Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000029106 (Add1)
Chromosomal location
Chr 5: 34916461 - 34974954 (+)
adducin 1 (alpha) Gene [Source:MGI (curated);Acc:Add1-002]
NM_013457 NM_001024458 
NP_001095914.1 NP_038485.1 NP_001019629.2 
Q8BJT2 Q8K232 
Human Ortholog
ENSG00000087274 (ADD1)
Omim not available
UniTrap UNI10474
Vector Insertion
Chr 5: 34916511 - 34916563
Public Clones D052F08 (ggtc) (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29780
Vector Insertion
Chr 5: 34916563 - 34916690
Public Clones E070D11 (ggtc) D088C08 (ggtc) E070C11 (ggtc) IST14614D1 (tigm) IST14491E5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29695
Vector Insertion
Chr 5: 34917274 - 34938217
Public Clones (sanger) E114G12 (ggtc) D123B10 (ggtc) 3SE386E02 (ggtc) E036E12 (ggtc)
D052F08 (ggtc) D163A05 (ggtc) E112E02 (ggtc) D065H04 (ggtc) 3SE386D02 (ggtc)
3SE289G03 (ggtc) E061C09 (ggtc) D056G05 (ggtc) E028E09 (ggtc) CMHD-GT_540G5-5S (cmhd)
IST11548G6 (tigm) IST14196A9 (tigm) IST13885G11 (tigm) IST14789B12 (tigm)
IST14641F10 (tigm) IST13246F8 (tigm) IST14923F7 (tigm) IST11973G8 (tigm)
IST13741F3 (tigm) IST14632H6 (tigm) IST12122H3 (tigm) IST11535D12 (tigm)
IST14559E4 (tigm) IST13126H5 (tigm) IST14529H9 (tigm) IST12420A11 (tigm)
IST14569H8 (tigm) IST14405D10 (tigm) IST15011C8 (tigm) IST11237E1 (tigm)
IST12860B8 (tigm) IST14564H7 (tigm) IST10287H11 (tigm) IST13403A4 (tigm)
IST10897C11 (tigm) IST11059G1 (tigm) IST14864B10 (tigm) IST15064C10 (tigm)
IST14180G11 (tigm) IST15056B2 (tigm) IST14881A8 (tigm) IST14375C9 (tigm)
IST14137G5 (tigm) IST14886G6 (tigm) IST11026B9 (tigm) IST14669D4 (tigm)
IST14657H1 (tigm) IST11177F11 (tigm) IST14226F2 (tigm) IST14226E1 (tigm)
IST12377H7 (tigm) IST11138B4 (tigm) IST11542F7 (tigm) IST12138F3 (tigm)
IST13150G2 (tigm) IST12294D8 (tigm) IST14579F12 (tigm) IST14062B2 (tigm)
IST14169H5 (tigm) IST14543F10 (tigm) IST14630C12 (tigm) IST14942H6 (tigm)
IST11188G1 (tigm) IST11485D5 (tigm) IST10296B3 (tigm) IST10951B10 (tigm)
IST10472H5 (tigm) IST14225F9 (tigm) IST11073G2 (tigm) IST10837G11 (tigm)
IST11593E8 (tigm) IST14303B7 (tigm) IST12377H8 (tigm) IST12420B11 (tigm)
IST13612E9 (tigm) IST14276G12 (tigm) IST12286G2 (tigm) IST12435G3 (tigm)
IST14678E1 (tigm) IST13261H6 (tigm) IST14424E5 (tigm) IST11754A4 (tigm)
IST14234G11 (tigm) IST11739H8 (tigm) IST10482D2 (tigm) IST13660B2 (tigm)
IST14625G5 (tigm) IST11604F5 (tigm) IST15021D9 (tigm) IST13213A8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14401
Vector Insertion
Chr 5: 34938355 - 34943972
Public Clones FHCRC-GT-S14-9A1 (fhcrc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16201
Vector Insertion
Chr 5: 34938355 - 34943990
Public Clones (sanger) E046C02 (ggtc) D115H11 (ggtc) CMHD-GT_319G12-3 (cmhd) CMHD-GT_540G5-3 (cmhd)
IST10088F1 (tigm) IST13663H9 (tigm)
Private Clones OST465221 (lexicon) OST463859 (lexicon) OST458422 (lexicon) OST455264 (lexicon)
OST450018 (lexicon) OST448222 (lexicon) OST446274 (lexicon) OST445770 (lexicon)
OST445752 (lexicon) OST443827 (lexicon) OST439389 (lexicon) OST438062 (lexicon)
OST435457 (lexicon) OST432456 (lexicon) OST431646 (lexicon) OST425808 (lexicon)
OST425732 (lexicon) OST425476 (lexicon) OST423829 (lexicon) OST422331 (lexicon)
OST420162 (lexicon) OST417638 (lexicon) OST415779 (lexicon) OST414381 (lexicon)
OST411981 (lexicon) OST411243 (lexicon) OST403605 (lexicon) OST399299 (lexicon)
OST398184 (lexicon) OST394992 (lexicon) OST377081 (lexicon) OST376288 (lexicon)
OST369157 (lexicon) OST353689 (lexicon) OST345091 (lexicon) OST341226 (lexicon)
OST340765 (lexicon) OST339269 (lexicon) OST337577 (lexicon) OST337474 (lexicon)
OST333020 (lexicon) OST329360 (lexicon) OST325680 (lexicon) OST323521 (lexicon)
OST323468 (lexicon) OST321237 (lexicon) OST314982 (lexicon) OST314841 (lexicon)
OST314309 (lexicon) OST312511 (lexicon) OST309041 (lexicon) OST308970 (lexicon)
OST305160 (lexicon) OST305070 (lexicon) OST301938 (lexicon) OST299714 (lexicon)
OST299379 (lexicon) OST298537 (lexicon) OST298036 (lexicon) OST294362 (lexicon)
OST290388 (lexicon) OST289840 (lexicon) OST288691 (lexicon) OST281754 (lexicon)
OST280115 (lexicon) OST279481 (lexicon) OST276667 (lexicon) OST275956 (lexicon)
OST272768 (lexicon) OST263064 (lexicon) OST262013 (lexicon) OST259744 (lexicon)
OST252805 (lexicon) OST251291 (lexicon) OST246774 (lexicon) OST242036 (lexicon)
OST235429 (lexicon) OST232841 (lexicon) OST230323 (lexicon) OST222144 (lexicon)
OST221962 (lexicon) OST221781 (lexicon) OST219547 (lexicon) OST215998 (lexicon)
OST215130 (lexicon) OST211439 (lexicon) OST211147 (lexicon) OST210941 (lexicon)
OST207934 (lexicon) OST203489 (lexicon) OST202764 (lexicon) OST202005 (lexicon)
OST200556 (lexicon) OST198157 (lexicon) OST197719 (lexicon) OST196808 (lexicon)
OST194211 (lexicon) OST194014 (lexicon) OST192086 (lexicon) OST191029 (lexicon)
OST189604 (lexicon) OST189473 (lexicon) OST188937 (lexicon) OST188036 (lexicon)
OST184557 (lexicon) OST178807 (lexicon) OST178799 (lexicon) OST178795 (lexicon)
OST173981 (lexicon) OST170521 (lexicon) OST170386 (lexicon) OST169381 (lexicon)
OST167297 (lexicon) OST164832 (lexicon) OST157407 (lexicon) OST139803 (lexicon)
OST139115 (lexicon) OST139092 (lexicon) OST137772 (lexicon) OST137749 (lexicon)
OST137474 (lexicon) OST133786 (lexicon) OST133764 (lexicon) OST132883 (lexicon)
OST131359 (lexicon) OST128841 (lexicon) OST118935 (lexicon) OST113025 (lexicon)
OST104544 (lexicon) OST103145 (lexicon) OST102545 (lexicon) OST92266 (lexicon)
OST82260 (lexicon) OST81710 (lexicon) OST78516 (lexicon) OST73432 (lexicon)
OST67413 (lexicon) OST66262 (lexicon) OST65665 (lexicon) OST59317 (lexicon)
OST56211 (lexicon) OST54216 (lexicon) OST53793 (lexicon) OST52714 (lexicon)
OST52163 (lexicon) OST51670 (lexicon) OST46486 (lexicon) OST45528 (lexicon)
OST44586 (lexicon) OST41984 (lexicon) OST41167 (lexicon) OST40943 (lexicon)
OST39603 (lexicon) OST38737 (lexicon) OST38264 (lexicon) OST38217 (lexicon)
OST36799 (lexicon) OST34526 (lexicon) OST34285 (lexicon) OST30738 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13363
Vector Insertion
Chr 5: 34943990 - 34944188
Public Clones CMHD-GT_320E4-3 (cmhd) CMHD-GT_320C4-3 (cmhd) CMHD-GT_307B03-3 (cmhd)
Private Clones OST425300 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25015
Vector Insertion
Chr 5: 34944188 - 34947338
Public Clones not available
Private Clones OST198153 (lexicon)
Severity of mutation (?) Insertion after 10% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13065
Vector Insertion
Chr 5: 34947502 - 34948476
Public Clones CMHD-GT_337G4-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 18% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13386
Vector Insertion
Chr 5: 34948629 - 34952840
Public Clones CMHD-GT_322B01-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 26% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14919
Vector Insertion
Chr 5: 34971822 - 34973118
Public Clones PST843-2 (escells)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000052836































Transcript ENSMUST00000114335





















































Transcript ENSMUST00000001108








































 - UNI10474 - - UNI14401 - - UNI16201 - - UNI29695 - - UNI29780 - MNGDTRAAVVTSPPPTTAPHKERYFDRVDENNPE








UNI14919 - P
Transcript ENSMUST00000114338

AG - UNI10474 - - UNI14401 - - UNI16201 - - UNI29695 - - UNI29780 - GACCCTAGGAAAATTGTGCAATGAATGGTGAC
































 - UNI10474 - - UNI14401 - - UNI16201 - - UNI29695 - - UNI29780 - MNGDTRAAVVTSPPPTTAPHKERYFDRVDENNPE







Transcript ENSMUST00000114340

AG - UNI10474 - - UNI14401 - - UNI16201 - - UNI29695 - - UNI29780 - GACCCTAGGAAAATTGTGCAATGAATGGTGAC































 - UNI10474 - - UNI14401 - - UNI16201 - - UNI29695 - - UNI29780 - MNGDTRAAVVTSPPPTTAPHKERYFDRVDENNPE









For any suggestions or comments, please send an email to