Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000029121 (Crmp1)
Chromosomal location
Chr 5: 37633384 - 37683371 (+)
Description
collapsin response mediator protein 1 Gene [Source:MGI Symbol;Acc:MGI:107793]
RefSeq_dna
NM_007765 
RefSeq_peptide
NP_031791.3 NP_001129530.1 
UniGene
Mm.290995 
MGI
MGI:107793 
Uniprot/SWISSPROT
P97427 
Uniprot/SPTREMBL
Q3TY94 Q71H75 Q3TXY0 Q6P1J1 
Human Ortholog
ENSG00000072832 (CRMP1)
Omim not available
UniTrap UNI32294
Vector Insertion
Chr 5: 37633765 - 37637030
Public Clones IST11314D6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7395
Vector Insertion
Chr 5: 37637336 - 37656470
Public Clones (sanger) RRS553 (baygenomics) RRF515 (baygenomics)
Private Clones OST30572 (lexicon)
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20257
Vector Insertion
Chr 5: 37680210 - 37682355
Public Clones not available
Private Clones OST368735 (lexicon)
Severity of mutation (?) Insertion after 95% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000031004
Sequence
GTCTGTCTTCAGCGCCCTCCTCTCGCCCTGCCTCTCCCTCCTCCTCCCGCCCTCCTTGCCAAGCCGGGCGGTGCAGGCAGCCGGAGCAGCGGCGGCGGGC

CGAGCAGCGGGGAGTGGGCAGCGGTGGGAGCCGAGCTTCTGTCCTTTCTTTCATCCCTCCCTGGCCTTTGTCGCCGCTCTCACGAGTAGCGCCGCCGGGA

GAGACCCGGGTAGAGCGCCAGGCAGACGTTAGTTCCAGCGGCCGGGCGGAGGGCTCCAGAGGGGCCATGTCTCATCAGGGGAAGAAGAGCATCCCGCACA

TCACC - UNI7395 - AGTGACCGGCTCCTCATCAGAGGTGGACGCATCATCAATGATGACCAGTCCTTCTACGCCGATGTCTACCTAGAAGATGGAC

TCATAAA ACAAATAGGAGAGAACCTGATTGTTCCTGGTGGAGTGAAGACCATCGAGGCGAATGGCCGAATGGTCATTCCCGGTGGCATTGATGTCAACA

CTTACCTGCAGAAGCCCTCCCAGGGCATGACCTCGGCTGATGACTTCTTCCAGGGCACTAAAGCAGCGCTGGCAGGTGGAACCACGATGATCA TTGACC

ACGTTGTTCCTGAACCTGGGTCCAGCTTGTTGACTTCCTTTGAGAAATGGCACGAAGCAGCAGACACCAAATCCTGCTGTGACTATTCCCTCCACGTGGA

CATCACAAGCTGGTATGATGGTGTTCGGGAAGAGCTGGAGGTGCTGGTGCAGGACAAAG GTGTCAACTCCTTCCAAGTCTACATGGCGTATAAGGACCT

GTACCAGATGTCTGACAGCCAG CTGTATGAAGCCTTCACCTTCCTTAAGGGTTTGGGAGCTGTGATCTTAGTCCATGCAGAAAATGGAGATTTGATAGC

TCAG GAACAAAAACGGATCCTGGAGATGGGCATCACGGGTCCCGAGGGTCATGCTCTGAGCAGACCCGAGGAG CTGGAGGCCGAGGCTGTGTTCCGGG

CTATTGCCATTGCAGGCCGGATCAATTGCCCTGTGTACATCACCAAGGTCATGAGCAAGAGTGCAGCGGACATCATCGCACTGGCCAGGAAGAAAG GCC

CTCTTGTCTTCGGTGAGCCCATAGCCGCCAGCCTGGGAACCGATGGCACCCACTACTGGAGCAAGAACTGGGCCAAGGCAGCTGCATTTGTGACTTCCCC

TCCCCTGAGCCCAGACCCCACCACTCCTGACTACTTGACCTCCTTGCTGGCCTG TGGAGACTTGCAGGTCACAGGTAGTGGCCACTGTCCCTACAGTAC

TGCTCAGAAGGCTGTGGGCAAGGACAACTTCACTCTGATCCCTGAGGGTGTCAATGGTATAGAAGAGCGGATGACCGTTGTCTGGGACAAGGCAGTG GC

TACTGGCAAGATGGATGAGAACCAGTTTGTAGCCGTCACCAGCACCAACGCAGCCAAGATCTTCAACCTGTACCCGAGGAAAGGTCGGATCGCTGTGGGC

TCCGATGCTGACGTAGTCATCTGGGACCCAGATAAGATGAAGACCATAACAGCCAAAAGCCATAAATCA ACTGTGGAGTACAACATCTTTGAGGGCATG

GAGTGCCACGGCTCCCCCCTGGTGGTCATCAGTCAGGGCAAGATTGTCTTTGAGGATGGAAACATCAGTGTCAGCAAGGGCATGGGCCGCTTCATCCCTC

GGAAGCCATTCCCAGAGCATCTCTACCAGCGTGTCAGGATCAGAAGCAAG GTTTTCGGGTTGCATAGTGTTTCCAGGGGCATGTACGATGGGCCTGTGT

ACGAGGTGCCAGCTACACCCAAACATGCTGCTCCTGCTCCTTCTGCCAAATCCTCGCCTTCTAAACACCAACCCCCACCCATCCGGAACCTCCACCAGTC

CAACTTCAGCTTATCAG - UNI20257 - GTGCCCAGATAGATGACAACAATCCAAGGCGTACAGGCCACCGCATTGTGGCGCCCCCTGGTGGCCGCT

CCAACATCACCAGCCTCGGTTGACCTCAGATGAGCCAGATATGCAAGAGTGAAGGATTATGGGAAAACGTCCATTCCTTTTCCGTGTTTTTGAAGCCCAC

AGTTTTAGTTGGTACTGACGGAGGGGAGATTGAGCGATGCTCTTTCCTTCTCTGTTTAGGAAGAAGTGGTACTAGTGTGGTGTGTTTGCCTGGAAGTCCC

TCGCCCACAGTGTGTGTTCACACCGACTCCACCTCAGAGCATGGTGCCTCCGTTTTCCCTTCCTAGTGACCCCAGGTTTAGCATCGTCCTATACTGTTCC

CTCCACTCCTCCATGACCCTCTGAGTGATGGTTCTTTTGCGCCCTGTAGCTGTTCTAGGATAGGATGCATGTTAGTAAGTTACGTATGCAAGTCTGAGCG

CGCGCGGCTGATGGACATCGTCGAGGACCGACATAGACCCGATGCCAAGACCTTAGCCCCAAGGGGAGATTTCCAAACTCTTAAAAATGAAGGCTCCCAT

GAGTCTTCACTAGAAAGATGTGGTCCCCATCCCCACCCTGACTGAGACCTGTGAAGATGCAGAGTGGCAGGGAAGGTCACAGAGCTCCACCACCCATGTC

CTGTGTCAACAACCCGGTCCCTGTGGCACCTGTAACTGGCCATAGTGTCTTTCTGGTCTGTGTGTTCTTCCAGCCAGCCTTGGGCTTTGGGCCCAGCCAG

GCTCACACCCAGAAAGGGGTGTCCTGACACCCCACCCAGGCCTTGAGGACGGTGCGGTAATGACTGCCCAGGCTGCCTGAGTCTCTGACCCTCTGAGGAG

TTCGAGCAGGGCAGTCAGATTTTTAAAGTTTTGTACAGTTTTCCTTTGTATTCACTTCCATTTTTACTTAATAACTGACTTGTTGGTGGCTCTTATTTCT

GAATTCAAAGCTTGTGAAAAAAAATAAAGAAATTAAATTGCCCGTTG
Translation
MSHQGKKSIPHIT - UNI7395 - SDRLLIRGGRIINDDQSFYADVYLEDGLIK KQIGENLIVPGGVKTIEANGRMVIPGGIDVNTYLQKPSQGMTS

ADDFFQGTKAALAGGTTMII IDHVVPEPGSSLLTSFEKWHEAADTKSCCDYSLHVDITSWYDGVREELEVLVQDKG GVNSFQVYMAYKDLYQMSDSQ 

LYEAFTFLKGLGAVILVHAENGDLIAQ EQKRILEMGITGPEGHALSRPEE LEAEAVFRAIAIAGRINCPVYITKVMSKSAADIIALARKKG GPLVFG

EPIAASLGTDGTHYWSKNWAKAAAFVTSPPLSPDPTTPDYLTSLLAC CGDLQVTGSGHCPYSTAQKAVGKDNFTLIPEGVNGIEERMTVVWDKAV ATG

KMDENQFVAVTSTNAAKIFNLYPRKGRIAVGSDADVVIWDPDKMKTITAKSHKS TVEYNIFEGMECHGSPLVVISQGKIVFEDGNISVSKGMGRFIPRK

PFPEHLYQRVRIRSK VFGLHSVSRGMYDGPVYEVPATPKHAAPAPSAKSSPSKHQPPPIRNLHQSNFSLSG - UNI20257 - GAQIDDNNPRRTGH

RIVAPPGGRSNITSLG
Transcript ENSMUST00000087535
Sequence
ATGGCGGAGCGGCGGCGCGCGTGGAACACGGAGGACGACCTGCCGGTGTACCTGGCGCGGCCAGGCAGCGCGGCGCAGACCCCGCGCCAGAAGTACGGCG

GCATGTTCGCCGCCGTGGAGGGCGCCTACGAGAACAAGACCATCGACTTCGACGCCTACAGCGTGGGCCGCCGCGGCTCCGCGCGCACACCACGCAGCGC

TGGCCGGCCCGACGCCGTGGGCCTGCCGTGCCCCGGCGGCAGCGAAGACACGGCCAGTGATGTGAGCGAGCCCTCGGGCTCTGCTGTCAGTTCGCCAGGC

GATCGCGATGACAGACCGCCAGCGTTGCGCATCCGATGTCCTGCGCCCCGCGACCTGCCACTCGGCCGGGACAATGGCCAG - UNI7395 - - UNI3

2294 - AGTGACCGGCTCCTCATCAGAGGTGGACGCATCATCAATGATGACCAGTCCTTCTACGCCGATGTCTACCTAGAAGATGGACTCATAAA ACA

AATAGGAGAGAACCTGATTGTTCCTGGTGGAGTGAAGACCATCGAGGCGAATGGCCGAATGGTCATTCCCGGTGGCATTGATGTCAACACTTACCTGCAG

AAGCCCTCCCAGGGCATGACCTCGGCTGATGACTTCTTCCAGGGCACTAAAGCAGCGCTGGCAGGTGGAACCACGATGATCA TTGACCACGTTGTTCCT

GAACCTGGGTCCAGCTTGTTGACTTCCTTTGAGAAATGGCACGAAGCAGCAGACACCAAATCCTGCTGTGACTATTCCCTCCACGTGGACATCACAAGCT

GGTATGATGGTGTTCGGGAAGAGCTGGAGGTGCTGGTGCAGGACAAAG GTGTCAACTCCTTCCAAGTCTACATGGCGTATAAGGACCTGTACCAGATGT

CTGACAGCCAG CTGTATGAAGCCTTCACCTTCCTTAAGGGTTTGGGAGCTGTGATCTTAGTCCATGCAGAAAATGGAGATTTGATAGCTCAG GAACAA

AAACGGATCCTGGAGATGGGCATCACGGGTCCCGAGGGTCATGCTCTGAGCAGACCCGAGGAG CTGGAGGCCGAGGCTGTGTTCCGGGCTATTGCCATT

GCAGGCCGGATCAATTGCCCTGTGTACATCACCAAGGTCATGA GCAAGATTGTCTTTGAGGATGGAAACATCAGTGTCAGCAAGGGCATGGGCCGCTTC

ATCCCTCGGAAGCCATTCCCAGAGCATCTCTACCAGCGTGTCAGGATCAGAAGCAAG GTTTTCGGGTTGCATAGTGTTTCCAGGGGCATGTACGATGGG

CCTGTGTACGAGGTGCCAGCTACACCCAAACATGCTGCTCCTGCTCCTTCTGCCAAATCCTCGCCTTCTAAACACCAACCCCCACCCATCCGGAACCTCC

ACCAGTCCAACTTCAGCTTATCAG - UNI20257 - GTGCCCAGATAGATGACAACAATCCAAGGCGTACAGGCCACCGCATTGTGGCGCCCCCTGGT

GGCCGCTCCAACATCACCAGCCTCGGTTGACCTCAGATGAGCCAGATATGCAAGAGTGAAGGATTATGGGAAAACGTCCATTCCTTTTCCGTGTTTTTGA

AGCCCACAGTTTTAGTTGGTACTGACGGAGGGGAGATTGAGCGATGCTCTTTCCTTCTCTGTTTAGGAAGAAGTGGTACTAGTGTGGTGTGTTTGCCTGG

AAGTCCCTCGCCCACAGTGTGTGTTCACACCGACTCCACCTCAGAGCATGGTGCCTCCGTTTTCCCTTCCTAGTGACCCCAGGTTTAGCATCGTCCTATA

CTGTTCCCTCCACTCCTCCATGACCCTCTGAGTGATGGTTCTTTTGCGCCCTGTAGCTGTTCTAGGATAGGATGCATGTTAGTAAGTTACGTATGCAAGT

CTGAGCGCGCGCGGCTGATGGACATCGTCGAGGACCGACATAGACCCGATGCCAAGACCTTAGCCCCAAGGGGAGATTTCCAAACTCTTAAAAATGAAGG

CTCCCATGAGTCTTCACTAGAAAGATGTGGTCCCCATCCCCACCCTGACTGAGACCTGTGAAGATGCAGAGTGGCAGGGAAGGTCACAGAGCTCCACCAC

CCATGTCCTGTGTCAACAACCCGGTCCCTGTGGCACCTGTAACTGGCCATAGTGTCTTTCTGGTCTGTGTGTTCTTCCAGCCAGCCTTGGGCTTTGGGCC

CAGCCAGGCTCACACCCAGAAAGGGGTGTCCTGACACCCCACCCAGGCCTTGAGGACGGTGCGGTAATGACTGCCCAGGCTGCCTGAGTCTCTGACCCTC

TGAGGAGTTCGAGCAGGGCAGTCAGATTTTTAAAGTTTTGTACAGTTTTCCTTTGTATTCACTTCCATTTTTACTTAATAACTGACTTGTTGGTGGCTCT

TATTTCTGAATTCAAAGCTTGTGAAAAAAAATAAAGAAATTAAATTGCCCGTTG
Translation
MAERRRAWNTEDDLPVYLARPGSAAQTPRQKYGGMFAAVEGAYENKTIDFDAYSVGRRGSARTPRSAGRPDAVGLPCPGGSEDTASDVSEPSGSAVSSPG

DRDDRPPALRIRCPAPRDLPLGRDNGQ - UNI7395 - - UNI32294 - SDRLLIRGGRIINDDQSFYADVYLEDGLIK KQIGENLIVPGGVKTI

EANGRMVIPGGIDVNTYLQKPSQGMTSADDFFQGTKAALAGGTTMII IDHVVPEPGSSLLTSFEKWHEAADTKSCCDYSLHVDITSWYDGVREELEVLV

QDKG GVNSFQVYMAYKDLYQMSDSQ LYEAFTFLKGLGAVILVHAENGDLIAQ EQKRILEMGITGPEGHALSRPEE LEAEAVFRAIAIAGRINCPVY

ITKVMS SKIVFEDGNISVSKGMGRFIPRKPFPEHLYQRVRIRSK VFGLHSVSRGMYDGPVYEVPATPKHAAPAPSAKSSPSKHQPPPIRNLHQSNFSL

SG - UNI20257 - GAQIDDNNPRRTGHRIVAPPGGRSNITSLG
Transcript ENSMUST00000114158
Sequence
ATGGCGGAGCGGCGGCGCGCGTGGAACACGGAGGACGACCTGCCGGTGTACCTGGCGCGGCCAGGCAGCGCGGCGCAGACCCCGCGCCAGAAGTACGGCG

GCATGTTCGCCGCCGTGGAGGGCGCCTACGAGAACAAGACCATCGACTTCGACGCCTACAGCGTGGGCCGCCGCGGCTCCGCGCGCACACCACGCAGCGC

TGGCCGGCCCGACGCCGTGGGCCTGCCGTGCCCCGGCGGCAGCGAAGACACGGCCAGTGATGTGAGCGAGCCCTCGGGCTCTGCTGTCAGTTCGCCAGGC

GATCGCGATGACAGACCGCCAGCGTTGCGCATCCGATGTCCTGCGCCCCGCGACCTGCCACTCGGCCGGGACAATGGCCAG - UNI7395 - - UNI3

2294 - AGTGACCGGCTCCTCATCAGAGGTGGACGCATCATCAATGATGACCAGTCCTTCTACGCCGATGTCTACCTAGAAGATGGACTCATAAA ACA

AATAGGAGAGAACCTGATTGTTCCTGGTGGAGTGAAGACCATCGAGGCGAATGGCCGAATGGTCATTCCCGGTGGCATTGATGTCAACACTTACCTGCAG

AAGCCCTCCCAGGGCATGACCTCGGCTGATGACTTCTTCCAGGGCACTAAAGCAGCGCTGGCAGGTGGAACCACGATGATCA TTGACCACGTTGTTCCT

GAACCTGGGTCCAGCTTGTTGACTTCCTTTGAGAAATGGCACGAAGCAGCAGACACCAAATCCTGCTGTGACTATTCCCTCCACGTGGACATCACAAGCT

GGTATGATGGTGTTCGGGAAGAGCTGGAGGTGCTGGTGCAGGACAAAG GTGTCAACTCCTTCCAAGTCTACATGGCGTATAAGGACCTGTACCAGATGT

CTGACAGCCAG CTGTATGAAGCCTTCACCTTCCTTAAGGGTTTGGGAGCTGTGATCTTAGTCCATGCAGAAAATGGAGATTTGATAGCTCAG GAACAA

AAACGGATCCTGGAGATGGGCATCACGGGTCCCGAGGGTCATGCTCTGAGCAGACCCGAGGAG CTGGAGGCCGAGGCTGTGTTCCGGGCTATTGCCATT

GCAGGCCGGATCAATTGCCCTGTGTACATCACCAAGGTCATGAGCAAGAGTGCAGCGGACATCATCGCACTGGCCAGGAAGAAAG GCCCTCTTGTCTTC

GGTGAGCCCATAGCCGCCAGCCTGGGAACCGATGGCACCCACTACTGGAGCAAGAACTGGGCCAAGGCAGCTGCATTTGTGACTTCCCCTCCCCTGAGCC

CAGACCCCACCACTCCTGACTACTTGACCTCCTTGCTGGCCTG TGGAGACTTGCAGGTCACAGGTAGTGGCCACTGTCCCTACAGTACTGCTCAGAAGG

CTGTGGGCAAGGACAACTTCACTCTGATCCCTGAGGGTGTCAATGGTATAGAAGAGCGGATGACCGTTGTCTGGGACAAGGCAGTG GCTACTGGCAAGA

TGGATGAGAACCAGTTTGTAGCCGTCACCAGCACCAACGCAGCCAAGATCTTCAACCTGTACCCGAGGAAAGGTCGGATCGCTGTGGGCTCCGATGCTGA

CGTAGTCATCTGGGACCCAGATAAGATGAAGACCATAACAGCCAAAAGCCATAAATCA ACTGTGGAGTACAACATCTTTGAGGGCATGGAGTGCCACGG

CTCCCCCCTGGTGGTCATCAGTCAGGGCAAGATTGTCTTTGAGGATGGAAACATCAGTGTCAGCAAGGGCATGGGCCGCTTCATCCCTCGGAAGCCATTC

CCAGAGCATCTCTACCAGCGTGTCAGGATCAGAAGCAAG GTTTTCGGGTTGCATAGTGTTTCCAGGGGCATGTACGATGGGCCTGTGTACGAGGTGCCA

GCTACACCCAAACATGCTGCTCCTGCTCCTTCTGCCAAATCCTCGCCTTCTAAACACCAACCCCCACCCATCCGGAACCTCCACCAGTCCAACTTCAGCT

TATCAG - UNI20257 - GTGCCCAGATAGATGACAACAATCCAAGGCGTACAGGCCACCGCATTGTGGCGCCCCCTGGTGGCCGCTCCAACATCACC

AGCCTCGGTTGACCTCAGATGAGCCAGATATGCAAGAGTGAAGGATTATGGGAAAACGTCCATTCCTTTTCCGTGTTTTTGAAGCCCACAGTTTTAGTTG

GTACTGACGGAGGGGAGATTGAGCGATGCTCTTTCCTTCTCTGTTTAGGAAGAAGTGGTACTAGTGTGGTGTGTTTGCCTGGAAGTCCCTCGCCCACAGT

GTGTGTTCACACCGACTCCACCTCAGAGCATGGTGCCTCCGTTTTCCCTTCCTAGTGACCCCAGGTTTAGCATCGTCCTATACTGTTCCCTCCACTCCTC

CATGACCCTCTGAGTGATGGTTCTTTTGCGCCCTGTAGCTGTTCTAGGATAGGATGCATGTTAGTAAGTTACGTATGCAAGTCTGAGCGCGCGCGGCTGA

TGGACATCGTCGAGGACCGACATAGACCCGATGCCAAGACCTTAGCCCCAAGGGGAGATTTCCAAACTCTTAAAAATGAAGGCTCCCATGAGTCTTCACT

AGAAAGATGTGGTCCCCATCCCCACCCTGACTGAGACCTGTGAAGATGCAGAGTGGCAGGGAAGGTCACAGAGCTCCACCACCCATGTCCTGTGTCAACA

ACCCGGTCCCTGTGGCACCTGTAACTGGCCATAGTGTCTTTCTGGTCTGTGTGTTCTTCCAGCCAGCCTTGGGCTTTGGGCCCAGCCAGGCTCACACCCA

GAAAGGGGTGTCCTGACACCCCACCCAGGCCTTGAGGACGGTGCGGTAATGACTGCCCAGGCTGCCTGAGTCTCTGACCCTCTGAGGAGTTCGAGCAGGG

CAGTCAGATTTTTAAAGTTTTGTACAGTTTTCCTTTGTATTCACTTCCATTTTTACTTAATAACTGACTTGTTGGTGGCTCTTATTTCTGAATTCAAAGC

TTGTGAAAAAAAATAAAGAAATTAAATTGCCCGTTG
Translation
MAERRRAWNTEDDLPVYLARPGSAAQTPRQKYGGMFAAVEGAYENKTIDFDAYSVGRRGSARTPRSAGRPDAVGLPCPGGSEDTASDVSEPSGSAVSSPG

DRDDRPPALRIRCPAPRDLPLGRDNGQ - UNI7395 - - UNI32294 - SDRLLIRGGRIINDDQSFYADVYLEDGLIK KQIGENLIVPGGVKTI

EANGRMVIPGGIDVNTYLQKPSQGMTSADDFFQGTKAALAGGTTMII IDHVVPEPGSSLLTSFEKWHEAADTKSCCDYSLHVDITSWYDGVREELEVLV

QDKG GVNSFQVYMAYKDLYQMSDSQ LYEAFTFLKGLGAVILVHAENGDLIAQ EQKRILEMGITGPEGHALSRPEE LEAEAVFRAIAIAGRINCPVY

ITKVMSKSAADIIALARKKG GPLVFGEPIAASLGTDGTHYWSKNWAKAAAFVTSPPLSPDPTTPDYLTSLLAC CGDLQVTGSGHCPYSTAQKAVGKDN

FTLIPEGVNGIEERMTVVWDKAV ATGKMDENQFVAVTSTNAAKIFNLYPRKGRIAVGSDADVVIWDPDKMKTITAKSHKS TVEYNIFEGMECHGSPLV

VISQGKIVFEDGNISVSKGMGRFIPRKPFPEHLYQRVRIRSK VFGLHSVSRGMYDGPVYEVPATPKHAAPAPSAKSSPSKHQPPPIRNLHQSNFSLSG 

- UNI20257 - GAQIDDNNPRRTGHRIVAPPGGRSNITSLG

For any suggestions or comments, please send an email to unitrap@crg.es