACCCTCAACTTCTTCCGCTCTGGGAT

TCAGTTTGGAAGTTGGGGTTCCTTCCAGCTGCCTGGATTGCTGAACTTTG GAGTCTTAGAGAGCCTCTTGGTGTCCCTGGTGACCACTGTGGTGGTGTT

TGTGGCCTCCATGGTGTTAGGAGAATGCCGACAGATGTCTTCCACGAGTCAAACCGGTAATGGCTCATTCCAGCTCCAG GTCACATCAGAAGATGTGAA

TTCAACTATCAAGGCTTTTTTCTGTCCCAATGACACTTACAATGACATGGCCACACTCTTCTTCAACTCCCAGGAGTCTGCCATCCTGCAGCTCTTCCAT

CAGGATG GGACTTTCAGCCCCGTCACCCTGGCCTTATTCTTCATCCTCTATTTCCTGCTCGCATGCTGGACTTTTGGCACATCTGTCCCCAGTGGCCTC

TTCGTGCCTTCCCTGCTGTGTGGAGCAGCTTTTGGACGTTTAGTTGCCAATGTCCTGAAAAG CTACATTGGACTGGGCCACCTCTATTCTGGGACCTTT

GCCCTGATTGGTGCGGCAGCTTTCTTGGGTGGGGTTGTAAGGATGACCATCAGCCTCACAGTCATCCTGATCGAGTCTACAAATGAGATCACCTATGGGC

TTCCGATCATGGTCACTCTGATG GTGGCCAAGTGGACTGGAGACTTGTTCAACAAGGGCATTTATGACGTCCATATTGGGCTGAGAGGTGTGCCTCTTC

TGGAGTGGGAGACAGACGTGGAAATGGACAA GCTGAGAGCCAGTGACATCATGGAGCCCAACCTGACGTACGTCTACCCGCACACTCGCATCCAGTCTC

TGGTGAGCATCCTGCGCACTACGGTCCACCATGCCTTCCCAGTGGTCACGGAGAACCGGGGCAACGAGAAGGAGTTCATGAAGGGCAACCAGCTCATAAG

CAACAACATCAAGTTCAAG AAATCCAGTATCCTGACCCGTGCTGGTGAGCAGCGCAAGCGGGGCCAGTCCATGAAGTCGTACCCTTCCAGCGAGCTGCG

CAACGTGTGTGATGAGCATGTGGCTTCTGAGGAGCCGGCAGAGAAGGAGGACCTGCTACAGCAGATGCTGGAGAGGAG ATACACTCCCTACCCCAACCT

ATACCCTGACCAGTCCCCGAGTGAAGACTGGACCATGGAGGAGCGTTTCCGTCCGCTGACCTTTCACGGCCTTGTCCTGCGCTCTCAGCTTGTCACCCTG

CTTGTCCGAGGAGTGTGCTATTCGGAAAGTCAGTCC AGTGCCAGCCAACCACGTCTTTCTTACGCTGAGATGGCTGAGGACTACCCGCGATACCCGGAC

ATACATGACCTGGACCTCACACTGCTGAATCCCCGAATGATTGTG GATGTCACCCCATATATGAATCCTTCACCATTTACCGTCTCCCCCAACACCCAT

GTTTCTCAAGTGTTCAACCTGTTCAGAACCATGGGCCTGCGCCACTTGCCTGTGGTGAATGCAGTAGGAGAG ATCGTGGGGATCATTACACGGCACAAC

CTGACAAATGAATTCCTGCAGGCCCGGCTGCGGCAGCATTACCAGACCCTCTGACAGTTGCACCCGGCTGAAGCCAGCCCACTCTCCCAGAGGTGCCTCT

GCAGGTGGCCCGCTCACTTACTGGCCCCCACAGCCGGCATGAAGGCTCCCACTCACCCGTTTGCTCAGATGCCTGGAGTCCTGGAAGATGGGGGTCAGAA

GTTTTTGGGGATGTGTTGAGTAGGAAGTTGGGGTTTTACTAACTTCCTCTGTAAGAATCTTCCATTCCCCAGCTCCCCTAAGGAGACGTCAGGGTGCCGT

CGGGCTGGATCCTAGGTGGACACTTGGTACCTCTCTGTTGCTGTTTCTTGGAGAGCCCAGCTCTTGCCCAGACCCTCCCGGGAAGGTGTTGGACTGAGGC

AAACATTGAGGATGTTATTTGCATATCATGTTCATTACTAGGTTCAAGAATTGGGCACTAAGAACTGTTCCCCATGTTTGGGGAGGCCTGGGATCAGAAC

CAAGACTTCAGATACATTCTGCCTCTTCATTGGCCCAACTTTCTTCTCCTTCTGTTTCCTAGGAGCGGGTTCATGCTCTGACCCCGTGGCTTGAATGTCT

TTAGACTCATTCCTGACCAGATCCTTGATGCACTAAAATTCCAGCTAACAGCCTTTGAAGCATTAAATCCCACCACAGGGGGACAGCTTCTCCCTTCTGT

G
Translation
MAGCRGSVCCCCRWCCCCGERESRTPEEL - UNI26652 - TILGETQEEEDEILPRKDYE - UNI1052 - SLDYDRCINDPYLEVLETMDNK -

 UNI24537 - KGRRYEAVKWMVVFAIGVCTGL - UNI11651 - VGLFVDFSVRLFTQLKFGVVQTS SVEECSQKGCLALSLLELLGFNLTFVFL

ASLLVLIE PVAAGSGIPEIKCYLNGVKVPGIVRLRTLLCKVFGVLFSVSGG GLFVGKEGPMIHSGAVVGAGLPQ FQSISLRKIQFNFPYFRSDR RD

KRDFVSAGAAAGVAAAFGAPIGGTLFSLEEGSSFWNQGLTWKV LFCSMSATFTLNFFRSGIQFGSWGSFQLPGLLNFG GVLESLLVSLVTTVVVFVAS

MVLGECRQMSSTSQTGNGSFQLQ VTSEDVNSTIKAFFCPNDTYNDMATLFFNSQESAILQLFHQDG GTFSPVTLALFFILYFLLACWTFGTSVPSGLF

VPSLLCGAAFGRLVANVLKS SYIGLGHLYSGTFALIGAAAFLGGVVRMTISLTVILIESTNEITYGLPIMVTLM VAKWTGDLFNKGIYDVHIGLRGVP

LLEWETDVEMDK KLRASDIMEPNLTYVYPHTRIQSLVSILRTTVHHAFPVVTENRGNEKEFMKGNQLISNNIKFK KSSILTRAGEQRKRGQSMKSYPS

SELRNVCDEHVASEEPAEKEDLLQQMLERR RYTPYPNLYPDQSPSEDWTMEERFRPLTFHGLVLRSQLVTLLVRGVCYSESQS SASQPRLSYAEMAED

YPRYPDIHDLDLTLLNPRMIV DVTPYMNPSPFTVSPNTHVSQVFNLFRTMGLRHLPVVNAVGE IVGIITRHNLTNEFLQARLRQHYQTL

For any suggestions or comments, please send an email to unitrap@crg.es