Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000029034 (Cpsf3l)
Chromosomal location
Chr 4: 155243655 - 155263212 (+)
Description
cleavage and polyadenylation specific factor 3-like Gene [Source:MGI (curated);Acc:Cpsf3l-001]
RefSeq_dna
NM_028020 
RefSeq_peptide
NP_082296.1 
UniGene
Mm.475640 
MGI
MGI:1919207 
Uniprot/SWISSPROT
Q9CWS4 
Uniprot/SPTREMBL
A2ADA4 A8Y5J3 
Human Ortholog
ENSG00000127054 (CPSF3L)
Omim not available
UniTrap UNI27887
Vector Insertion
Chr 4: 155243830 - 155246235
Public Clones D155D01 (ggtc)
Private Clones OST45227 (lexicon)
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000030901
Sequence
GCGCAGTGCGGAGGGACTCGCCGCGGCCGGGCGTCTGATGTGAGCGCGCGCGGGGTCTGCCTGCGGCTCTCCTGCGGGCGGTGCACGCGAGCCGTGGAGC

CGTGGTTCGAGGCGACCTCCCTGACCATGCCCGAGATTAGGGTCACTCCCTTGG - UNI27887 - GGGCTGGCCAGGATGTAGGCCGAAGCTGCATC

TTGGTCTCCATTTCGGGGAAGAATGTCATGTTGGACTGTGGGATGCACATGGGCTACAATGATGAC AGGCGCTTTCCTGACTTTTCTTACATCACCCAG

AGTGGCCGCCTGACTGACTTTCTGGACTGTGTGATCATCAG CCACTTCCACCTGGACCATTGTGGGGCACTCCCCTACTTCAGTGAAATGGTGGGCTAC

GATGGACCCATCTATATGACCCATCCTACCCAGGCCATCTGCCCCATCCTGTTGGAAGACTACCGCAAGATTGCAGTGGACAAGAAGGGCGAGGCCAATT

TCTTCACTTCTCAGATGATCAAAGACTGTATGAAGAAGGTGGTGGCTGTTCACCTGCATCAGACAGTTCAG GTGGATGATGAGCTGGAAATCAAGGCAT

ACTATGCAGGCCACGTGCTGGGGGCAGCCATGTTCCAGATTAAAGTGGGCTCGGAGTCTGTGGTCTACACG GGTGACTATAACATGACCCCAGACCGGC

ATTTGGG GGCTGCGTGGATTGACAAGTGTCGCCCCAACTTGCTCATCACAGAATCCACATATGCTACAACCATCCGAGATTCCAAACGCTGCAGAGAGC

GAGATTTCCTAAAGAAAGTTCATGAAACTGTGGAGCGTGGAGGAAAG GTGCTGATTCCTGTGTTTGCACTGGGCCGAGCACAAGAACTCTGCATCCTGC

TGGAGACCTTCTG GGAGCGCATGAACCTGAAGGTGCCCATATACTTCTCTACGGGCCTGACAGAGAAAGCCAACCACTACTACAAGCTCTTCATCACCT

GGACCAACCAGAAGATCCGGAAGACATTTGTCCAGAGGAACATGTTTGAGTTTAAGCACATCAAAGCCTTTGACCGGACATTTGCTGACAACCCAGGTCC

CATG GTTGTGTTTGCCACACCTGGGATGCTGCATGCTGGCCAATCCCTGCAAATCTTCCGAAAGTGGGCAGGAAATGAGAAGAACATG GTCATCATGC

CTGGTTATTGTGTGCAAGGCACCGTGGGCCACAAGATCCTTAGTGGGCAACGTAAACTGGAAATGGAAGGGCGCCAGATG CTGGAGGTAAAGATGCAAG

TGGAATACATGTCCTTCAGCGCCCATGCTGATGCCAAGGGCATCATGCAGCTGGTAGGACAAGCGGAGCCCGAGAGTGTGCTATTGGTGCATGGCGAAGC

CAAGAAGATGGAGTTCCTGAGGCAGAAGATTGAGCAGGAATTCC GGGTCAGCTGCTACATGCCGGCCAATGGTGAGACAGTGACGCTGCCCACAAGCCC

TAGCATCCCTGTGGGCATCTCCCTGGGATTGCTGAAGCGGGAGATGGTGCAGG GACTGTTGCCTGAAGCCAAAAAACCTAGGCTTTTACATGGCACCCT

AATTATGAAAGACAGT AATTTCCGGCTGGTATCCTCAGAGCAAGCCCTGAAGGAGCTGGGCCTGGCAGAGCACCAACTTCGCTTCACCTGTCGTGTGCA

CCTGCAGGACACACGCAAAGAACAAGAAACAGCTTTACGTGTGTACAGCCATCTCAAGAG CACCCTCAAGGACCACTGTGTACAGCATCTCCCCGATGG

CTCTGTGACTGTGGAGTCCATTCTAATCCAGGCTGCCGCCCATTCGGAGGACCCTGGTACCAAGGTGCTATTGGTCTCCTGGACTTACCAG GATGAAGA

GCTGGGAAGCTTCCTCACAACATTGCTCAAAAATGGCCTTCCTCAGGCTCCCAGCTGACATGTATCCACCAGGAATCCACTGCTCTTGTCTCTTGCTGTT

CTCCCAGCAGGACCAGGGCTTCGGCCGAGAGGCGGGTGCCCTGAGTAAATGGGAGACCATGACTGGATTACAGACCCCGTTCTAGGGATAAGATCAGAGT

CATAGGCTGGCTAAAGTAATAAACAGACCTTTTTGTTCTCTATGTCTTTTATTCCTACTCTCTGCCCCAAGAAAACAGGGTTCCCAGAAAAATGGGGTTT

TTACAGCTTTTGACTGCCTGGTACCCCATGTTGTTCCCTTTAGTGACAAAGGGATGTCCAGGGTAGAGAGCCCGGGGAAGTGGTAGCTGCTGGAAGGTAG

GCAGGACTGCCAGAGCCCTACATAGCTGTAGATTAATCTCTGCCGAGCACAATAAATGTTGTACAATCTCCACTTC
Translation
MPEIRVTPLG - UNI27887 - GAGQDVGRSCILVSISGKNVMLDCGMHMGYNDD RRFPDFSYITQSGRLTDFLDCVIIS SHFHLDHCGALPYFSE

MVGYDGPIYMTHPTQAICPILLEDYRKIAVDKKGEANFFTSQMIKDCMKKVVAVHLHQTVQ VDDELEIKAYYAGHVLGAAMFQIKVGSESVVYT GDYN

MTPDRHLG GAAWIDKCRPNLLITESTYATTIRDSKRCRERDFLKKVHETVERGGK VLIPVFALGRAQELCILLETFW WERMNLKVPIYFSTGLTEKA

NHYYKLFITWTNQKIRKTFVQRNMFEFKHIKAFDRTFADNPGPM VVFATPGMLHAGQSLQIFRKWAGNEKNM VIMPGYCVQGTVGHKILSGQRKLEME

GRQM LEVKMQVEYMSFSAHADAKGIMQLVGQAEPESVLLVHGEAKKMEFLRQKIEQEFR RVSCYMPANGETVTLPTSPSIPVGISLGLLKREMVQG G

LLPEAKKPRLLHGTLIMKDS NFRLVSSEQALKELGLAEHQLRFTCRVHLQDTRKEQETALRVYSHLKS STLKDHCVQHLPDGSVTVESILIQAAAHSE

DPGTKVLLVSWTYQ DEELGSFLTTLLKNGLPQAPS
Transcript ENSMUST00000120794
Sequence
GGTCTCGGCGGTTGCGCCTGCGCGCAGTGCGGAGGGACTCGCCGCGGCCGGGCGTCTGATGTGAGCGCGCGCGGGGTCTGCCTGCGGCTCTCCTGCGGGC

GGTGCACGCGAGCCGTGGAGCCGTGGTTCGAGGCGACCTCCCTGACCATGCCCGAGATTAGGGTCACTCCCTTGG - UNI27887 - GGGCTGGCCAG

GATGTAGGCCGAAGCTGCATCTTGGTCTCCATTTCGGGGAAGAATGTCATGTTGGACTGTGGGATGCACATGGGCTACAATGATGAC AGGCGCTTTCCT

GACTTTTCTTACATCACCCAGAGTGGCCGCCTGACTGACTTTCTGGACTGTGTGATCATCAG CCACTTCCACCTGGACCATTGTGGGGCACTCCCCTAC

TTCAGTGAAATGGTGGGCTACGATGGACCCATCTATATGACCCATCCTACCCAGGCCATCTGCCCCATCCTGTTGGAAGACTACCGCAAGATTGCAGTGG

ACAAGAAGGGCGAGGCCAATTTCTTCACTTCTCAGATGATCAAAGACTGTATGAAGAAGGTGGTGGCTGTTCACCTGCATCAGACAGTTCAG ATTAAAG

TGGGCTCGGAGTCTGTGGTCTACACG GGTGACTATAACATGACCCCAGACCGGCATTTGGG GGCTGCGTGGATTGACAAGTGTCGCCCCAACTTGCTC

ATCACAGAATCCACATATGCTACAACCATCCGAGATTCCAAACGCTGCAGAGAGCGAGATTTCCTAAAGAAAGTTCATGAAACTGTGGAGCGTGGAGGAA

AG GTGCTGATTCCTGTGTTTGCACTGGGCCGAGCACAAGAACTCTGCATCCTGCTGGAGACCTTCTG GGAGCGCATGAACCTGAAGGTGCCCATATAC

TTCTCTACGGGCCTGACAGAGAAAGCCAACCACTACTACAAGCTCTTCATCACCTGGACCAACCAGAAGATCCGGAAGACATTTGTCCAGAGGAACATGT

TTGAGTTTAAGCACATCAAAGCCTTTGACCGGACATTTGCTGACAACCCAGGTCCCATG GTTGTGTTTGCCACACCTGGGATGCTGCATGCTGGCCAAT

CCCTGCAAATCTTCCGAAAGTGGGCAGGAAATGAGAAGAACATG GTCATCATGCCTGGTTATTGTGTGCAAGGCACCGTGGGCCACAAGATCCTTAGTG

GGCAACGTAAACTGGAAATGGAAGGGCGCCAGATG CTGGAGGTAAAGATGCAAGTGGAATACATGTCCTTCAGCGCCCATGCTGATGCCAAGGGCATCA

TGCAGCTGGTAGGACAAGCGGAGCCCGAGAGTGTGCTATTGGTGCATGGCGAAGCCAAGAAGATGGAGTTCCTGAGGCAGAAGATTGAGCAGGAATTCC 

GGGTCAGCTGCTACATGCCGGCCAATGGTGAGACAGTGACGCTGCCCACAAGCCCTAGCATCCCTGTGGGCATCTCCCTGGGATTGCTGAAGCGGGAGAT

GGTGCAGG GACTGTTGCCTGAAGCCAAAAAACCTAGGCTTTTACATGGCACCCTAATTATGAAAGACAGT AATTTCCGGCTGGTATCCTCAGAGCAAG

CCCTGAAGGAGCTGGGCCTGGCAGAGCACCAACTTCGCTTCACCTGTCGTGTGCACCTGCAGGACACACGCAAAGAACAAGAAACAGCTTTACGTGTGTA

CAGCCATCTCAAGAG CACCCTCAAGGACCACTGTGTACAGCATCTCCCCGATGGCTCTGTGACTGTGGAGTCCATTCTAATCCAGGCTGCCGCCCATTC

GGAGGACCCTGGTACCAAGGTGCTATTGGTCTCCTGGACTTACCAG GATGAAGAGCTGGGAAGCTTCCTCACAACATTGCTCAAAAATGGCCTTCCTCA

GGCTCCCAGCTGA
Translation
MPEIRVTPLG - UNI27887 - GAGQDVGRSCILVSISGKNVMLDCGMHMGYNDD RRFPDFSYITQSGRLTDFLDCVIIS SHFHLDHCGALPYFSE

MVGYDGPIYMTHPTQAICPILLEDYRKIAVDKKGEANFFTSQMIKDCMKKVVAVHLHQTVQ IKVGSESVVYT GDYNMTPDRHLG GAAWIDKCRPNLL

ITESTYATTIRDSKRCRERDFLKKVHETVERGGK VLIPVFALGRAQELCILLETFW WERMNLKVPIYFSTGLTEKANHYYKLFITWTNQKIRKTFVQR

NMFEFKHIKAFDRTFADNPGPM VVFATPGMLHAGQSLQIFRKWAGNEKNM VIMPGYCVQGTVGHKILSGQRKLEMEGRQM LEVKMQVEYMSFSAHAD

AKGIMQLVGQAEPESVLLVHGEAKKMEFLRQKIEQEFR RVSCYMPANGETVTLPTSPSIPVGISLGLLKREMVQG GLLPEAKKPRLLHGTLIMKDS N

FRLVSSEQALKELGLAEHQLRFTCRVHLQDTRKEQETALRVYSHLKS STLKDHCVQHLPDGSVTVESILIQAAAHSEDPGTKVLLVSWTYQ DEELGSF

LTTLLKNGLPQAPS

For any suggestions or comments, please send an email to unitrap@crg.es