Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000029086 (Prom1)
Chromosomal location
Chr 5: 44384861 - 44492920 (-)
Description
prominin 1 Gene [Source:MGI Symbol;Acc:MGI:1100886]
RefSeq_dna
NM_008935 
RefSeq_peptide
NP_032961.1 
UniGene
Mm.474219 Mm.6250 
MGI
MGI:1100886 
Uniprot/SWISSPROT
O54990 
Uniprot/SPTREMBL
Q80XB2 Q80XB3 Q8C3K1 Q80XB6 Q8BH12 Q8CDK8 Q8R056 
Human Ortholog
ENSG00000007062 (PROM1)
Omim 612095 - RETINITIS PIGMENTOSA 41  
UniTrap UNI31620
Vector Insertion
Chr 5: 44428662 - 44435646
Public Clones IST12893F10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 31% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000030973
Sequence
GTTCCGAGACCCGGAGGAGAGCTGGACCGGAGAG GGATGGTACTTTGAGTGAATGACCACCTTGGAGACCGTTCTTCTGTTTCCCTTGTTACCAGCCAG

GAGGCAGAAGAGTCCACCGGTCCAGGAAAGACCCATTTCCCTTGAGTTTCCAGAAAGTACCTCATGCTTGAGAGATCAGGCCAACAACTATGGCTCTCGT

CTTCAGTGCCCTGCTGTTACTGGGGCTGTGTGGAAAGATCTCTTCAGAAGGTCAGCCTGCATTCCATAACACTCCTGGGGCTATGAATTATGAATTGCCT

ACCACCAAATATGAGACCCAAGATACCTTCAATGCTGGGATTGTTGGCCCTCTCTACAAAATGGTGCACATCTTCCTCAACGTGGTCCAGCCGAATGACT

TCCCTCTAG ATTTGATCAAAAAACTCATACAGAACAAGAACTTTGACATCTCAGTTGATTCCAAGGAG ATTGCCCTCTATGAGATCGGAGTCCTTATC

TGCGCCATCCTGGGACTGCTGTTCATTATCCTCATGCCTCTGGTGGGCTGCTTCTTTTGTATGTGCCGTTGCTGCAACAAATGCGGCGGAGAGATGCACC

AGCGGCAGAAGCAGAATGCGCCATGCAGGAGGAAGTGCTTGGGCCTCTCCCTCCTGGTGATTTGTCTGCTCATGAG CCTTGGCATTATATATGGCTTTG

TGGCTAACCAGCAGACCAGGACTCGGATCAAAGGGACCCAGAAACTGGCAAAGAGCAATTTCAGAGACTTTCAAACACTCCTGACTGAAACACCAAAG C

AAATTGACTATGTAGTGGAGCAGTACACCAACACCAAGAACAAGGCATTCTCAGACCTGGATG - UNI31620 - GCATCGGCTCCGTGCTGGGAGGC

AGAATAAAGGACCAACTAAAACCCAAAGTAACTCCTGTCCTCGAAGAGATTAAGGCCATGGCGACAG - UNI31620 - CCATCAAACAGACCAAGGA

TGCCCTGCAGAACATGAGCAGCAGCCTGAAAAGTCTCCAAGATGCAGCCACCCAGCTCAATACCAACCTGAGCTCTGTGAGAAACAGCATCGAGAATTCG

CTCAGCAGCAGTGACTGTACCTCAGATCCAGCCAGCAAGATCTGCGATAGCATCAGACCAAGCCTAAGCAGTCTGGGGAGCAGCCTCAATTCAAGTCAG 

- UNI31620 - GGGTATACGACAATTGATGAAATACCCAATACAATACAAAACCAAACTGTGGATGTCATCAAAG ACGTCAAAAATACCTTGGACTC

CATTAGCTCCAACATTAAGGACATGAGCCAAAGTATTCCTATTGAGGATATGCTGTTACAGGTCTCCCATTACCTTAATAACAGCAACAGATACTTAAAC

CAGGAGCTGCCCAAGCTGGAAGAATATGACTCGTACTG GTGGCTGGGTGGCTTGATTGTCTGCTTTCTGCTGACTCTCATTGTGACCTTCTTTTTCCTG

GGCTTGCTGTGTGGTGTGTTTGGCTATGACAAGCATGCCACCCCAACTAGAAGAGGCTGTGTGTCCAACACTGGAGGCATCTTCCTCATGGC TGGGGTT

GGATTCGGCTTCCTTTTTTGCTGGATATTGATGATCCTTGTGGTTCTTACGTTTGTTGTTGGTGCAAATGTGGAAAAGTTGCTCTGCGAACCTTATGAAA

ACAAGAAATTATTACAG GTTTTGGACACTCCCTATCTGCTCAAGGAACAATGGCAATTTTATCTTTCTGGCATGCTATTCAATAACCCAGACATTAACA

TGACCTTTGAGCAAGTCTACAG GGATTGCAAAAGAGGTCGAGGTATATATGCTGCTTTTCAGCTTGAGAATGTCGTCAACGTCAGTGATCATTTCAACA

TTGACCAG ATTTCTGAAAACATAAATACGGAGTTGGAAAACCTGAATGTGAACATTGATAGCATTGAACTGTTGGATAACACAGGAAGGAAGAGCCTCG

AGGACTTTGCACATTCTGGGATAGATACAATCGATTATTCCACATACTTGAAGGAG ACTGAGAAATCCCCTACTGAAGTGAATCTGCTGACATTTGCCT

CTACCCTGGAAGCAAAAGCAAACCAGTTG CCTGAAGGAAAGCTGAAACAGGCCTTCTTACTGGATGTACAGAATATAAGAGCCATCCACCAGCATCTCC

TCCCTCCTGTGCAGCAATCACTG AATACGTTAAGACAAAGTGTCTGGACCCTCCAGCAAACAAGCAACAAGTTGCCG GAGAAAGTGAAGAAGATCCTT

GCCTCTTTGGACTCTGTTCAGCATTTCCTCACCAATAACGTTTCCCTCATCGTTATCGGG GAAACGAAGAAGTTTGGGAAAACAATACTAGGCTACTTT

GAACATTATCTGCACTGGGTCTTTTATGCC ATCACAGAGAAGATGACATCCTGCAAACCCATGGCCACCGCGATGGACTCTGCTGTTAATGGCATTCTG

TGTGGCTATGTTGCGGACCCTCTG AATTTGTTCTGGTTCGGCATAGGGAAAGCCACGGTGCTCTTACTTCCGGCTGTAATCATTGCTATCAAGCTGGCC

AAGTACTATCGCAGGATGGATTCAGAGGATGTATACGACGA CTCGTCCGTCTCGGGGATGTGGCATTTCACTTTATGA
Translation
 MALVFSALLLLGLCGKISSEGQPAFHNTPGAMNYELPTTKYETQDTFNAGIVGPLYKMVHIFLNVVQPNDFPLD DLIKKLIQNKNFDISVDSKE IAL

YEIGVLICAILGLLFIILMPLVGCFFCMCRCCNKCGGEMHQRQKQNAPCRRKCLGLSLLVICLLMS SLGIIYGFVANQQTRTRIKGTQKLAKSNFRDFQ

TLLTETPK QIDYVVEQYTNTKNKAFSDLDG - UNI31620 - GIGSVLGGRIKDQLKPKVTPVLEEIKAMATA - UNI31620 - AIKQTKDALQ

NMSSSLKSLQDAATQLNTNLSSVRNSIENSLSSSDCTSDPASKICDSIRPSLSSLGSSLNSSQ - UNI31620 - GYTTIDEIPNTIQNQTVDVIKD 

DVKNTLDSISSNIKDMSQSIPIEDMLLQVSHYLNNSNRYLNQELPKLEEYDSYW WWLGGLIVCFLLTLIVTFFFLGLLCGVFGYDKHATPTRRGCVSNT

GGIFLMA AGVGFGFLFCWILMILVVLTFVVGANVEKLLCEPYENKKLLQ VLDTPYLLKEQWQFYLSGMLFNNPDINMTFEQVYR RDCKRGRGIYAAF

QLENVVNVSDHFNIDQ ISENINTELENLNVNIDSIELLDNTGRKSLEDFAHSGIDTIDYSTYLKE TEKSPTEVNLLTFASTLEAKANQL PEGKLKQA

FLLDVQNIRAIHQHLLPPVQQSL NTLRQSVWTLQQTSNKLP EKVKKILASLDSVQHFLTNNVSLIVIG ETKKFGKTILGYFEHYLHWVFYA ITEKM

TSCKPMATAMDSAVNGILCGYVADPL NLFWFGIGKATVLLLPAVIIAIKLAKYYRRMDSEDVYDD DSSVSGMWHFTL
Transcript ENSMUST00000087442
Sequence
GTTCCGAGACCCGGAGGAGAGCTGGACCGGAGAG GGATGGTACTTTGAGTGAATGACCACCTTGGAGACCGTTCTTCTGTTTCCCTTGTTACCAGCCAG

GAGGCAGAAGAGTCCACCGGTCCAGGAAAGACCCATTTCCCTTGAGTTTCCAGAAAGTACCTCATGCTTGAGAGATCAGGCCAACAACTATGGCTCTCGT

CTTCAGTGCCCTGCTGTTACTGGGGCTGTGTGGAAAGATCTCTTCAGAAGGTCAGCCTGCATTCCATAACACTCCTGGGGCTATGAATTATGAATTGCCT

ACCACCAAATATGAGACCCAAGATACCTTCAATGCTGGGATTGTTGGCCCTCTCTACAAAATGGTGCACATCTTCCTCAACGTGGTCCAGCCGAATGACT

TCCCTCTAG ATTTGATCAAAAAACTCATACAGAACAAGAACTTTGACATCTCAGTTGATTCCAAGGAG ATTGCCCTCTATGAGATCGGAGTCCTTATC

TGCGCCATCCTGGGACTGCTGTTCATTATCCTCATGCCTCTGGTGGGCTGCTTCTTTTGTATGTGCCGTTGCTGCAACAAATGCGGCGGAGAGATGCACC

AGCGGCAGAAGCAGAATGCGCCATGCAGGAGGAAGTGCTTGGGCCTCTCCCTCCTGGTGATTTGTCTGCTCATGAG CCTTGGCATTATATATGGCTTTG

TGGCTAACCAGCAGACCAGGACTCGGATCAAAGGGACCCAGAAACTGGCAAAGAGCAATTTCAGAGACTTTCAAACACTCCTGACTGAAACACCAAAG C

AAATTGACTATGTAGTGGAGCAGTACACCAACACCAAGAACAAGGCATTCTCAGACCTGGATG - UNI31620 - GCATCGGCTCCGTGCTGGGAGGC

AGAATAAAGGACCAACTAAAACCCAAAGTAACTCCTGTCCTCGAAGAGATTAAGGCCATGGCGACAG - UNI31620 - CCATCAAACAGACCAAGGA

TGCCCTGCAGAACATGAGCAGCAGCCTGAAAAGTCTCCAAGATGCAGCCACCCAGCTCAATACCAACCTGAGCTCTGTGAGAAACAGCATCGAGAATTCG

CTCAGCAGCAGTGACTGTACCTCAGATCCAGCCAGCAAGATCTGCGATAGCATCAGACCAAGCCTAAGCAGTCTGGGGAGCAGCCTCAATTCAAGTCAG 

- UNI31620 - CTCCCATCAGTGGATAGAGAACTCAACACTGTTACTGAAGTCGACAAAACTGATCTGGAGAGCCTCGTCAAAAGG GGGTATACGAC

AATTGATGAAATACCCAATACAATACAAAACCAAACTGTGGATGTCATCAAAG ACGTCAAAAATACCTTGGACTCCATTAGCTCCAACATTAAGGACAT

GAGCCAAAGTATTCCTATTGAGGATATGCTGTTACAGGTCTCCCATTACCTTAATAACAGCAACAGATACTTAAACCAGGAGCTGCCCAAGCTGGAAGAA

TATGACTCGTACTG GTGGCTGGGTGGCTTGATTGTCTGCTTTCTGCTGACTCTCATTGTGACCTTCTTTTTCCTGGGCTTGCTGTGTGGTGTGTTTGGC

TATGACAAGCATGCCACCCCAACTAGAAGAGGCTGTGTGTCCAACACTGGAGGCATCTTCCTCATGGC TGGGGTTGGATTCGGCTTCCTTTTTTGCTGG

ATATTGATGATCCTTGTGGTTCTTACGTTTGTTGTTGGTGCAAATGTGGAAAAGTTGCTCTGCGAACCTTATGAAAACAAGAAATTATTACAG GTTTTG

GACACTCCCTATCTGCTCAAGGAACAATGGCAATTTTATCTTTCTGGCATGCTATTCAATAACCCAGACATTAACATGACCTTTGAGCAAGTCTACAG G

GATTGCAAAAGAGGTCGAGGTATATATGCTGCTTTTCAGCTTGAGAATGTCGTCAACGTCAGTGATCATTTCAACATTGACCAG ATTTCTGAAAACATA

AATACGGAGTTGGAAAACCTGAATGTGAACATTGATAGCATTGAACTGTTGGATAACACAGGAAGGAAGAGCCTCGAGGACTTTGCACATTCTGGGATAG

ATACAATCGATTATTCCACATACTTGAAGGAG ACTGAGAAATCCCCTACTGAAGTGAATCTGCTGACATTTGCCTCTACCCTGGAAGCAAAAGCAAACC

AGTTG CCTGAAGGAAAGCTGAAACAGGCCTTCTTACTGGATGTACAGAATATAAGAGCCATCCACCAGCATCTCCTCCCTCCTGTGCAGCAATCACTG 

AATACGTTAAGACAAAGTGTCTGGACCCTCCAGCAAACAAGCAACAAGTTGCCG GAGAAAGTGAAGAAGATCCTTGCCTCTTTGGACTCTGTTCAGCAT

TTCCTCACCAATAACGTTTCCCTCATCGTTATCGGG GAAACGAAGAAGTTTGGGAAAACAATACTAGGCTACTTTGAACATTATCTGCACTGGGTCTTT

TATGCC ATCACAGAGAAGATGACATCCTGCAAACCCATGGCCACCGCGATGGACTCTGCTGTTAATGGCATTCTGTGTGGCTATGTTGCGGACCCTCTG

 AATTTGTTCTGGTTCGGCATAGGGAAAGCCACGGTGCTCTTACTTCCGGCTGTAATCATTGCTATCAAGCTGGCCAAGTACTATCGCAGGATGGATTCA

GAGGATGTATACGACGA CTCGTCCGTCTCGGGGATGTGGCATTTCACTTTATGA
Translation
 MALVFSALLLLGLCGKISSEGQPAFHNTPGAMNYELPTTKYETQDTFNAGIVGPLYKMVHIFLNVVQPNDFPLD DLIKKLIQNKNFDISVDSKE IAL

YEIGVLICAILGLLFIILMPLVGCFFCMCRCCNKCGGEMHQRQKQNAPCRRKCLGLSLLVICLLMS SLGIIYGFVANQQTRTRIKGTQKLAKSNFRDFQ

TLLTETPK QIDYVVEQYTNTKNKAFSDLDG - UNI31620 - GIGSVLGGRIKDQLKPKVTPVLEEIKAMATA - UNI31620 - AIKQTKDALQ

NMSSSLKSLQDAATQLNTNLSSVRNSIENSLSSSDCTSDPASKICDSIRPSLSSLGSSLNSSQ - UNI31620 - LPSVDRELNTVTEVDKTDLESLV

KR GYTTIDEIPNTIQNQTVDVIKD DVKNTLDSISSNIKDMSQSIPIEDMLLQVSHYLNNSNRYLNQELPKLEEYDSYW WWLGGLIVCFLLTLIVTFF

FLGLLCGVFGYDKHATPTRRGCVSNTGGIFLMA AGVGFGFLFCWILMILVVLTFVVGANVEKLLCEPYENKKLLQ VLDTPYLLKEQWQFYLSGMLFNN

PDINMTFEQVYR RDCKRGRGIYAAFQLENVVNVSDHFNIDQ ISENINTELENLNVNIDSIELLDNTGRKSLEDFAHSGIDTIDYSTYLKE TEKSPTE

VNLLTFASTLEAKANQL PEGKLKQAFLLDVQNIRAIHQHLLPPVQQSL NTLRQSVWTLQQTSNKLP EKVKKILASLDSVQHFLTNNVSLIVIG ETK

KFGKTILGYFEHYLHWVFYA ITEKMTSCKPMATAMDSAVNGILCGYVADPL NLFWFGIGKATVLLLPAVIIAIKLAKYYRRMDSEDVYDD DSSVSGM

WHFTL
Transcript ENSMUST00000087441
Sequence
GTTCCGAGACCCGGAGGAGAGCTGGACCGGAGAG GGATGGTACTTTGAGTGAATGACCACCTTGGAGACCGTTCTTCTGTTTCCCTTGTTACCAGCCAG

GAGGCAGAAGAGTCCACCGGTCCAGGAAAGACCCATTTCCCTTGAGTTTCCAGAAAGTACCTCATGCTTGAGAGATCAGGCCAACAACTATGGCTCTCGT

CTTCAGTGCCCTGCTGTTACTGGGGCTGTGTGGAAAGATCTCTTCAGAAGGTCAGCCTGCATTCCATAACACTCCTGGGGCTATGAATTATGAATTGCCT

ACCACCAAATATGAGACCCAAGATACCTTCAATGCTGGGATTGTTGGCCCTCTCTACAAAATGGTGCACATCTTCCTCAACGTGGTCCAGCCGAATGACT

TCCCTCTAG ATTTGATCAAAAAACTCATACAGAACAAGAACTTTGACATCTCAGTTGATTCCAAGGAG ATTGCCCTCTATGAGATCGGAGTCCTTATC

TGCGCCATCCTGGGACTGCTGTTCATTATCCTCATGCCTCTGGTGGGCTGCTTCTTTTGTATGTGCCGTTGCTGCAACAAATGCGGCGGAGAGATGCACC

AGCGGCAGAAGCAGAATGCGCCATGCAGGAGGAAGTGCTTGGGCCTCTCCCTCCTGGTGATTTGTCTGCTCATGAG CCTTGGCATTATATATGGCTTTG

TGGCTAACCAGCAGACCAGGACTCGGATCAAAGGGACCCAGAAACTGGCAAAGAGCAATTTCAGAGACTTTCAAACACTCCTGACTGAAACACCAAAG C

AAATTGACTATGTAGTGGAGCAGTACACCAACACCAAGAACAAGGCATTCTCAGACCTGGATG - UNI31620 - GCATCGGCTCCGTGCTGGGAGGC

AGAATAAAGGACCAACTAAAACCCAAAGTAACTCCTGTCCTCGAAGAGATTAAGGCCATGGCGACAG - UNI31620 - CCATCAAACAGACCAAGGA

TGCCCTGCAGAACATGAGCAGCAGCCTGAAAAGTCTCCAAGATGCAGCCACCCAGCTCAATACCAACCTGAGCTCTGTGAGAAACAGCATCGAGAATTCG

CTCAGCAGCAGTGACTGTACCTCAGATCCAGCCAGCAAGATCTGCGATAGCATCAGACCAAGCCTAAGCAGTCTGGGGAGCAGCCTCAATTCAAGTCAG 

- UNI31620 - CTCCCATCAGTGGATAGAGAACTCAACACTGTTACTGAAGTCGACAAAACTGATCTGGAGAGCCTCGTCAAAAGG GGGTATACGAC

AATTGATGAAATACCCAATACAATACAAAACCAAACTGTGGATGTCATCAAAG ACGTCAAAAATACCTTGGACTCCATTAGCTCCAACATTAAGGACAT

GAGCCAAAGTATTCCTATTGAGGATATGCTGTTACAGGTCTCCCATTACCTTAATAACAGCAACAGATACTTAAACCAGGAGCTGCCCAAGCTGGAAGAA

TATGACTCGTACTG GTGGCTGGGTGGCTTGATTGTCTGCTTTCTGCTGACTCTCATTGTGACCTTCTTTTTCCTGGGCTTGCTGTGTGGTGTGTTTGGC

TATGACAAGCATGCCACCCCAACTAGAAGAGGCTGTGTGTCCAACACTGGAGGCATCTTCCTCATGGC TGGGGTTGGATTCGGCTTCCTTTTTTGCTGG

ATATTGATGATCCTTGTGGTTCTTACGTTTGTTGTTGGTGCAAATGTGGAAAAGTTGCTCTGCGAACCTTATGAAAACAAGAAATTATTACAG GTTTTG

GACACTCCCTATCTGCTCAAGGAACAATGGCAATTTTATCTTTCTGGCATGCTATTCAATAACCCAGACATTAACATGACCTTTGAGCAAGTCTACAG G

GATTGCAAAAGAGGTCGAGGTATATATGCTGCTTTTCAGCTTGAGAATGTCGTCAACGTCAGTGATCATTTCAACATTGACCAG ATTTCTGAAAACATA

AATACGGAGTTGGAAAACCTGAATGTGAACATTGATAGCATTGAACTGTTGGATAACACAGGAAGGAAGAGCCTCGAGGACTTTGCACATTCTGGGATAG

ATACAATCGATTATTCCACATACTTGAAGGAG ACTGAGAAATCCCCTACTGAAGTGAATCTGCTGACATTTGCCTCTACCCTGGAAGCAAAAGCAAACC

AGTTG CCTGAAGGAAAGCTGAAACAGGCCTTCTTACTGGATGTACAGAATATAAGAGCCATCCACCAGCATCTCCTCCCTCCTGTGCAGCAATCACTG 

AATACGTTAAGACAAAGTGTCTGGACCCTCCAGCAAACAAGCAACAAGTTGCCG GAGAAAGTGAAGAAGATCCTTGCCTCTTTGGACTCTGTTCAGCAT

TTCCTCACCAATAACGTTTCCCTCATCGTTATCGGG GAAACGAAGAAGTTTGGGAAAACAATACTAGGCTACTTTGAACATTATCTGCACTGGGTCTTT

TATGCC ATCACAGAGAAGATGACATCCTGCAAACCCATGGCCACCGCGATGGACTCTGCTGTTAATGGCATTCTGTGTGGCTATGTTGCGGACCCTCTG

 AATTTGTTCTGGTTCGGCATAGGGAAAGCCACGGTGCTCTTACTTCCGGCTGTAATCATTGCTATCAAGCTGGCCAAGTACTATCGCAGGATGGATTCA

GAGGATGTATACGACGA TGTTGAGACTGTGCCCATGAAAAA TTTGGAAATCGGTAGTAATGGTTATCATAAAGATCATTTATATGGTGTTCACAATCC

TGTTATGACAAG CCCGTCTCGATACTGACAACTGGAGTTGAAGCTGCTTGAA CAACAAGATAGTCAACATGGAAAGCATCACAGATTTTGGATAGTTT

CTGAGTCTTCTAGAACGTTCCAAGTGCAGAAGAAACCTGGTGGAGACTCAGGCGGGCACTAGGAACATGGCATCAGTGGTCTTAGGGTAGCACTTTGTCA

GGAATGAACAGTCATCATGGTTATAATCCACATATCCATTGCAACTCATGAATGATTCTCTCCTGTTTTGTTTTTAACTTTTCTTTTTACACTGATTTTC

TATTTAGACACTAAAACATATAGGGGTGCTTATTCCCCCTGGATACATTTACCTGTGAACCAGCTATTCCGGTGTCATAGCTGGGTACCTAACTTACTTC

CATATGTGAAGTGTGCTAAACACAAACCAGTTTACAGAAGAGATGTATTTTGTGTATAGTAAACTGTATATATACCCTTTTACCACAGTCAGTTTTTTAA

ACAAATGAATACTCTAGATTTTTCTTCTAAATGAGGTTACTGTTGGGGTGGTTGTGACCTAGTGATGCTGTAGAAAGGAGTCTGCATTCACTAAAAGTGT

GTCAACCTAGAGCAGGCAATGCCCTTCCTTGTGGATTTCTGTCTGCTCGTTTTGGAGCTACCTGCGGTTTAGAAATAGAATTCAAGAACAATCACGGAGT

TTCCCACTTGATGCCACTGCCAAAGTCAGAACAAGGGATCTTGAGAGAAGGAACTGTCGCTCAGCTGGGAGCGGAATCATTATCGCAATCACAGGTCCTG

GTTCACAGTTTAGTGGCACTCTCTGGTTTGTAAGAATGGGCATTACGTTCAGTGTCATCTGGTCATCTGTGATGTGTGTCATCAGCCTGTCCTGATGTTG

AGATTTAAAATAAAGCATGAATGAACAGA
Translation
 MALVFSALLLLGLCGKISSEGQPAFHNTPGAMNYELPTTKYETQDTFNAGIVGPLYKMVHIFLNVVQPNDFPLD DLIKKLIQNKNFDISVDSKE IAL

YEIGVLICAILGLLFIILMPLVGCFFCMCRCCNKCGGEMHQRQKQNAPCRRKCLGLSLLVICLLMS SLGIIYGFVANQQTRTRIKGTQKLAKSNFRDFQ

TLLTETPK QIDYVVEQYTNTKNKAFSDLDG - UNI31620 - GIGSVLGGRIKDQLKPKVTPVLEEIKAMATA - UNI31620 - AIKQTKDALQ

NMSSSLKSLQDAATQLNTNLSSVRNSIENSLSSSDCTSDPASKICDSIRPSLSSLGSSLNSSQ - UNI31620 - LPSVDRELNTVTEVDKTDLESLV

KR GYTTIDEIPNTIQNQTVDVIKD DVKNTLDSISSNIKDMSQSIPIEDMLLQVSHYLNNSNRYLNQELPKLEEYDSYW WWLGGLIVCFLLTLIVTFF

FLGLLCGVFGYDKHATPTRRGCVSNTGGIFLMA AGVGFGFLFCWILMILVVLTFVVGANVEKLLCEPYENKKLLQ VLDTPYLLKEQWQFYLSGMLFNN

PDINMTFEQVYR RDCKRGRGIYAAFQLENVVNVSDHFNIDQ ISENINTELENLNVNIDSIELLDNTGRKSLEDFAHSGIDTIDYSTYLKE TEKSPTE

VNLLTFASTLEAKANQL PEGKLKQAFLLDVQNIRAIHQHLLPPVQQSL NTLRQSVWTLQQTSNKLP EKVKKILASLDSVQHFLTNNVSLIVIG ETK

KFGKTILGYFEHYLHWVFYA ITEKMTSCKPMATAMDSAVNGILCGYVADPL NLFWFGIGKATVLLLPAVIIAIKLAKYYRRMDSEDVYDD DVETVPM

KN NLEIGSNGYHKDHLYGVHNPVMTS SPSRY 
Transcript ENSMUST00000074113
Sequence
GTTCCGAGACCCGGAGGAGAGCTGGACCGGAGAG GGATGGTACTTTGAGTGAATGACCACCTTGGAGACCGTTCTTCTGTTTCCCTTGTTACCAGCCAG

GAGGCAGAAGAGTCCACCGGTCCAGGAAAGACCCATTTCCCTTGAGTTTCCAGAAAGTACCTCATGCTTGAGAGATCAGGCCAACAACTATGGCTCTCGT

CTTCAGTGCCCTGCTGTTACTGGGGCTGTGTGGAAAGATCTCTTCAGAAGGTCAGCCTGCATTCCATAACACTCCTGGGGCTATGAATTATGAATTGCCT

ACCACCAAATATGAGACCCAAGATACCTTCAATGCTGGGATTGTTGGCCCTCTCTACAAAATGGTGCACATCTTCCTCAACGTGGTCCAGCCGAATGACT

TCCCTCTAG ATTTGATCAAAAAACTCATACAGAACAAGAACTTTGACATCTCAGTTGATTCCAAGGAG CCAGAAATCATAGTCTTGGCTCTGAAG AT

TGCCCTCTATGAGATCGGAGTCCTTATCTGCGCCATCCTGGGACTGCTGTTCATTATCCTCATGCCTCTGGTGGGCTGCTTCTTTTGTATGTGCCGTTGC

TGCAACAAATGCGGCGGAGAGATGCACCAGCGGCAGAAGCAGAATGCGCCATGCAGGAGGAAGTGCTTGGGCCTCTCCCTCCTGGTGATTTGTCTGCTCA

TGAG CCTTGGCATTATATATGGCTTTGTGGCTAACCAGCAGACCAGGACTCGGATCAAAGGGACCCAGAAACTGGCAAAGAGCAATTTCAGAGACTTTC

AAACACTCCTGACTGAAACACCAAAG CAAATTGACTATGTAGTGGAGCAGTACACCAACACCAAGAACAAGGCATTCTCAGACCTGGATG - UNI316

20 - GCATCGGCTCCGTGCTGGGAGGCAGAATAAAGGACCAACTAAAACCCAAAGTAACTCCTGTCCTCGAAGAGATTAAGGCCATGGCGACAG - UN

I31620 - CCATCAAACAGACCAAGGATGCCCTGCAGAACATGAGCAGCAGCCTGAAAAGTCTCCAAGATGCAGCCACCCAGCTCAATACCAACCTGAG

CTCTGTGAGAAACAGCATCGAGAATTCGCTCAGCAGCAGTGACTGTACCTCAGATCCAGCCAGCAAGATCTGCGATAGCATCAGACCAAGCCTAAGCAGT

CTGGGGAGCAGCCTCAATTCAAGTCAG - UNI31620 - CTCCCATCAGTGGATAGAGAACTCAACACTGTTACTGAAGTCGACAAAACTGATCTGGA

GAGCCTCGTCAAAAGG GGGTATACGACAATTGATGAAATACCCAATACAATACAAAACCAAACTGTGGATGTCATCAAAG ACGTCAAAAATACCTTGG

ACTCCATTAGCTCCAACATTAAGGACATGAGCCAAAGTATTCCTATTGAGGATATGCTGTTACAGGTCTCCCATTACCTTAATAACAGCAACAGATACTT

AAACCAGGAGCTGCCCAAGCTGGAAGAATATGACTCGTACTG GTGGCTGGGTGGCTTGATTGTCTGCTTTCTGCTGACTCTCATTGTGACCTTCTTTTT

CCTGGGCTTGCTGTGTGGTGTGTTTGGCTATGACAAGCATGCCACCCCAACTAGAAGAGGCTGTGTGTCCAACACTGGAGGCATCTTCCTCATGGC TGG

GGTTGGATTCGGCTTCCTTTTTTGCTGGATATTGATGATCCTTGTGGTTCTTACGTTTGTTGTTGGTGCAAATGTGGAAAAGTTGCTCTGCGAACCTTAT

GAAAACAAGAAATTATTACAG GTTTTGGACACTCCCTATCTGCTCAAGGAACAATGGCAATTTTATCTTTCTGGCATGCTATTCAATAACCCAGACATT

AACATGACCTTTGAGCAAGTCTACAG GGATTGCAAAAGAGGTCGAGGTATATATGCTGCTTTTCAGCTTGAGAATGTCGTCAACGTCAGTGATCATTTC

AACATTGACCAG ATTTCTGAAAACATAAATACGGAGTTGGAAAACCTGAATGTGAACATTGATAGCATTGAACTGTTGGATAACACAGGAAGGAAGAGC

CTCGAGGACTTTGCACATTCTGGGATAGATACAATCGATTATTCCACATACTTGAAGGAG ACTGAGAAATCCCCTACTGAAGTGAATCTGCTGACATTT

GCCTCTACCCTGGAAGCAAAAGCAAACCAGTTG CCTGAAGGAAAGCTGAAACAGGCCTTCTTACTGGATGTACAGAATATAAGAGCCATCCACCAGCAT

CTCCTCCCTCCTGTGCAGCAATCACTG AATACGTTAAGACAAAGTGTCTGGACCCTCCAGCAAACAAGCAACAAGTTGCCG GAGAAAGTGAAGAAGAT

CCTTGCCTCTTTGGACTCTGTTCAGCATTTCCTCACCAATAACGTTTCCCTCATCGTTATCGGG GAAACGAAGAAGTTTGGGAAAACAATACTAGGCTA

CTTTGAACATTATCTGCACTGGGTCTTTTATGCC ATCACAGAGAAGATGACATCCTGCAAACCCATGGCCACCGCGATGGACTCTGCTGTTAATGGCAT

TCTGTGTGGCTATGTTGCGGACCCTCTG AATTTGTTCTGGTTCGGCATAGGGAAAGCCACGGTGCTCTTACTTCCGGCTGTAATCATTGCTATCAAGCT

GGCCAAGTACTATCGCAGGATGGATTCAGAGGATGTATACGACGA TGTTGAGACTGTGCCCATGAAAAA TTTGGAAATCGGTAGTAATGGTTATCATA

AAGATCATTTATATGGTGTTCACAATCCTGTTATGACAAG CCCGTCTCGATACTGACAACTGGAGTTGAAGCTGCTTGAA CAACAAGATAGTCAACAT

GGAAAGCATCACAGATTTTGGATAGTTTCTGAGTCTTCTAGAACGTTCCAAGTGCAGAAGAAACCTGGTGGAGACTCAGGCGGGCACTAGGAACATGGCA

TCAGTGGTCTTAGGGTAGCACTTTGTCAGGAATGAACAGTCATCATGGTTATAATCCACATATCCATTGCAACTCATGAATGATTCTCTCCTGTTTTGTT

TTTAACTTTTCTTTTTACACTGATTTTCTATTTAGACACTAAAACATATAGGGGTGCTTATTCCCCCTGGATACATTTACCTGTGAACCAGCTATTCCGG

TGTCATAGCTGGGTACCTAACTTACTTCCATATGTGAAGTGTGCTAAACACAAACCAGTTTACAGAAGAGATGTATTTTGTGTATAGTAAACTGTATATA

TACCCTTTTACCACAGTCAGTTTTTTAAACAAATGAATACTCTAGATTTTTCTTCTAAATGAGGTTACTGTTGGGGTGGTTGTGACCTAGTGATGCTGTA

GAAAGGAGTCTGCATTCACTAAAAGTGTGTCAACCTAGAGCAGGCAATGCCCTTCCTTGTGGATTTCTGTCTGCTCGTTTTGGAGCTACCTGCGGTTTAG

AAATAGAATTCAAGAACAATCACGGAGTTTCCCACTTGATGCCACTGCCAAAGTCAGAACAAGGGATCTTGAGAGAAGGAACTGTCGCTCAGCTGGGAGC

GGAATCATTATCGCAATCACAGGTCCTGGTTCACAGTTTAGTGGCACTCTCTGGTTTGTAAGAATGGGCATTACGTTCAGTGTCATCTGGTCATCTGTGA

TGTGTGTCATCAGCCTGTCCTGATGTTGAGATTTAAAATAAAGCATGAATGAACAGA
Translation
 MALVFSALLLLGLCGKISSEGQPAFHNTPGAMNYELPTTKYETQDTFNAGIVGPLYKMVHIFLNVVQPNDFPLD DLIKKLIQNKNFDISVDSKE PEI

IVLALK IALYEIGVLICAILGLLFIILMPLVGCFFCMCRCCNKCGGEMHQRQKQNAPCRRKCLGLSLLVICLLMS SLGIIYGFVANQQTRTRIKGTQK

LAKSNFRDFQTLLTETPK QIDYVVEQYTNTKNKAFSDLDG - UNI31620 - GIGSVLGGRIKDQLKPKVTPVLEEIKAMATA - UNI31620 - 

AIKQTKDALQNMSSSLKSLQDAATQLNTNLSSVRNSIENSLSSSDCTSDPASKICDSIRPSLSSLGSSLNSSQ - UNI31620 - LPSVDRELNTVTE

VDKTDLESLVKR GYTTIDEIPNTIQNQTVDVIKD DVKNTLDSISSNIKDMSQSIPIEDMLLQVSHYLNNSNRYLNQELPKLEEYDSYW WWLGGLIVC

FLLTLIVTFFFLGLLCGVFGYDKHATPTRRGCVSNTGGIFLMA AGVGFGFLFCWILMILVVLTFVVGANVEKLLCEPYENKKLLQ VLDTPYLLKEQWQ

FYLSGMLFNNPDINMTFEQVYR RDCKRGRGIYAAFQLENVVNVSDHFNIDQ ISENINTELENLNVNIDSIELLDNTGRKSLEDFAHSGIDTIDYSTYL

KE TEKSPTEVNLLTFASTLEAKANQL PEGKLKQAFLLDVQNIRAIHQHLLPPVQQSL NTLRQSVWTLQQTSNKLP EKVKKILASLDSVQHFLTNNV

SLIVIG ETKKFGKTILGYFEHYLHWVFYA ITEKMTSCKPMATAMDSAVNGILCGYVADPL NLFWFGIGKATVLLLPAVIIAIKLAKYYRRMDSEDVY

DD DVETVPMKN NLEIGSNGYHKDHLYGVHNPVMTS SPSRY 

For any suggestions or comments, please send an email to unitrap@crg.es