Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000029095 (Ablim2)
Chromosomal location
Chr 5: 36100573 - 36227619 (+)
Description
actin-binding LIM protein 2 Gene [Source:MGI (curated);Acc:Ablim2-007]
RefSeq_dna
NM_177678 
RefSeq_peptide
NP_808346.3 
UniGene
Mm.408756 Mm.254446 
MGI
MGI:2385758 
Uniprot/SWISSPROT
Q8BL65 
Uniprot/SPTREMBL
B2RUF8 Q3U409 Q19VH2 
Human Ortholog
ENSG00000163995 (ABLIM2)
Omim not available
UniTrap UNI22918
Vector Insertion
Chr 5: 36100710 - 36141101
Public Clones D124G11 (ggtc) CMHD-GT_437B2-3 (cmhd) (cmhd) CMHD-GT_448B2-3 (cmhd) IST14575E4 (tigm)
IST11974H6 (tigm) IST11577B6 (tigm) IST14751B7 (tigm) IST14726F7 (tigm)
IST14837H3 (tigm) IST12558E5 (tigm) IST11919F3 (tigm) IST14633C1 (tigm)
Private Clones OST281246 (lexicon) OST136173 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30402
Vector Insertion
Chr 5: 36199830 - 36200474
Public Clones CMHD-GT_398G5-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 56% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000114203
Sequence
GGGTGGAGACAGCCAGCTCTGCAGAAGGGAGCCTCGCTGCAGCAGCACTGCCTGAAGCTGGCCCAGGCAGGCAGATGCCCAGCTGGTGATGCTGTGTTCT

CGGGAAGCTGCAGGGACCAGTGACTTGCTGGAAGAAAGAAACAAAGACAAGAGTATGGAGACTGGCTGGGGCAAGGGTGACACAGGCAGGCCGTCCAGTC

TCCTGCGCTGAGAAGGACTGGAGACAGACCCCGTGCAG GCCGGAGAGAAGCACTACCACCCTTCATGTGCGCTATGCGTCAGGTGCGGCCAGATGTTCT

CAGAGGGCGAGGAGATGTACCTGCAAG GCTCCTCCATCTGGCATCCGGCATGTCGACAGGCAGCCAGGACTGAAGACAAGAGCAAG GAAACCAGGACT

TCTTCGGAGAGCATTGTCTCCGTGCCTGCCTCCAGCACGTCAGGGTCCCCGAGCCGTGTGATCTAC GCAAAGCTTGGCGATGAGATCCTGGACTACAGG

GACTTGGCTGCTCTTCCCAAAAACAAAGCGATCTACAACATCGACCGCCCCGACATGATCTCCTATTCGCCCTACATTAGCCACTCGGCCGTGGGGGACA

GGCAGAGCTATGGCGAG TCACCTCAGTTGCTCTCACCAACGCCGACTGAG GGGGATCAGGATGATCGGTCCTACAAGCAGTGCAGGACCTCCAGCCCC

AGCTCTGCCGGCTCAGTCAGCCTCGGACACTACACCCCAACCTCACGGTCACCCCAGCACTACAGTCGTCCAG ACACTGGCGTAAAAGATAACATCTAT

AGGAAACCCCCTATCTACAAACAGCACG CTGCCAGGCGATTGGACGTGGAGGACAGCAGCTTTGACCAGGACAGCAGGAAG - UNI30402 - AAGA

CAACCTGGCTGCTTCTCAAGGGGGATGCAGACACCAGAACTAACTCTCCAGACCTGGACAGTCAGTCGCTGTCCCTCAGCAGCGGGACTGACCAGGAACC

TCTCCAAAGAATGGCAGGGGACAGCCTCTACTCAC GCTTTCCTTATTCCAAACCTGACACTCTTCCAGGACCCAGGAAGGATGGCCTGGACCTCCGG A

ATGCCAACCTGGCCCCTTGTGGAGCAGACCCGGATGCCAGCTGGGGCACGCGAG AGTATAAG ATATATCCCTATGATTCCCTCATCGTAACAAACCGA

ATTCGTGTGAAACTGCCCAAAGACGTGGACCGGACACGGCTGGAG AGACACCTATCACCTGAGGAGTTCCAAGAAGTGTTTGGGATGAGCATCGAGGAG

TTTGACCGCCTGGCCCTGTGGAAGAGGAATGACCTCAAGAAGAAAGCCTTGCTGTTCTGA
Translation
 MFSEGEEMYLQG GSSIWHPACRQAARTEDKSK ETRTSSESIVSVPASSTSGSPSRVIY AKLGDEILDYRDLAALPKNKAIYNIDRPDMISYSPYIS

HSAVGDRQSYGE SPQLLSPTPTE GDQDDRSYKQCRTSSPSSAGSVSLGHYTPTSRSPQHYSRPD DTGVKDNIYRKPPIYKQHA AARRLDVEDSSFD

QDSRK - UNI30402 - KTTWLLLKGDADTRTNSPDLDSQSLSLSSGTDQEPLQRMAGDSLYSR RFPYSKPDTLPGPRKDGLDLR NANLAPCGADP

DASWGTRE EYK IYPYDSLIVTNRIRVKLPKDVDRTRLE RHLSPEEFQEVFGMSIEEFDRLALWKRNDLKKKALLF
Transcript ENSMUST00000114204
Sequence
GAGGATCCTGCCAGCGCCGCACCTGCCCGCCCGGTCCTCGGGCTGTCGCAGCGCGGGGACCACCCTACTGGGAGCTGCCGCTGACATGAGCGCAG - UN

I22918 - TGTCGCAGCCCCAGGCTGCTCATGCCCCACTGGAGAAGCCGGCCAGCACTGCGATCCTGTGTAATACCTGTGGGAATGTGTGCAAGGGAGA

GGTGCTGCGTGTGCAGAACAAGTACTTCCACATCAGGTGCTTTGTGTGCAAAG CGTGTGGCTGTGACCTGGCTGAGGGTGGCTTCTTCGTGAGGCAGGG

TGAGCACATTTGCACACGTGACTACCAGCGGCTCTATGGCACTCGCTGCTTCAGCTGTGACCGCTTCATTGAAGGCGAAGTGGTGTCGGCGCTTGGGAAG

ACCTACCACCCTGACTGCTTCGTGTGTGCTGTCTGCAG GCTGCCCTTTCCTCCTGGGGACCGTGTGACCTTCAACGGGAAGGAGTGTATGTGCCAGAAG

TGTTCCCCACCCACATTGCTGGGCAACAGTGCTCACGTGGCCCAGGGCCTCCGGA GTTGTGGGGGCTGTGGCTTAGAAATCAAGAATGGCCAGGCCCTG

GTGGCTTTGGACAAGCACTGGCACCTGGGATGCTTCAAGTGCAAGACTTGTGGGAAACTCCTCAATGCAGAGTACATCAGCAA GGACGGGCTGCCCTAC

TGCGAGGCTGATTATCACAGCAAGTTTGGCATCCGCTGCGACGGCTGTGAGAAGTACATCACGGGCCGGGTGCTAGAG GCCGGAGAGAAGCACTACCAC

CCTTCATGTGCGCTATGCGTCAGGTGCGGCCAGATGTTCTCAGAGGGCGAGGAGATGTACCTGCAAG GCTCCTCCATCTGGCATCCGGCATGTCGACAG

GCAGCCAGGACTGAAGACAAGAGCAAG GAAACCAGGACTTCTTCGGAGAGCATTGTCTCCGTGCCTGCCTCCAGCACGTCAGGGTCCCCGAGCCGTGTG

ATCTAC GCAAAGCTTGGCGATGAGATCCTGGACTACAGGGACTTGGCTGCTCTTCCCAAAAACAAAGCGATCTACAACATCGACCGCCCCGACATGATC

TCCTATTCGCCCTACATTAGCCACTCGGCCGTGGGGGACAGGCAGAGCTATGGCGAG GGGGATCAGGATGATCGGTCCTACAAGCAGTGCAGGACCTCC

AGCCCCAGCTCTGCCGGCTCAGTCAGCCTCGGACACTACACCCCAACCTCACGGTCACCCCAGCACTACAGTCGTCCAG CTGGTACTGTGAGTGTTGGT

ACCAGTAGCTGTCTGTCCCTGTCCCAACACCCAAGCCCTACATCCGTGTTCAGACATCATTACATCCCCTACTTCCGAG GCAGCGAAAGTGGCCGTAGC

ACCCCGAGTCTCTCAGTGCACTCCGACAGCAGACCTCCTTCCTCTACCTACCAGCAGGCTCCGAGACACTTCCACGTCCCAG ACACTGGCGTAAAAGAT

AACATCTATAGGAAACCCCCTATCTACAAACAGCACG CTGCCAGGCGATTGGACGTGGAGGACAGCAGCTTTGACCAGGACAGCAGGAAG - UNI304

02 - AAGACAACCTGGCTGCTTCTCAAGGGGGATGCAGACACCAGAACTAACTCTCCAGACCTGGACAGTCAGTCGCTGTCCCTCAGCAGCGGGACTGA

CCAGGAACCTCTCCAAAGAATGGCAGGGGACAGCCTCTACTCAC AGTATAAG ATATATCCCTATGATTCCCTCATCGTAACAAACCGAATTCGTGTGA

AACTGCCCAAAGACGTGGACCGGACACGGCTGGAG AGACACCTATCACCTGAGGAGTTCCAAGAAGTGTTTGGGATGAGCATCGAGGAGTTTGACCGCC

TGGCCCTGTGGAAGAGGAATGACCTCAAGAAGAAAGCCTTGCTGTTCTGACAGCTGCCAACATCTTACCAGGAGCCTGCTGGGGGGGCAGGGCTGAAGGA

CCCCACCAGTCCCCTGAAAATCCCCTCCTGCACCTTGCTCTGCTTCTCTGTGTCAGTAGGGCAGGCAGGGTGCCTGCAGGAGGCAGGGTGGGGCCAGGCC

CTGAGGAGCATCCAGCAGGCATGGTCCCTTGTATAGCAAGGATGCTCTTGCCTGTAGTTTAGGGCCAGGTGCCAGCTTGACCCACTCCTTCCCGCCACAA

CTGGGCATCAGGGCAGTGTTGCAGCCAGCTATCCTAGGAGATAGGGACAGAGCAGTCAGCCAGCCCAGCACCTTTCCGGGGCACCTGGTGTGCCCACACC

TGTGCTAGGCACTGGGGCACAGAGTGTCTGGGACGTGAGTGAAAGACTTGTCAGGGGCAGACTCTGACACAGCAGGAATGGTAAGTGTGAGACTTCTCGG

AGCGTGAGGAGGTACCAAGTAGCCTTGCAGACTGAGGCAGGGGAGCCAGGCCAAAGTCTGCGAGGCAGTGGGACGGAGGTTTTCTACAGTTATTGTGATA

GATCTTTTATGGGGAATGAATGTTGACCTGACAGGGTGCCCCCCGCTAATGCTCTGTGTATTGTGCCCCTCTTCCAGATCACCCCCTTAGTTGCCTAAAT

GATATCTTTCAAGTTACACAGAAGTTTTTATTTTATTAAAAAGTATCGCTTCCTTACACATATGAAGACATATATGCAGAGTTTAGTTTTACGGTCCCTG

AGAAGGGGACCGCCTCCGCCTTACAACTCCCCACCCCACTCCCACCGTGCAGGCCTCTGTGCTTCCAGTCCTCCGCGCTCCTCACAGACAGGAGCCGGTC

TGTTTCCCTTCGTCCCTGCTCCTTTGTATGTGTCACACAGACAGCCTCAAAGACACTCACTCGCTCGCTCAGCAGTGCCGTTTGTAAATACATGTGAAAT

GTATCCATCTCCTTTTCCCTCTGTCATTTTCCCAAGTCGCTAAGAGAAGAGCGCCCCCTGATGGCCAAATCCCTAGAATAAAGGTTTCCCCACTGTG
Translation
MSAV - UNI22918 - VSQPQAAHAPLEKPASTAILCNTCGNVCKGEVLRVQNKYFHIRCFVCKA ACGCDLAEGGFFVRQGEHICTRDYQRLYGTRC

FSCDRFIEGEVVSALGKTYHPDCFVCAVCR RLPFPPGDRVTFNGKECMCQKCSPPTLLGNSAHVAQGLRS SCGGCGLEIKNGQALVALDKHWHLGCFK

CKTCGKLLNAEYISK KDGLPYCEADYHSKFGIRCDGCEKYITGRVLE AGEKHYHPSCALCVRCGQMFSEGEEMYLQG GSSIWHPACRQAARTEDKSK

 ETRTSSESIVSVPASSTSGSPSRVIY AKLGDEILDYRDLAALPKNKAIYNIDRPDMISYSPYISHSAVGDRQSYGE GDQDDRSYKQCRTSSPSSAGS

VSLGHYTPTSRSPQHYSRPA AGTVSVGTSSCLSLSQHPSPTSVFRHHYIPYFRG GSESGRSTPSLSVHSDSRPPSSTYQQAPRHFHVPD DTGVKDNI

YRKPPIYKQHA AARRLDVEDSSFDQDSRK - UNI30402 - KTTWLLLKGDADTRTNSPDLDSQSLSLSSGTDQEPLQRMAGDSLYSQ QYK IYPY

DSLIVTNRIRVKLPKDVDRTRLE RHLSPEEFQEVFGMSIEEFDRLALWKRNDLKKKALLF
Transcript ENSMUST00000114205
Sequence
AGCGGGTACTGTGTGCGCCGAGCCGCTGGCCTCAAGCGTGCTGAGGATCCTGCCAGCGCCGCACCTGCCCGCCCGGTCCTCGGGCTGTCGCAGCGCGGGG

ACCACCCTACTGGGAGCTGCCGCTGACATGAGCGCAG - UNI22918 - TGTCGCAGCCCCAGGCTGCTCATGCCCCACTGGAGAAGCCGGCCAGCAC

TGCGATCCTGTGTAATACCTGTGGGAATGTGTGCAAGGGAGAGGTGCTGCGTGTGCAGAACAAGTACTTCCACATCAGGTGCTTTGTGTGCAAAG CGTG

TGGCTGTGACCTGGCTGAGGGTGGCTTCTTCGTGAGGCAGGGTGAGCACATTTGCACACGTGACTACCAGCGGCTCTATGGCACTCGCTGCTTCAGCTGT

GACCGCTTCATTGAAGGCGAAGTGGTGTCGGCGCTTGGGAAGACCTACCACCCTGACTGCTTCGTGTGTGCTGTCTGCAG GCTGCCCTTTCCTCCTGGG

GACCGTGTGACCTTCAACGGGAAGGAGTGTATGTGCCAGAAGTGTTCCCCACCCACATTGCTGGGCAACAGTGCTCACGTGGCCCAGGGCCTCCGGA GT

TGTGGGGGCTGTGGCTTAGAAATCAAGAATGGCCAGGCCCTGGTGGCTTTGGACAAGCACTGGCACCTGGGATGCTTCAAGTGCAAGACTTGTGGGAAAC

TCCTCAATGCAGAGTACATCAGCAA GGACGGGCTGCCCTACTGCGAGGCTGATTATCACAGCAAGTTTGGCATCCGCTGCGACGGCTGTGAGAAGTACA

TCACGGGCCGGGTGCTAGAG GCCGGAGAGAAGCACTACCACCCTTCATGTGCGCTATGCGTCAGGTGCGGCCAGATGTTCTCAGAGGGCGAGGAGATGT

ACCTGCAAG GCTCCTCCATCTGGCATCCGGCATGTCGACAGGCAGCCAGGACTGAAGACAAGAGCAAG GAAACCAGGACTTCTTCGGAGAGCATTGTC

TCCGTGCCTGCCTCCAGCACGTCAGGGTCCCCGAGCCGTGTGATCTAC GCAAAGCTTGGCGATGAGATCCTGGACTACAGGGACTTGGCTGCTCTTCCC

AAAAACAAAGCGATCTACAACATCGACCGCCCCGACATGATCTCCTATTCGCCCTACATTAGCCACTCGGCCGTGGGGGACAGGCAGAGCTATGGCGAG 

GGGGATCAGGATGATCGGTCCTACAAGCAGTGCAGGACCTCCAGCCCCAGCTCTGCCGGCTCAGTCAGCCTCGGACACTACACCCCAACCTCACGGTCAC

CCCAGCACTACAGTCGTCCAG GCAGCGAAAGTGGCCGTAGCACCCCGAGTCTCTCAGTGCACTCCGACAGCAGACCTCCTTCCTCTACCTACCAGCAGG

CTCCGAGACACTTCCACGTCCCAG ACACTGGCGTAAAAGATAACATCTATAGGAAACCCCCTATCTACAAACAGCACG CTGCCAGGCGATTGGACGTG

GAGGACAGCAGCTTTGACCAGGACAGCAGGAAG - UNI30402 - AAGACAACCTGGCTGCTTCTCAAGGGGGATGCAGACACCAGAACTAACTCTCC

AGACCTGGACAGTCAGTCGCTGTCCCTCAGCAGCGGGACTGACCAGGAACCTCTCCAAAGAATGGCAGGGGACAGCCTCTACTCAC AGTATAAG ATAT

ATCCCTATGATTCCCTCATCGTAACAAACCGAATTCGTGTGAAACTGCCCAAAGACGTGGACCGGACACGGCTGGAG AGACACCTATCACCTGAGGAGT

TCCAAGAAGTGTTTGGGATGAGCATCGAGGAGTTTGACCGCCTGGCCCTGTGGAAGAGGAATGACCTCAAGAAGAAAGCCTTGCTGTTCTGACAGCTGCC

AACATCTTACCAGGAGCCTGCTGGGGGGGCAGGGCTGAAGGACCCCACCAGTCCCCTGAAAATCCCCTCCTGCACCTTGCTCTGCTTCTCTGTGTCAGTA

GGGCAGGCAGGGTGCCTGCAGGAGGCAGGGTGGGGCCAGGCCCTGAGGAGCATCCAGCAGGCATGGTCCCTTGTATAGCAAGGATGCTCTTGCCTGTAGT

TTAGGGCCAGGTGCCAGCTTGACCCACTCCTTCCCGCCACAACTGGGCATCAGGGCAGTGTTGCAGCCAGCTATCCTAGGAGATAGGGACAGAGCAGTCA

GCCAGCCCAGCACCTTTCCGGGGCACCTGGTGTGCCCACACCTGTGCTAGGCACTGGGGCACAGAGTGTCTGGGACGTGAGTGAAAGACTTGTCAGGGGC

AGACTCTGACACAGCAGGAATGGTAAGTGTGAGACTTCTCGGAGCGTGAGGAGGTACCAAGTAGCCTTGCAGACTGAGGCAGGGGAGCCAGGCCAAAGTC

TGCGAGGCAGTGGGACGGAGGTTTTCTACAGTTATTGTGATAGATCTTTTATGGGGAATGAATGTTGACCTGACAGGGTGCCCCCCGCTAATGCTCTGTG

TATTGTGCCCCTCTTCCAGATCACCCCCTTAGTTGCCTAAATGATATCTTTCAAGTTACACAGAAGTTTTTATTTTATTAAAAAGTATCGCTTCCTTACA

CATATGAAGACATATATGCAGA
Translation
MSAV - UNI22918 - VSQPQAAHAPLEKPASTAILCNTCGNVCKGEVLRVQNKYFHIRCFVCKA ACGCDLAEGGFFVRQGEHICTRDYQRLYGTRC

FSCDRFIEGEVVSALGKTYHPDCFVCAVCR RLPFPPGDRVTFNGKECMCQKCSPPTLLGNSAHVAQGLRS SCGGCGLEIKNGQALVALDKHWHLGCFK

CKTCGKLLNAEYISK KDGLPYCEADYHSKFGIRCDGCEKYITGRVLE AGEKHYHPSCALCVRCGQMFSEGEEMYLQG GSSIWHPACRQAARTEDKSK

 ETRTSSESIVSVPASSTSGSPSRVIY AKLGDEILDYRDLAALPKNKAIYNIDRPDMISYSPYISHSAVGDRQSYGE GDQDDRSYKQCRTSSPSSAGS

VSLGHYTPTSRSPQHYSRPG GSESGRSTPSLSVHSDSRPPSSTYQQAPRHFHVPD DTGVKDNIYRKPPIYKQHA AARRLDVEDSSFDQDSRK - UN

I30402 - KTTWLLLKGDADTRTNSPDLDSQSLSLSSGTDQEPLQRMAGDSLYSQ QYK IYPYDSLIVTNRIRVKLPKDVDRTRLE RHLSPEEFQEV

FGMSIEEFDRLALWKRNDLKKKALLF
Transcript ENSMUST00000101280
Sequence
ACTGTGTGCGCCGAGCCGCTGGCCTCAAGCGTGCTGAGGATCCTGCCAGCGCCGCACCTGCCCGCCCGGTCCTCGGGCTGTCGCAGCGCGGGGACCACCC

TACTGGGAGCTGCCGCTGACATGAGCGCAG - UNI22918 - TGTCGCAGCCCCAGGCTGCTCATGCCCCACTGGAGAAGCCGGCCAGCACTGCGATC

CTGTGTAATACCTGTGGGAATGTGTGCAAGGGAGAGGTGCTGCGTGTGCAGAACAAGTACTTCCACATCAGGTGCTTTGTGTGCAAAG CGTGTGGCTGT

GACCTGGCTGAGGGTGGCTTCTTCGTGAGGCAGGGTGAGCACATTTGCACACGTGACTACCAGCGGCTCTATGGCACTCGCTGCTTCAGCTGTGACCGCT

TCATTGAAGGCGAAGTGGTGTCGGCGCTTGGGAAGACCTACCACCCTGACTGCTTCGTGTGTGCTGTCTGCAG GCTGCCCTTTCCTCCTGGGGACCGTG

TGACCTTCAACGGGAAGGAGTGTATGTGCCAGAAGTGTTCCCCACCCACATTGCTGGGCAACAGTGCTCACGTGGCCCAGGGCCTCCGGA GTTGTGGGG

GCTGTGGCTTAGAAATCAAGAATGGCCAGGCCCTGGTGGCTTTGGACAAGCACTGGCACCTGGGATGCTTCAAGTGCAAGACTTGTGGGAAACTCCTCAA

TGCAGAGTACATCAGCAA GGACGGGCTGCCCTACTGCGAGGCTGATTATCACAGCAAGTTTGGCATCCGCTGCGACGGCTGTGAGAAGTACATCACGGG

CCGGGTGCTAGAG GCCGGAGAGAAGCACTACCACCCTTCATGTGCGCTATGCGTCAGGTGCGGCCAGATGTTCTCAGAGGGCGAGGAGATGTACCTGCA

AG GCTCCTCCATCTGGCATCCGGCATGTCGACAGGCAGCCAGGACTGAAGACAAGAGCAAG ATGCACAGCTCTGTTTGCAGCCAGCCCTGCCCGGGCA

CCCTGCCCTGTGCCTTACAG GAAACCAGGACTTCTTCGGAGAGCATTGTCTCCGTGCCTGCCTCCAGCACGTCAGGGTCCCCGAGCCGTGTGATCTAC 

GCAAAGCTTGGCGATGAGATCCTGGACTACAGGGACTTGGCTGCTCTTCCCAAAAACAAAGCGATCTACAACATCGACCGCCCCGACATGATCTCCTATT

CGCCCTACATTAGCCACTCGGCCGTGGGGGACAGGCAGAGCTATGGCGAG GGGGATCAGGATGATCGGTCCTACAAGCAGTGCAGGACCTCCAGCCCCA

GCTCTGCCGGCTCAGTCAGCCTCGGACACTACACCCCAACCTCACGGTCACCCCAGCACTACAGTCGTCCAG CTGGTACTGTGAGTGTTGGTACCAGTA

GCTGTCTGTCCCTGTCCCAACACCCAAGCCCTACATCCGTGTTCAGACATCATTACATCCCCTACTTCCGAG GCAGCGAAAGTGGCCGTAGCACCCCGA

GTCTCTCAGTGCACTCCGACAGCAGACCTCCTTCCTCTACCTACCAGCAGGCTCCGAGACACTTCCACGTCCCAG CTGCCAGGCGATTGGACGTGGAGG

ACAGCAGCTTTGACCAGGACAGCAGGAAG - UNI30402 - AAGACAACCTGGCTGCTTCTCAAGGGGGATGCAGACACCAGAACTAACTCTCCAGAC

CTGGACAGTCAGTCGCTGTCCCTCAGCAGCGGGACTGACCAGGAACCTCTCCAAAGAATGGCAGGGGACAGCCTCTACTCAC AGTATAAG ATATATCC

CTATGATTCCCTCATCGTAACAAACCGAATTCGTGTGAAACTGCCCAAAGACGTGGACCGGACACGGCTGGAG AGACACCTATCACCTGAGGAGTTCCA

AGAAGTGTTTGGGATGAGCATCGAGGAGTTTGACCGCCTGGCCCTGTGGAAGAGGAATGACCTCAAGAAGAAAGCCTTGCTGTTCTGACAGCTGCCAACA

TCTTACCAGGAGCCTGCTGGGGGGGCAGGGCTGAAGGACCCCACCAGTCCCCTGAAAATCCCCTCCTGCACCTTGCTCTGCTTCTCTGTGTCAGTAGGGC

AGGCAGGGTGCCTGCAGGAGGCAGGGTGGGGCCAGGCCCTGAGGAGCATCCAGCAGGCATGGTCCCTTGTATAGCAAGGATGCTCTTGCCTGTAGTTTAG

GGCCAGGTGCCAGCTTGACCCACTCCTTCCCGCCACAACTGGGCATCAGGGCAGTGTTGCAGCCAGCTATCCTAGGAGATAGGGACAGAGCAGTCAGCCA

GCCCAGCACCTTTCCGGGGCACCTGGTGTGCCCACACCTGTGCTAGGCACTGGGGCACAGAGTGTCTGGGACGTGAGTGAAAGACTTGTCAGGGGCAGAC

TCTGACACAGCAGGAATGGTAAGTGTGAGACTTCTCGGAGCGTGAGGAGGTACCAAGTAGCCTTGCAGACTGAGGCAGGGGAGCCAGGCCAAAGTCTGCG

AGGCAGTGGGACGGAGGTTTTCTACAGTTATTGTGATAGATCTTTTATGGGGAATGAATGTTGACCTGACAGGGTGCCCCCCGCTAATGCTCTGTGTATT

GTGCCCCTCTTCCAGATCACCCCCTTAGTTGCCTAAATGATATCTTTCAAGTTACACAGAAGTTTTTATTTTATTAAAAAGTATCGCTTCCTTACACATA

TGAAGACATATATGCAGAGTTTAGTTTTACGGTCCCTGAGAAGGGGACCGCCTCCGCCTTACAACTCCCCACCCCACTCCCACCGTGCAGGCCTCTGTGC

TTCCAGTCCTCCGCGCTCCTCACAGACAGGAGCCGGTCTGTTTCCCTTCGTCCCTGCTCCTTTGTATGTGTCACACAGACAGCCTCAAAGACACTCACTC

GCTCGCTCAGCAGTGCCGTTTGTAAATACATGTGAAATGTATCCATCTCCTTTTCCCTCTGTCATTTTCCCAAGTCGCTAAGAGAAGAGCGCCCCCTGAT

GGCCAAATCCCTAGAATAAAGGTTTCCCCACTGTGGCCTAGTCTCACATCAACCTGACCAGTCTTCCCAGTAAAGACACTCACTGTAGCCCTCCACCACA

TAAAACACGCATGCCCAGGAAGCATGCTGTCACGTGACACAGCCATTGACTGCAGCGGCAGAGATGGACAGCTAGAGGCGGTGCCTCCTCCAACCTGGGT

GTCTAGAAGTGGGGGCTAACTGGGGCCCTGGTAGCGGGTATGGAAGAGCACCCCTGCTGCAGAATGGGTGGACACTGTGGTCCTGGGTGACTCTAGCTGT

CCCCTCCTCTGGGTTGCCCTCACTTTCTCACATCCCGGGACATGTGTTGAGTCTCATTTTGTGCTGGGGTTCTCACCAGCCTGGCTGGGCCGTGGAGGGG

AACTTTTGGTACTTAATCTGCTTCCTGCCACTTAGCAGTCTGGACCTGCGCAACTGGAAAACCCCCACCTCCTCACTCATGAGGTGTCATGTCATGTCTG

ATCCCTGGGACACCTGGGAAAATAAATGGTGACACACTG
Translation
MSAV - UNI22918 - VSQPQAAHAPLEKPASTAILCNTCGNVCKGEVLRVQNKYFHIRCFVCKA ACGCDLAEGGFFVRQGEHICTRDYQRLYGTRC

FSCDRFIEGEVVSALGKTYHPDCFVCAVCR RLPFPPGDRVTFNGKECMCQKCSPPTLLGNSAHVAQGLRS SCGGCGLEIKNGQALVALDKHWHLGCFK

CKTCGKLLNAEYISK KDGLPYCEADYHSKFGIRCDGCEKYITGRVLE AGEKHYHPSCALCVRCGQMFSEGEEMYLQG GSSIWHPACRQAARTEDKSK

 MHSSVCSQPCPGTLPCALQ ETRTSSESIVSVPASSTSGSPSRVIY AKLGDEILDYRDLAALPKNKAIYNIDRPDMISYSPYISHSAVGDRQSYGE G

DQDDRSYKQCRTSSPSSAGSVSLGHYTPTSRSPQHYSRPA AGTVSVGTSSCLSLSQHPSPTSVFRHHYIPYFRG GSESGRSTPSLSVHSDSRPPSSTY

QQAPRHFHVPA AARRLDVEDSSFDQDSRK - UNI30402 - KTTWLLLKGDADTRTNSPDLDSQSLSLSSGTDQEPLQRMAGDSLYSQ QYK IYPY

DSLIVTNRIRVKLPKDVDRTRLE RHLSPEEFQEVFGMSIEEFDRLALWKRNDLKKKALLF
Transcript ENSMUST00000054598
Sequence
ACTGTGTGCGCCGAGCCGCTGGCCTCAAGCGTGCTGAGGATCCTGCCAGCGCCGCACCTGCCCGCCCGGTCCTCGGGCTGTCGCAGCGCGGGGACCACCC

TACTGGGAGCTGCCGCTGACATGAGCGCAG - UNI22918 - TGTCGCAGCCCCAGGCTGCTCATGCCCCACTGGAGAAGCCGGCCAGCACTGCGATC

CTGTGTAATACCTGTGGGAATGTGTGCAAGGGAGAGGTGCTGCGTGTGCAGAACAAGTACTTCCACATCAGGTGCTTTGTGTGCAAAG CGTGTGGCTGT

GACCTGGCTGAGGGTGGCTTCTTCGTGAGGCAGGGTGAGCACATTTGCACACGTGACTACCAGCGGCTCTATGGCACTCGCTGCTTCAGCTGTGACCGCT

TCATTGAAGGCGAAGTGGTGTCGGCGCTTGGGAAGACCTACCACCCTGACTGCTTCGTGTGTGCTGTCTGCAG GCTGCCCTTTCCTCCTGGGGACCGTG

TGACCTTCAACGGGAAGGAGTGTATGTGCCAGAAGTGTTCCCCACCCACATTGCTGGGCAACAGTGCTCACGTGGCCCAGGGCCTCCGGA GTTGTGGGG

GCTGTGGCTTAGAAATCAAGAATGGCCAGGCCCTGGTGGCTTTGGACAAGCACTGGCACCTGGGATGCTTCAAGTGCAAGACTTGTGGGAAACTCCTCAA

TGCAGAGTACATCAGCAA GGACGGGCTGCCCTACTGCGAGGCTGATTATCACAGCAAGTTTGGCATCCGCTGCGACGGCTGTGAGAAGTACATCACGGG

CCGGGTGCTAGAG GCCGGAGAGAAGCACTACCACCCTTCATGTGCGCTATGCGTCAGGTGCGGCCAGATGTTCTCAGAGGGCGAGGAGATGTACCTGCA

AG GCTCCTCCATCTGGCATCCGGCATGTCGACAGGCAGCCAGGACTGAAGACAAGAGCAAG GAAACCAGGACTTCTTCGGAGAGCATTGTCTCCGTGC

CTGCCTCCAGCACGTCAGGGTCCCCGAGCCGTGTGATCTAC GCAAAGCTTGGCGATGAGATCCTGGACTACAGGGACTTGGCTGCTCTTCCCAAAAACA

AAGCGATCTACAACATCGACCGCCCCGACATGATCTCCTATTCGCCCTACATTAGCCACTCGGCCGTGGGGGACAGGCAGAGCTATGGCGAG GGGGATC

AGGATGATCGGTCCTACAAGCAGTGCAGGACCTCCAGCCCCAGCTCTGCCGGCTCAGTCAGCCTCGGACACTACACCCCAACCTCACGGTCACCCCAGCA

CTACAGTCGTCCAG GCAGCGAAAGTGGCCGTAGCACCCCGAGTCTCTCAGTGCACTCCGACAGCAGACCTCCTTCCTCTACCTACCAGCAGGCTCCGAG

ACACTTCCACGTCCCAG ACACTGGCGTAAAAGATAACATCTATAGGAAACCCCCTATCTACAAACAGCACG CTGCCAGGCGATTGGACGTGGAGGACA

GCAGCTTTGACCAGGACAGCAGGAAG - UNI30402 - AAGACAACCTGGCTGCTTCTCAAGGGGGATGCAGACACCAGAACTAACTCTCCAGACCTG

GACAGTCAGTCGCTGTCCCTCAGCAGCGGGACTGACCAGGAACCTCTCCAAAGAATGGCAGGGGACAGCCTCTACTCAC GCTTTCCTTATTCCAAACCT

GACACTCTTCCAGGACCCAGGAAGGATGGCCTGGACCTCCGG AATGCCAACCTGGCCCCTTGTGGAGCAGACCCGGATGCCAGCTGGGGCACGCGAG A

GTATAAG ATATATCCCTATGATTCCCTCATCGTAACAAACCGAATTCGTGTGAAACTGCCCAAAGACGTGGACCGGACACGGCTGGAG AGACACCTAT

CACCTGAGGAGTTCCAAGAAGTGTTTGGGATGAGCATCGAGGAGTTTGACCGCCTGGCCCTGTGGAAGAGGAATGACCTCAAGAAGAAAGCCTTGCTGTT

CTGACAGCTGCCAACATCTTACCAGGAGCCTGCTGGGGGGGCAGGGCTGAAGGACCCCACCAGTCCCCTGAAAATCCCCTCCTGCACCTTGCTCTGCTTC

TCTGTGTCAGTAGGGCAGGCAGGGTGCCTGCAGGAGGCAGGGTGGGGCCAGGCCCTGAGGAGCATCCAGCAGGCATGGTCCCTTGTATAGCAAGGATGCT

CTTGCCTGTAGTTTAGGGCCAGGTGCCAGCTTGACCCACTCCTTCCCGCCACAACTGGGCATCAGGGCAGTGTTGCAGCCAGCTATCCTAGGAGATAGGG

ACAGAGCAGTCAGCCAGCCCAGCACCTTTCCGGGGCACCTGGTGTGCCCACACCTGTGCTAGGCACTGGGGCACAGAGTGTCTGGGACGTGAGTGAAAGA

CTTGTCAGGGGCAGACTCTGACACAGCAGGAATGGTAAGTGTGAGACTTCTCGGAGCGTGAGGAGGTACCAAGTAGCCTTGCAGACTGAGGCAGGGGAGC

CAGGCCAAAGTCTGCGAGGCAGTGGGACGGAGGTTTTCTACAGTTATTGTGATAGATCTTTTATGGGGAATGAATGTTGACCTGACAGGGTGCCCCCCGC

TAATGCTCTGTGTATTGTGCCCCTCTTCCAGATCACCCCCTTAGTTGCCTAAATGATATCTTTCAAGTTACACAGAAGTTTTTATTTTATTAAAAAGTAT

CGCTTCCTTACACATATGAAGACATATATGCAGAGTTTAGTTTTACGGTCCCTGAGAAGGGGACCGCCTCCGCCTTACAACTCCCCACCCCACTCCCACC

GTGCAGGCCTCTGTGCTTCCAGTCCTCCGCGCTCCTCACAGACAGGAGCCGGTCTGTTTCCCTTCGTCCCTGCTCCTTTGTATGTGTCACACAGACAGCC

TCAAAGACACTCACTCGCTCGCTCAGCAGTGCCGTTTGTAAATACATGTGAAATGTATCCATCTCCTTTTCCCTCTGTCATTTTCCCAAGTCGCTAAGAG

AAGAGCGCCCCCTGATGGCCAAATCCCTAGAATAAAGGTTTCCCCACTGTGGCCTAGTCTCACATCAACCTGACCAGTCTTCCCAGTAAAGACACTCACT

GTAGCCCTCCACCACATAAAACACGCATGCCCAGGAAGCATGCTGTCACGTGACACAGCCATTGACTGCAGCGGCAGAGATGGACAGCTAGAGGCGGTGC

CTCCTCCAACCTGGGTGTCTAGAAGTGGGGGCTAACTGGGGCCCTGGTAGCGGGTATGGAAGAGCACCCCTGCTGCAGAATGGGTGGACACTGTGGTCCT

GGGTGACTCTAGCTGTCCCCTCCTCTGGGTTGCCCTCACTTTCTCACATCCCGGGACATGTGTTGAGTCTCATTTTGTGCTGGGGTTCTCACCAGCCTGG

CTGGGCCGTGGAGGGGAACTTTTGGTACTTAATCTGCTTCCTGCCACTTAGCAGTCTGGACCTGCGCAACTGGAAAACCCCCACCTCCTCACTCATGAGG

TGTCATGTCATGTCTGATCCCTGGGACACCTGGGAAAATAAATGGTGACACACTG
Translation
MSAV - UNI22918 - VSQPQAAHAPLEKPASTAILCNTCGNVCKGEVLRVQNKYFHIRCFVCKA ACGCDLAEGGFFVRQGEHICTRDYQRLYGTRC

FSCDRFIEGEVVSALGKTYHPDCFVCAVCR RLPFPPGDRVTFNGKECMCQKCSPPTLLGNSAHVAQGLRS SCGGCGLEIKNGQALVALDKHWHLGCFK

CKTCGKLLNAEYISK KDGLPYCEADYHSKFGIRCDGCEKYITGRVLE AGEKHYHPSCALCVRCGQMFSEGEEMYLQG GSSIWHPACRQAARTEDKSK

 ETRTSSESIVSVPASSTSGSPSRVIY AKLGDEILDYRDLAALPKNKAIYNIDRPDMISYSPYISHSAVGDRQSYGE GDQDDRSYKQCRTSSPSSAGS

VSLGHYTPTSRSPQHYSRPG GSESGRSTPSLSVHSDSRPPSSTYQQAPRHFHVPD DTGVKDNIYRKPPIYKQHA AARRLDVEDSSFDQDSRK - UN

I30402 - KTTWLLLKGDADTRTNSPDLDSQSLSLSSGTDQEPLQRMAGDSLYSR RFPYSKPDTLPGPRKDGLDLR NANLAPCGADPDASWGTRE E

YK IYPYDSLIVTNRIRVKLPKDVDRTRLE RHLSPEEFQEVFGMSIEEFDRLALWKRNDLKKKALLF
Transcript ENSMUST00000114206
Sequence
ACTGTGTGCGCCGAGCCGCTGGCCTCAAGCGTGCTGAGGATCCTGCCAGCGCCGCACCTGCCCGCCCGGTCCTCGGGCTGTCGCAGCGCGGGGACCACCC

TACTGGGAGCTGCCGCTGACATGAGCGCAG - UNI22918 - TGTCGCAGCCCCAGGCTGCTCATGCCCCACTGGAGAAGCCGGCCAGCACTGCGATC

CTGTGTAATACCTGTGGGAATGTGTGCAAGGGAGAGGTGCTGCGTGTGCAGAACAAGTACTTCCACATCAGGTGCTTTGTGTGCAAAG CGTGTGGCTGT

GACCTGGCTGAGGGTGGCTTCTTCGTGAGGCAGGGTGAGCACATTTGCACACGTGACTACCAGCGGCTCTATGGCACTCGCTGCTTCAGCTGTGACCGCT

TCATTGAAGGCGAAGTGGTGTCGGCGCTTGGGAAGACCTACCACCCTGACTGCTTCGTGTGTGCTGTCTGCAG GCTGCCCTTTCCTCCTGGGGACCGTG

TGACCTTCAACGGGAAGGAGTGTATGTGCCAGAAGTGTTCCCCACCCACATTGCTGGGCAACAGTGCTCACGTGGCCCAGGGCCTCCGGA GTTGTGGGG

GCTGTGGCTTAGAAATCAAGAATGGCCAGGCCCTGGTGGCTTTGGACAAGCACTGGCACCTGGGATGCTTCAAGTGCAAGACTTGTGGGAAACTCCTCAA

TGCAGAGTACATCAGCAA GGACGGGCTGCCCTACTGCGAGGCTGATTATCACAGCAAGTTTGGCATCCGCTGCGACGGCTGTGAGAAGTACATCACGGG

CCGGGTGCTAGAG GCCGGAGAGAAGCACTACCACCCTTCATGTGCGCTATGCGTCAGGTGCGGCCAGATGTTCTCAGAGGGCGAGGAGATGTACCTGCA

AG GCTCCTCCATCTGGCATCCGGCATGTCGACAGGCAGCCAGGACTGAAGACAAGAGCAAG GAAACCAGGACTTCTTCGGAGAGCATTGTCTCCGTGC

CTGCCTCCAGCACGTCAGGGTCCCCGAGCCGTGTGATCTAC GCAAAGCTTGGCGATGAGATCCTGGACTACAGGGACTTGGCTGCTCTTCCCAAAAACA

AAGCGATCTACAACATCGACCGCCCCGACATGATCTCCTATTCGCCCTACATTAGCCACTCGGCCGTGGGGGACAGGCAGAGCTATGGCGAG TCACCTC

AGTTGCTCTCACCAACGCCGACTGAG GGGGATCAGGATGATCGGTCCTACAAGCAGTGCAGGACCTCCAGCCCCAGCTCTGCCGGCTCAGTCAGCCTCG

GACACTACACCCCAACCTCACGGTCACCCCAGCACTACAGTCGTCCAG CTGGTACTGTGAGTGTTGGTACCAGTAGCTGTCTGTCCCTGTCCCAACACC

CAAGCCCTACATCCGTGTTCAGACATCATTACATCCCCTACTTCCGAG GCAGCGAAAGTGGCCGTAGCACCCCGAGTCTCTCAGTGCACTCCGACAGCA

GACCTCCTTCCTCTACCTACCAGCAGGCTCCGAGACACTTCCACGTCCCAG ACACTGGCGTAAAAGATAACATCTATAGGAAACCCCCTATCTACAAAC

AGCACG CTGCCAGGCGATTGGACGTGGAGGACAGCAGCTTTGACCAGGACAGCAGGAAG - UNI30402 - AAGACAACCTGGCTGCTTCTCAAGGG

GGATGCAGACACCAGAACTAACTCTCCAGACCTGGACAGTCAGTCGCTGTCCCTCAGCAGCGGGACTGACCAGGAACCTCTCCAAAGAATGGCAGGGGAC

AGCCTCTACTCAC AGTATAAG ATATATCCCTATGATTCCCTCATCGTAACAAACCGAATTCGTGTGAAACTGCCCAAAGACGTGGACCGGACACGGCT

GGAG AGACACCTATCACCTGAGGAGTTCCAAGAAGTGTTTGGGATGAGCATCGAGGAGTTTGACCGCCTGGCCCTGTGGAAGAGGAATGACCTCAAGAA

GAAAGCCTTGCTGTTCTGACAGCTGCCAACATCTTACCAGGAGCCTGCTGGGGGGGCAGGGCTGAAGGACCCCACCAGTCCCCTGAAAATCCCCTCCTGC

ACCTTGCTCTGCTTCTCTGTGTCAGTAGGGCAGGCAGGGTGCCTGCAGGAGGCAGGGTGGGGCCAGGCCCTGAGGAGCATCCAGCAGGCATGGTCCCTTG

TATAGCAAGGATGCTCTTGCCTGTAGTTTAGGGCCAGGTGCCAGCTTGACCCACTCCTTCCCGCCACAACTGGGCATCAGGGCAGTGTTGCAGCCAGCTA

TCCTAGGAGATAGGGACAGAGCAGTCAGCCAGCCCAGCACCTTTCCGGGGCACCTGGTGTGCCCACACCTGTGCTAGGCACTGGGGCACAGAGTGTCTGG

GACGTGAGTGAAAGACTTGTCAGGGGCAGACTCTGACACAGCAGGAATGGTAAGTGTGAGACTTCTCGGAGCGTGAGGAGGTACCAAGTAGCCTTGCAGA

CTGAGGCAGGGGAGCCAGGCCAAAGTCTGCGAGGCAGTGGGACGGAGGTTTTCTACAGTTATTGTGATAGATCTTTTATGGGGAATGAATGTTGACCTGA

CAGGGTGCCCCCCGCTAATGCTCTGTGTATTGTGCCCCTCTTCCAGATCACCCCCTTAGTTGCCTAAATGATATCTTTCAAGTTACACAGAAGTTTTTAT

TTTATTAAAAAGTATCGCTTCCTTACACATATGAAGACATATATGCAGAGTTTAGTTTTACGGTCCCTGAGAAGGGGACCGCCTCCGCCTTACAACTCCC

CACCCCACTCCCACCGTGCAGGCCTCTGTGCTTCCAGTCCTCCGCGCTCCTCACAGACAGGAGCCGGTCTGTTTCCCTTCGTCCCTGCTCCTTTGTATGT

GTCACACAGACAGCCTCAAAGACACTCACTCGCTCGCTCAGCAGTGCCGTTTGTAAATACATGTGAAATGTATCCATCTCCTTTTCCCTCTGTCATTTTC

CCAAGTCGCTAAGAGAAGAGCGCCCCCTGATGGCCAAATCCCTAGAATAAAGGTTTCCCCACTGTGGCCTAGTCTCACATCAACCTGACCAGTCTTCCCA

GTAAAGACACTCACTGTAGCCCTCCACCACATAAAACACGCATGCCCAGGAAGCATGCTGTCACGTGACACAGCCATTGACTGCAGCGGCAGAGATGGAC

AGCTAGAGGCGGTGCCTCCTCCAACCTGGGTGTCTAGAAGTGGGGGCTAACTGGGGCCCTGGTAGCGGGTATGGAAGAGCACCCCTGCTGCAGAATGGGT

GGACACTGTGGTCCTGGGTGACTCTAGCTGTCCCCTCCTCTGGGTTGCCCTCACTTTCTCACATCCCGGGACATGTGTTGAGTCTCATTTTGTGCTGGGG

TTCTCACCAGCCTGGCTGGGCCGTGGAGGGGAACTTTTGGTACTTAATCTGCTTCCTGCCACTTAGCAGTCTGGACCTGCGCAACTGGAAAACCCCCACC

TCCTCACTCATGAGGTGTCATGTCATGTCTGATCCCTGGGACACCTGGGAAAATAAATGGTGACACACTG
Translation
MSAV - UNI22918 - VSQPQAAHAPLEKPASTAILCNTCGNVCKGEVLRVQNKYFHIRCFVCKA ACGCDLAEGGFFVRQGEHICTRDYQRLYGTRC

FSCDRFIEGEVVSALGKTYHPDCFVCAVCR RLPFPPGDRVTFNGKECMCQKCSPPTLLGNSAHVAQGLRS SCGGCGLEIKNGQALVALDKHWHLGCFK

CKTCGKLLNAEYISK KDGLPYCEADYHSKFGIRCDGCEKYITGRVLE AGEKHYHPSCALCVRCGQMFSEGEEMYLQG GSSIWHPACRQAARTEDKSK

 ETRTSSESIVSVPASSTSGSPSRVIY AKLGDEILDYRDLAALPKNKAIYNIDRPDMISYSPYISHSAVGDRQSYGE SPQLLSPTPTE GDQDDRSYK

QCRTSSPSSAGSVSLGHYTPTSRSPQHYSRPA AGTVSVGTSSCLSLSQHPSPTSVFRHHYIPYFRG GSESGRSTPSLSVHSDSRPPSSTYQQAPRHFH

VPD DTGVKDNIYRKPPIYKQHA AARRLDVEDSSFDQDSRK - UNI30402 - KTTWLLLKGDADTRTNSPDLDSQSLSLSSGTDQEPLQRMAGDSL

YSQ QYK IYPYDSLIVTNRIRVKLPKDVDRTRLE RHLSPEEFQEVFGMSIEEFDRLALWKRNDLKKKALLF
Transcript ENSMUST00000114207
Sequence
ACTGTGTGCGCCGAGCCGCTGGCCTCAAGCGTGCTGAGGATCCTGCCAGCGCCGCACCTGCCCGCCCGGTCCTCGGGCTGTCGCAGCGCGGGGACCACCC

TACTGGGAGCTGCCGCTGACATGAGCGCAG - UNI22918 - TGTCGCAGCCCCAGGCTGCTCATGCCCCACTGGAGAAGCCGGCCAGCACTGCGATC

CTGTGTAATACCTGTGGGAATGTGTGCAAGGGAGAGGTGCTGCGTGTGCAGAACAAGTACTTCCACATCAGGTGCTTTGTGTGCAAAG CGTGTGGCTGT

GACCTGGCTGAGGGTGGCTTCTTCGTGAGGCAGGGTGAGCACATTTGCACACGTGACTACCAGCGGCTCTATGGCACTCGCTGCTTCAGCTGTGACCGCT

TCATTGAAGGCGAAGTGGTGTCGGCGCTTGGGAAGACCTACCACCCTGACTGCTTCGTGTGTGCTGTCTGCAG GCTGCCCTTTCCTCCTGGGGACCGTG

TGACCTTCAACGGGAAGGAGTGTATGTGCCAGAAGTGTTCCCCACCCACATTGCTGGGCAACAGTGCTCACGTGGCCCAGGGCCTCCGGA GTTGTGGGG

GCTGTGGCTTAGAAATCAAGAATGGCCAGGCCCTGGTGGCTTTGGACAAGCACTGGCACCTGGGATGCTTCAAGTGCAAGACTTGTGGGAAACTCCTCAA

TGCAGAGTACATCAGCAA GGACGGGCTGCCCTACTGCGAGGCTGATTATCACAGCAAGTTTGGCATCCGCTGCGACGGCTGTGAGAAGTACATCACGGG

CCGGGTGCTAGAG GCCGGAGAGAAGCACTACCACCCTTCATGTGCGCTATGCGTCAGGTGCGGCCAGATGTTCTCAGAGGGCGAGGAGATGTACCTGCA

AG GCTCCTCCATCTGGCATCCGGCATGTCGACAGGCAGCCAGGACTGAAGACAAGAGCAAG GAAACCAGGACTTCTTCGGAGAGCATTGTCTCCGTGC

CTGCCTCCAGCACGTCAGGGTCCCCGAGCCGTGTGATCTAC GCAAAGCTTGGCGATGAGATCCTGGACTACAGGGACTTGGCTGCTCTTCCCAAAAACA

AAGCGATCTACAACATCGACCGCCCCGACATGATCTCCTATTCGCCCTACATTAGCCACTCGGCCGTGGGGGACAGGCAGAGCTATGGCGAG GGGGATC

AGGATGATCGGTCCTACAAGCAGTGCAGGACCTCCAGCCCCAGCTCTGCCGGCTCAGTCAGCCTCGGACACTACACCCCAACCTCACGGTCACCCCAGCA

CTACAGTCGTCCAG CTGGTACTGTGAGTGTTGGTACCAGTAGCTGTCTGTCCCTGTCCCAACACCCAAGCCCTACATCCGTGTTCAGACATCATTACAT

CCCCTACTTCCGAG GCAGCGAAAGTGGCCGTAGCACCCCGAGTCTCTCAGTGCACTCCGACAGCAGACCTCCTTCCTCTACCTACCAGCAGGCTCCGAG

ACACTTCCACGTCCCAG ACACTGGCGTAAAAGATAACATCTATAGGAAACCCCCTATCTACAAACAGCACG CTGCCAGGCGATTGGACGTGGAGGACA

GCAGCTTTGACCAGGACAGCAGGAAG - UNI30402 - AAGACAACCTGGCTGCTTCTCAAGGGGGATGCAGACACCAGAACTAACTCTCCAGACCTG

GACAGTCAGTCGCTGTCCCTCAGCAGCGGGACTGACCAGGAACCTCTCCAAAGAATGGCAGGGGACAGCCTCTACTCAC AATGCCAACCTGGCCCCTTG

TGGAGCAGACCCGGATGCCAGCTGGGGCACGCGAGGTACA AGATATATCCCTATGATTCCCTCATCGTAACAAACCGAATTCGTGTGAAACTGCCCAAA

GACGTGGACCGGACACGGCTGGAG AGACACCTATCACCTGAGGAGTTCCAAGAAGTGTTTGGGATGAGCATCGAGGAGTTTGACCGCCTGGCCCTGTGG

AAGAGGAATGACCTCAAGAAGAAAGCCTTGCTGTTCTGACAGCTGCCAACATCTTACCAGGAGCCTGCTGGGGGGGCAGGGCTGAAGGACCCCACCAGTC

CCCTGAAAATCCCCTCCTGCACCTTGCTCTGCTTCTCTGTGTCAGTAGGGCAGGCAGGGTGCCTGCAGGAGGCAGGGTGGGGCCAGGCCCTGAGGAGCAT

CCAGCAGGCATGGTCCCTTGTATAGCAAGGATGCTCTTGCCTGTAGTTTAGGGCCAGGTGCCAGCTTGACCCACTCCTTCCCGCCACAACTGGGCATCAG

GGCAGTGTTGCAGCCAGCTATCCTAGGAGATAGGGACAGAGCAGTCAGCCAGCCCAGCACCTTTCCGGGGCACCTGGTGTGCCCACACCTGTGCTAGGCA

CTGGGGCACAGAGTGTCTGGGACGTGAGTGAAAGACTTGTCAGGGGCAGACTCTGACACAGCAGGAATGGTAAGTGTGAGACTTCTCGGAGCGTGAGGAG

GTACCAAGTAGCCTTGCAGACTGAGGCAGGGGAGCCAGGCCAAAGTCTGCGAGGCAGTGGGACGGAGGTTTTCTACAGTTATTGTGATAGATCTTTTATG

GGGAATGAATGTTGACCTGACAGGGTGCCCCCCGCTAATGCTCTGTGTATTGTGCCCCTCTTCCAGATCACCCCCTTAGTTGCCTAAATGATATCTTTCA

AGTTACACAGAAGTTTTTATTTTATTAAAAAGTATCGCTTCCTTACACATATGAAGACATATATGCAGAGTTTAGTTTTACGGTCCCTGAGAAGGGGACC

GCCTCCGCCTTACAACTCCCCACCCCACTCCCACCGTGCAGGCCTCTGTGCTTCCAGTCCTCCGCGCTCCTCACAGACAGGAGCCGGTCTGTTTCCCTTC

GTCCCTGCTCCTTTGTATGTGTCACACAGACAGCCTCAAAGACACTCACTCGCTCGCTCAGCAGTGCCGTTTGTAAATACATGTGAAATGTATCCATCTC

CTTTTCCCTCTGTCATTTTCCCAAGTCGCTAAGAGAAGAGCGCCCCCTGATGGCCAAATCCCTAGAATAAAGGTTTCCCCACTGTGGCCTAGTCTCACAT

CAACCTGACCAGTCTTCCCAGTAAAGACACTCACTGTAGCCCTCCACCACATAAAACACGCATGCCCAGGAAGCATGCTGTCACGTGACACAGCCATTGA

CTGCAGCGGCAGAGATGGACAGCTAGAGGCGGTGCCTCCTCCAACCTGGGTGTCTAGAAGTGGGGGCTAACTGGGGCCCTGGTAGCGGGTATGGAAGAGC

ACCCCTGCTGCAGAATGGGTGGACACTGTGGTCCTGGGTGACTCTAGCTGTCCCCTCCTCTGGGTTGCCCTCACTTTCTCACATCCCGGGACATGTGTTG

AGTCTCATTTTGTGCTGGGGTTCTCACCAGCCTGGCTGGGCCGTGGAGGGGAACTTTTGGTACTTAATCTGCTTCCTGCCACTTAGCAGTCTGGACCTGC

GCAACTGGAAAACCCCCACCTCCTCACTCATGAGGTGTCATGTCATGTCTGATCCCTGGGACACCTGGGAAAATAAATGGTGACACACTG
Translation
MSAV - UNI22918 - VSQPQAAHAPLEKPASTAILCNTCGNVCKGEVLRVQNKYFHIRCFVCKA ACGCDLAEGGFFVRQGEHICTRDYQRLYGTRC

FSCDRFIEGEVVSALGKTYHPDCFVCAVCR RLPFPPGDRVTFNGKECMCQKCSPPTLLGNSAHVAQGLRS SCGGCGLEIKNGQALVALDKHWHLGCFK

CKTCGKLLNAEYISK KDGLPYCEADYHSKFGIRCDGCEKYITGRVLE AGEKHYHPSCALCVRCGQMFSEGEEMYLQG GSSIWHPACRQAARTEDKSK

 ETRTSSESIVSVPASSTSGSPSRVIY AKLGDEILDYRDLAALPKNKAIYNIDRPDMISYSPYISHSAVGDRQSYGE GDQDDRSYKQCRTSSPSSAGS

VSLGHYTPTSRSPQHYSRPA AGTVSVGTSSCLSLSQHPSPTSVFRHHYIPYFRG GSESGRSTPSLSVHSDSRPPSSTYQQAPRHFHVPD DTGVKDNI

YRKPPIYKQHA AARRLDVEDSSFDQDSRK - UNI30402 - KTTWLLLKGDADTRTNSPDLDSQSLSLSSGTDQEPLQRMAGDSLYSQ QCQPGPLW

SRPGCQLGHARYK KIYPYDSLIVTNRIRVKLPKDVDRTRLE RHLSPEEFQEVFGMSIEEFDRLALWKRNDLKKKALLF
Transcript ENSMUST00000114210
Sequence
ACTGTGTGCGCCGAGCCGCTGGCCTCAAGCGTGCTGAGGATCCTGCCAGCGCCGCACCTGCCCGCCCGGTCCTCGGGCTGTCGCAGCGCGGGGACCACCC

TACTGGGAGCTGCCGCTGACATGAGCGCAG - UNI22918 - TGTCGCAGCCCCAGGCTGCTCATGCCCCACTGGAGAAGCCGGCCAGCACTGCGATC

CTGTGTAATACCTGTGGGAATGTGTGCAAGGGAGAGGTGCTGCGTGTGCAGAACAAGTACTTCCACATCAGGTGCTTTGTGTGCAAAG CGTGTGGCTGT

GACCTGGCTGAGGGTGGCTTCTTCGTGAGGCAGGGTGAGCACATTTGCACACGTGACTACCAGCGGCTCTATGGCACTCGCTGCTTCAGCTGTGACCGCT

TCATTGAAGGCGAAGTGGTGTCGGCGCTTGGGAAGACCTACCACCCTGACTGCTTCGTGTGTGCTGTCTGCAG GCTGCCCTTTCCTCCTGGGGACCGTG

TGACCTTCAACGGGAAGGAGTGTATGTGCCAGAAGTGTTCCCCACCCACATTGCTGGGCAACAGTGCTCACGTGGCCCAGGGCCTCCGGA GTTGTGGGG

GCTGTGGCTTAGAAATCAAGAATGGCCAGGCCCTGGTGGCTTTGGACAAGCACTGGCACCTGGGATGCTTCAAGTGCAAGACTTGTGGGAAACTCCTCAA

TGCAGAGTACATCAGCAA GGACGGGCTGCCCTACTGCGAGGCTGATTATCACAGCAAGTTTGGCATCCGCTGCGACGGCTGTGAGAAGTACATCACGGG

CCGGGTGCTAGAG GCCGGAGAGAAGCACTACCACCCTTCATGTGCGCTATGCGTCAGGTGCGGCCAGATGTTCTCAGAGGGCGAGGAGATGTACCTGCA

AG GCTCCTCCATCTGGCATCCGGCATGTCGACAGGCAGCCAGGACTGAAGACAAGAGCAAG ATGCACAGCTCTGTTTGCAGCCAGCCCTGCCCGGGCA

CCCTGCCCTGTGCCTTACAG GAAACCAGGACTTCTTCGGAGAGCATTGTCTCCGTGCCTGCCTCCAGCACGTCAGGGTCCCCGAGCCGTGTGATCTAC 

GCAAAGCTTGGCGATGAGATCCTGGACTACAGGGACTTGGCTGCTCTTCCCAAAAACAAAGCGATCTACAACATCGACCGCCCCGACATGATCTCCTATT

CGCCCTACATTAGCCACTCGGCCGTGGGGGACAGGCAGAGCTATGGCGAG GGGGATCAGGATGATCGGTCCTACAAGCAGTGCAGGACCTCCAGCCCCA

GCTCTGCCGGCTCAGTCAGCCTCGGACACTACACCCCAACCTCACGGTCACCCCAGCACTACAGTCGTCCAG CTGGTACTGTGAGTGTTGGTACCAGTA

GCTGTCTGTCCCTGTCCCAACACCCAAGCCCTACATCCGTGTTCAGACATCATTACATCCCCTACTTCCGAG GCAGCGAAAGTGGCCGTAGCACCCCGA

GTCTCTCAGTGCACTCCGACAGCAGACCTCCTTCCTCTACCTACCAGCAGGCTCCGAGACACTTCCACGTCCCAG ACACTGGCGTAAAAGATAACATCT

ATAGGAAACCCCCTATCTACAAACAGCACG CTGCCAGGCGATTGGACGTGGAGGACAGCAGCTTTGACCAGGACAGCAGGAAG - UNI30402 - AA

GACAACCTGGCTGCTTCTCAAGGGGGATGCAGACACCAGAACTAACTCTCCAGACCTGGACAGTCAGTCGCTGTCCCTCAGCAGCGGGACTGACCAGGAA

CCTCTCCAAAGAATGGCAGGGGACAGCCTCTACTCAC GCTTTCCTTATTCCAAACCTGACACTCTTCCAGGACCCAGGAAGGATGGCCTGGACCTCCGG

 AATGCCAACCTGGCCCCTTGTGGAGCAGACCCGGATGCCAGCTGGGGCACGCGAG AGTATAAG ATATATCCCTATGATTCCCTCATCGTAACAAACC

GAATTCGTGTGAAACTGCCCAAAGACGTGGACCGGACACGGCTGGAG AGACACCTATCACCTGAGGAGTTCCAAGAAGTGTTTGGGATGAGCATCGAGG

AGTTTGACCGCCTGGCCCTGTGGAAGAGGAATGACCTCAAGAAGAAAGCCTTGCTGTTCTGACAGCTGCCAACATCTTACCAGGAGCCTGCTGGGGGGGC

AGGGCTGAAGGACCCCACCAGTCCCCTGAAAATCCCCTCCTGCACCTTGCTCTGCTTCTCTGTGTCAGTAGGGCAGGCAGGGTGCCTGCAGGAGGCAGGG

TGGGGCCAGGCCCTGAGGAGCATCCAGCAGGCATGGTCCCTTGTATAGCAAGGATGCTCTTGCCTGTAGTTTAGGGCCAGGTGCCAGCTTGACCCACTCC

TTCCCGCCACAACTGGGCATCAGGGCAGTGTTGCAGCCAGCTATCCTAGGAGATAGGGACAGAGCAGTCAGCCAGCCCAGCACCTTTCCGGGGCACCTGG

TGTGCCCACACCTGTGCTAGGCACTGGGGCACAGAGTGTCTGGGACGTGAGTGAAAGACTTGTCAGGGGCAGACTCTGACACAGCAGGAATGGTAAGTGT

GAGACTTCTCGGAGCGTGAGGAGGTACCAAGTAGCCTTGCAGACTGAGGCAGGGGAGCCAGGCCAAAGTCTGCGAGGCAGTGGGACGGAGGTTTTCTACA

GTTATTGTGATAGATCTTTTATGGGGAATGAATGTTGACCTGACAGGGTGCCCCCCGCTAATGCTCTGTGTATTGTGCCCCTCTTCCAGATCACCCCCTT

AGTTGCCTAAATGATATCTTTCAAGTTACACAGAAGTTTTTATTTTATTAAAAAGTATCGCTTCCTTACACATATGAAGACATATATGCAGAGTTTAGTT

TTACGGTCCCTGAGAAGGGGACCGCCTCCGCCTTACAACTCCCCACCCCACTCCCACCGTGCAGGCCTCTGTGCTTCCAGTCCTCCGCGCTCCTCACAGA

CAGGAGCCGGTCTGTTTCCCTTCGTCCCTGCTCCTTTGTATGTGTCACACAGACAGCCTCAAAGACACTCACTCGCTCGCTCAGCAGTGCCGTTTGTAAA

TACATGTGAAATGTATCCATCTCCTTTTCCCTCTGTCATTTTCCCAAGTCGCTAAGAGAAGAGCGCCCCCTGATGGCCAAATCCCTAGAATAAAGGTTTC

CCCACTGTGGCCTAGTCTCACATCAACCTGACCAGTCTTCCCAGTAAAGACACTCACTGTAGCCCTCCACCACATAAAACACGCATGCCCAGGAAGCATG

CTGTCACGTGACACAGCCATTGACTGCAGCGGCAGAGATGGACAGCTAGAGGCGGTGCCTCCTCCAACCTGGGTGTCTAGAAGTGGGGGCTAACTGGGGC

CCTGGTAGCGGGTATGGAAGAGCACCCCTGCTGCAGAATGGGTGGACACTGTGGTCCTGGGTGACTCTAGCTGTCCCCTCCTCTGGGTTGCCCTCACTTT

CTCACATCCCGGGACATGTGTTGAGTCTCATTTTGTGCTGGGGTTCTCACCAGCCTGGCTGGGCCGTGGAGGGGAACTTTTGGTACTTAATCTGCTTCCT

GCCACTTAGCAGTCTGGACCTGCGCAACTGGAAAACCCCCACCTCCTCACTCATGAGGTGTCATGTCATGTCTGATCCCTGGGACACCTGGGAAAATAAA

TGGTGACACACTG
Translation
MSAV - UNI22918 - VSQPQAAHAPLEKPASTAILCNTCGNVCKGEVLRVQNKYFHIRCFVCKA ACGCDLAEGGFFVRQGEHICTRDYQRLYGTRC

FSCDRFIEGEVVSALGKTYHPDCFVCAVCR RLPFPPGDRVTFNGKECMCQKCSPPTLLGNSAHVAQGLRS SCGGCGLEIKNGQALVALDKHWHLGCFK

CKTCGKLLNAEYISK KDGLPYCEADYHSKFGIRCDGCEKYITGRVLE AGEKHYHPSCALCVRCGQMFSEGEEMYLQG GSSIWHPACRQAARTEDKSK

 MHSSVCSQPCPGTLPCALQ ETRTSSESIVSVPASSTSGSPSRVIY AKLGDEILDYRDLAALPKNKAIYNIDRPDMISYSPYISHSAVGDRQSYGE G

DQDDRSYKQCRTSSPSSAGSVSLGHYTPTSRSPQHYSRPA AGTVSVGTSSCLSLSQHPSPTSVFRHHYIPYFRG GSESGRSTPSLSVHSDSRPPSSTY

QQAPRHFHVPD DTGVKDNIYRKPPIYKQHA AARRLDVEDSSFDQDSRK - UNI30402 - KTTWLLLKGDADTRTNSPDLDSQSLSLSSGTDQEPL

QRMAGDSLYSR RFPYSKPDTLPGPRKDGLDLR NANLAPCGADPDASWGTRE EYK IYPYDSLIVTNRIRVKLPKDVDRTRLE RHLSPEEFQEVFGM

SIEEFDRLALWKRNDLKKKALLF

For any suggestions or comments, please send an email to unitrap@crg.es