Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000029068 (Ccnl2)
Chromosomal location
Chr 4: 155186621 - 155198460 (+)
Description
cyclin L2 Gene [Source:MGI (curated);Acc:Ccnl2-001]
RefSeq_dna
NM_207678 
RefSeq_peptide
NP_997561.1 
UniGene
Mm.408813 
MGI
MGI:1927119 
Uniprot/SWISSPROT
Q9JJA7 
Uniprot/SPTREMBL
A2AD95 A2RSY2 Q9D814 
Human Ortholog
ENSG00000215726 (AC026283.2-203)
Omim not available
UniTrap UNI22371
Vector Insertion
Chr 4: 155186919 - 155187276
Public Clones not available
Private Clones OST299119 (lexicon) OST67848 (lexicon) OST45875 (lexicon)
Severity of mutation (?) Insertion after 18% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21015
Vector Insertion
Chr 4: 155187352 - 155187567
Public Clones not available
Private Clones OST345839 (lexicon) OST105120 (lexicon)
Severity of mutation (?) Insertion after 23% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21898
Vector Insertion
Chr 4: 155187678 - 155189351
Public Clones not available
Private Clones OST314462 (lexicon)
Severity of mutation (?) Insertion after 30% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29382
Vector Insertion
Chr 4: 155192097 - 155192647
Public Clones Ayu18-71 (egtc)
Private Clones not available
Severity of mutation (?) Insertion after 42% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14710
Vector Insertion
Chr 4: 155195224 - 155195920
Public Clones PST12003-NR (escells) PST2508-NR (escells) PST15435-NR (escells)
Private Clones OST426160 (lexicon)
Severity of mutation (?) Insertion after 64% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000030944
Sequence
GAGTCGGCGGCACAAAATGGCGGCGGCGGCGGCCGGGGCTGCGGGGTTGATGGCTCCGGCGTCGGCGGCCTGCTCTTCCGGCTCGGCGGGAGCGGCCCCG

GGGTCTCAGGGGGTGCTGATCGGCGACAGGCTCTACTCGGGCGTGCTCATCACCTTGGAAAACTGCCTGCTGCCCGACGACAAGCTCCGCTTCACGCCGT

CCATGTCGAGCGGCCTCGACGTCGATACGGAGACGGGACTCCGCGTCGTGGGCTGCGAGCTCATCCAGGCAGCCGGCATCCTGCTCCGCCTGCCGCAG -

 UNI22371 - GTGGCCATGGCTACAGGGCAGGTGCTGTTCCAGCGGTTCTTTTACACTAAGTCCTTCGTGAAACATTCCATGGAG - UNI21015 -

 CATGTGTCCATGGCTTGTGTTCACCTGGCTTCCAAAATAGAAGAGGCTCCGAGACGAATCAGGGATGTCATCAATGTATTCCATCGCCTTCGGCATCTG

AGAGAGAAAAA - UNI21898 - GAAGCCCGTGCCTCTGGTGCTTGATCAAGAGTATGTTAACCTAAAGAACCAGATTATAAAGGCAGAGAGACGGGT

TCTCAAGGAGTTGGGCTTTTGTGTCCATGTGAAGCACCCTCACAAG ATAATCGTTATGTACCTTCAGGTGTTAGAATGTGAGCGTAATCAACACCTGGT

CCAGACTGCATG - UNI29382 - GAACTACATGAATGACAGCCTTCGCACAGATGTCTTTGTCCGGTTCCAGCCTGAAAGCATTGCTTGTGCCTGTA

TCTACCTTGCTGCCCGGACACTGGAG ATCCCTTTACCCAATCGTCCACATTGGTTTCTTTTGTTTGGAGCAACTGAAGAAGAAATTCAAGAAATTTGCT

TTAAAATCTTGCAGCTTTATACACGGAAAAAG GTTGATTTGACGCATCTGGAGAGTGAAGTGGAGAAGAGAAAGCACGCCATTGAAGAAGCAAAGGCCC

GAGCAAAGGGCCTGCTCCCAGGGACTGCGCCAGGCCTGGACAGTGCTGCGGGGTTCTCGCCTGCTCCCAAGCTGG - UNI14710 - AATCCCCAAAA

GAAGGTAAAGGAGGCAAGCCTTCCCCGCCCTCTGGAAAGAGCGCCAAACGGAAAATGGAAGGCCCAAAGAAAGCCCAGGGCCACAGCCCTGTAAATGG C

TTGCTGAAAGGGCAGGAGAGTCGAAGTCAAAGCAGGAGTCGTGAGCAGAGCTACTCAAGGTCCCCATCACGGTCCGCTTCTCCAAAGAGAAG GAAAAGT

GATAGTGGCTCTACCTCAGGTGGGTCCAAGTCACAGAGTCGTTCTCGGAGCCGAAGTGACTCTCCTCCAAGGCAGGTACACCGAGGTGCTCCCTACAAAG

GCTCAGAAGTGAGGGGCTCCCGGAAATCAAAGGACTGCAAGTACCTCACCCAGAAGCCACACAAGTCTCGTAGCCGGAGCTCCTCTCGTTCCCGAAGCCG

GTCACGAGAGCGGACGGACAATTCTGGAAAATACAAGAAGAAAAGTCATTACTATAGAGATCAAAGACGTGAGCGCTCAAGGTCATATGAGCGCACAGGC

CATCGCTATGAGAGGGACCACCCTGGACACAGCAGGCATCGGAGGTGAGATAGGATCCCTGGTGGCTGCCCTTGGTCCCTCCCTGTTGGGCACACCTTGG

CGTCAGTGGCCTTGTAGCATGATGTTTTTCGAAAGTGTTTTTAATTGGACCTTGAGGTGAATTTGATTGATGAGACAGTGGGCAAGGTGCCCTTCAGGCT

GGCCTGGGGAGTGCTGTGCATCTGTCCCGGTTAATGGTCCACCTCAACTGCAGACCTTCAGGTAGCTGGATGGAACAGCAAAGGCACACGTCCCCATTGG

CGTGGCTTGGTGCTATTGACAAGCTGTCTCTTCACTCCTAAACTGATACTCAATTACGTTAAGCCAAGAAAGATGATTTTTGAAATCTTTGCCTATATTA

GGTTGTACTTGTGTACATATTTTGCAGTGGTTCACAATGAGAAAATGGCCTTAATAGCCCCCTTGTTCTCTATTCACGTTGTAAATAAACATGTTTAATA

CAAGTAAAAGCTATATACGAGAACTCAGAATTTTGATTCTGTTAGCTTAACACTTGTATAGAAAATTGAGATTTTTAAAATGTGAAGGTATTTAGGTCTG

TGTTCAAAGTCCGTATATTTTTATCTGTGCAATGCTGAGTGCAGGCCACCAGCTGGAGAGAAATTTTACGTGGTTGAATAAACAATTCTCAGGACACTTG

TT
Translation
MAAAAAGAAGLMAPASAACSSGSAGAAPGSQGVLIGDRLYSGVLITLENCLLPDDKLRFTPSMSSGLDVDTETGLRVVGCELIQAAGILLRLPQ - UNI

22371 - VAMATGQVLFQRFFYTKSFVKHSME - UNI21015 - HVSMACVHLASKIEEAPRRIRDVINVFHRLRHLREKK - UNI21898 - KK

PVPLVLDQEYVNLKNQIIKAERRVLKELGFCVHVKHPHK IIVMYLQVLECERNQHLVQTAW - UNI29382 - WNYMNDSLRTDVFVRFQPESIACA

CIYLAARTLE IPLPNRPHWFLLFGATEEEIQEICFKILQLYTRKK VDLTHLESEVEKRKHAIEEAKARAKGLLPGTAPGLDSAAGFSPAPKLE - UN

I14710 - ESPKEGKGGKPSPPSGKSAKRKMEGPKKAQGHSPVNG GLLKGQESRSQSRSREQSYSRSPSRSASPKRR RKSDSGSTSGGSKSQSRSRS

RSDSPPRQVHRGAPYKGSEVRGSRKSKDCKYLTQKPHKSRSRSSSRSRSRSRERTDNSGKYKKKSHYYRDQRRERSRSYERTGHRYERDHPGHSRHRR
Transcript ENSMUST00000116250
Sequence
GAGTCGGCGGCACAAAATGGCGGCGGCGGCGGCCGGGGCTGCGGGGTTGATGGCTCCGGCGTCGGCGGCCTGCTCTTCCGGCTCGGCGGGAGCGGCCCCG

GGGTCTCAGGGGGTGCTGATCGGCGACAGGCTCTACTCGGGCGTGCTCATCACCTTGGAAAACTGCCTGCTGCCCGACGACAAGCTCCGCTTCACGCCGT

CCATGTCGAGCGGCCTCGACGTCGATACGGAGACGGGACTCCGCGTCGTGGGCTGCGAGCTCATCCAGGCAGCCGGCATCCTGCTCCGCCTGCCGCAG -

 UNI22371 - GTGGCCATGGCTACAGGGCAGGTGCTGTTCCAGCGGTTCTTTTACACTAAGTCCTTCGTGAAACATTCCATGGAG - UNI21015 -

 CATGTGTCCATGGCTTGTGTTCACCTGGCTTCCAAAATAGAAGAGGCTCCGAGACGAATCAGGGATGTCATCAATGTATTCCATCGCCTTCGGCATCTG

AGAGAGAAAAA - UNI21898 - GAAGCCCGTGCCTCTGGTGCTTGATCAAGAGTATGTTAACCTAAAGAACCAGATTATAAAGGCAGAGAGACGGGT

TCTCAAGGAGTTGGGCTTTTGTGTCCATGTGAAGCACCCTCACAAG ATAATCGTTATGTACCTTCAGGTGTTAGAATGTGAGCGTAATCAACACCTGGT

CCAGACTGCATG - UNI29382 - GGTAGCCTCTGAGGGTAAGTGA
Translation
MAAAAAGAAGLMAPASAACSSGSAGAAPGSQGVLIGDRLYSGVLITLENCLLPDDKLRFTPSMSSGLDVDTETGLRVVGCELIQAAGILLRLPQ - UNI

22371 - VAMATGQVLFQRFFYTKSFVKHSME - UNI21015 - HVSMACVHLASKIEEAPRRIRDVINVFHRLRHLREKK - UNI21898 - KK

PVPLVLDQEYVNLKNQIIKAERRVLKELGFCVHVKHPHK IIVMYLQVLECERNQHLVQTAW - UNI29382 - WVASEGK
Transcript ENSMUST00000030945
Sequence
GAGTCGGCGGCACAAAATGGCGGCGGCGGCGGCCGGGGCTGCGGGGTTGATGGCTCCGGCGTCGGCGGCCTGCTCTTCCGGCTCGGCGGGAGCGGCCCCG

GGGTCTCAGGGGGTGCTGATCGGCGACAGGCTCTACTCGGGCGTGCTCATCACCTTGGAAAACTGCCTGCTGCCCGACGACAAGCTCCGCTTCACGCCGT

CCATGTCGAGCGGCCTCGACGTCGATACGGAGACGGGACTCCGCGTCGTGGGCTGCGAGCTCATCCAGGCAGCCGGCATCCTGCTCCGCCTGCCGCAG -

 UNI22371 - GTGGCCATGGCTACAGGGCAGGTGCTGTTCCAGCGGTTCTTTTACACTAAGTCCTTCGTGAAACATTCCATGGAG - UNI21015 -

 CATGTGTCCATGGCTTGTGTTCACCTGGCTTCCAAAATAGAAGAGGCTCCGAGACGAATCAGGGATGTCATCAATGTATTCCATCGCCTTCGGCATCTG

AGAGAGAAAAA - UNI21898 - GAAGCCCGTGCCTCTGGTGCTTGATCAAGAGTATGTTAACCTAAAGAACCAGATTATAAAGGCAGAGAGACGGGT

TCTCAAGGAGTTGGGCTTTTGTGTCCATGTGAAGCACCCTCACAAG ATAATCGTTATGTACCTTCAGGTGTTAGAATGTGAG - UNI14710 - - U

NI29382 - CGGACGGACAATTCTGGAAAATACAAGAAGAAAAGTCATTACTATAGAGATCAAAGACGTGAGCGCTCAAGGTCATATGAGCGCACAGGC

CATCGCTATGAGAGGGACCACCCTGGACACAGCAGGCATCGGAGGTGA
Translation
MSSGLDVDTETGLRVVGCELIQAAGILLRLPQ - UNI22371 - VAMATGQVLFQRFFYTKSFVKHSME - UNI21015 - HVSMACVHLASKIEE

APRRIRDVINVFHRLRHLREKK - UNI21898 - KKPVPLVLDQEYVNLKNQIIKAERRVLKELGFCVHVKHPHK IIVMYLQVLECE - UNI1471

0 - - UNI29382 - RTDNSGKYKKKSHYYRDQRRERSRSYERTGHRYERDHPGHSRHRR

For any suggestions or comments, please send an email to unitrap@crg.es