Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000029145 (Eif2b4)
Chromosomal location
Chr 5: 31489940 - 31495466 (-)
Description
eukaryotic translation initiation factor 2B, subunit 4 delta Gene [Source:MGI (curated);Acc:Eif2b4-001]
RefSeq_dna
NM_010122 
RefSeq_peptide
NP_001120827.1 NP_001120828.1 NP_034252.2 
UniGene
Mm.29394 
MGI
MGI:95300 
Uniprot/SWISSPROT
Q61749 
Uniprot/SPTREMBL
Q3TYW7 
Human Ortholog
ENSG00000115211 (EIF2B4)
Omim 603896 - LEUKOENCEPHALOPATHY WITH VANISHING WHITE MATTER  
UniTrap UNI21185
Vector Insertion
Chr 5: 31494662 - 31494954
Public Clones (ggtc)
Private Clones OST339253 (lexicon)
Severity of mutation (?) Insertion after 8% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000114603
Sequence
GTGGCGGTGGCTGTTCGCGAAGGTGAGTGAAGGGCTAGATGCACCAAGTGGTAGAAGAGCAGATGAACACTGGATCGCTGATGCGGGGTCCGGAGCGCCT

TTGGGCCTTGCCGCCGGGTTTCTGCACGTCGCGGGACTCTGGTTTACAAGATCTAGGGCGCAGCAGGGTGCTGCTTGCCGGCTGTTCCCAGAAGGGTGAC

TGACCCTTTTCCTCCCACGCCTGTCCTTTGATCCTGCCGCGCAGTGCGTCCCCACGCGGATCCCAGAGCGCCTCGCGCCCGGCAGCCGAGCTGTGGTCAT

GCCAACCCAGCAGCCAGCTGCGCCGACGAGTCTCCCCAAGTCCTCCCGGAGCCTGTCTGGCTCACTCTGTGCCCTGTTTTCTGATGCAGAATCGAGATCC

GAGATGAAGACTGAACTTTCTCCTCGGCCCGGG - UNI21185 - GCAGCAGGGCGGGAGTTGACCCAAGAAGAGAAGCTTCAGCTTCGAAAAGAAAA

GAAACAGCAGAAGAAGAAACGGAAGGAGGAAAAGGGGGCAGACCAAGAAATTGGCTCTGCTGTGTCTGCAGCTCAACGGCAAG ACCCAATCAGAGAACT

CCCAGGACCTGGTAGTCAGCTGGGAGGTACTGCTGGGGAGAAACTTCCAGCTGGCCGGAGTAAGGCAGAACTTCGCGCCGAAAGGAGAGCCAAGCAGGAG

GCAGAGCGGGCCCTGAAACAGGCAAGAAAAGGGGAACAAGGAGGCGTCCCTCCTCAGGCCTGCCCCAGCACTGCTGGAGAAACCACCTCAG GAGTGAAG

CGTGTCCCCGAGCACACCCCAGCTGATGACCCCACACTTCTGAGGAGGCTCCTTAGAAAGCCAGATCGACAACAG GTTCCTACACGAAAGGATTACGGA

TCCAAAGTCAGTCTCTTCTCCCACCTGCCTCAGTACAGCAGACAAAGCTCCTTGACCCAGTACATGAG CATCCCATCCTCTGTGATCCACCCAGCCATG

GTGAGACTCGGTCTGCAGTACTCCCAGGGCCTCATCAGTGGCTCCAATGCCCGGTGCATCGCACTGCTTCACGCCCTGCAGCAG GTGATTCAGGATTAC

ACAACACCTCCCAGTGAGGAACTCTCCAGGGATCTTGTAAATAAACTAAAACCCTACATCAG CTTCCTGACGCAGTGCCGCCCCATGTCGGCAAGTATG

TGCAACGCCATCAAGTTCCTAACCAAGGAAGTCACTGGCATGAGCAGCTCCAAGCGGGAAGAGGAG GCCAAGTCAGAACTTAGAGAAGCCCTCGACCGG

TACGTGCAAGAGAAGATCGTGCTTGCAGCTCAGGCAATTTCACGATTTGCTTCTACAAAGATCAGTGATGGGGACGTGATCCTGGTATATGGATG CTCA

TCTTTGGTGTCGAGAATTCTCCAGGAGGCCAGGGTCGAGGGCAGGCGGTTTCGGGTGGTGGTGGTGGACAGCCGGCCCCGGCTGGAAGGAAGGCACATGC

TCCACTCTCTTGTCCGTGCTGGGGTCCCTACCTCCTATCTGCTGATTCCTGCAGCCTCCTATGTGCTTCCAGAG GTTTCTAAGGTGCTATTGGGAGCTC

ATGCACTCCTGGCCAATGGATCTGTGATGTCTCGGGTAGGGACAGCACAGTTGGCCCTGGTGGCTCGAGCTCATAACGTTCCAGTACTGGTCTGCTGTGA

AACGTACAAGTTCTGTGAACGTGTGCAGACTGATGCCTTTGTCTCCAACGAGCTAG ATGATCCCGATGATCTGCAGTGTAAGCGGGGAGACCAGGTGGC

CCTGGCTAACTGGCAGAGCCACCCGTCCCTCCGGTTGTTGAATCTGGTCTATGACGTGACTCCACCTGAGCTCGTGGATCTGGTGATCACAGAGTTGGGC

ATGATCCCTTGCAGTTCTGTGCCTGTTGTTCTTCGAGTCAAGAGCAGTGACCAGTGAAGGGAACAAGGGTCAATAAAAAGCTTACTCCCT
Translation
MPTQQPAAPTSLPKSSRSLSGSLCALFSDAESRSEMKTELSPRPG - UNI21185 - AAGRELTQEEKLQLRKEKKQQKKKRKEEKGADQEIGSAVSA

AQRQD DPIRELPGPGSQLGGTAGEKLPAGRSKAELRAERRAKQEAERALKQARKGEQGGVPPQACPSTAGETTSG GVKRVPEHTPADDPTLLRRLLRK

PDRQQ VPTRKDYGSKVSLFSHLPQYSRQSSLTQYMS SIPSSVIHPAMVRLGLQYSQGLISGSNARCIALLHALQQ VIQDYTTPPSEELSRDLVNKLK

PYIS SFLTQCRPMSASMCNAIKFLTKEVTGMSSSKREEE AKSELREALDRYVQEKIVLAAQAISRFASTKISDGDVILVYGC CSSLVSRILQEARVE

GRRFRVVVVDSRPRLEGRHMLHSLVRAGVPTSYLLIPAASYVLPE VSKVLLGAHALLANGSVMSRVGTAQLALVARAHNVPVLVCCETYKFCERVQTDA

FVSNELD DDPDDLQCKRGDQVALANWQSHPSLRLLNLVYDVTPPELVDLVITELGMIPCSSVPVVLRVKSSDQ
Transcript ENSMUST00000114605
Sequence
GTGGCTGTTCGCGAAGGTGAGTGAAGGGCTAGATGCACCAAGTGGTAGAAGAGCAGATGAACACTGGATCGCTGATGCGGGGTCCGGAGCGCCTTTGGGC

CTTGCCGCCGGGTTTCTGCACGTCGCGGGACTCTGGTTTACAAGATCTAGGGCGCAGCAGGGTGCTGCTTGCCGGCTGTTCCCAGAAGG AATCGAGATC

CGAGATGAAGACTGAACTTTCTCCTCGGCCCGGG - UNI21185 - GCAGCAGGGCGGGAGTTGACCCAAGAAGAGAAGCTTCAGCTTCGAAAAGAAA

AGAAACAGCAGAAGAAGAAACGGAAGGAGGAAAAGGGGGCAGACCAAGAAATTGGCTCTGCTGTGTCTGCAGCTCAACGGCAAG ACCCAATCAGAGAAC

TCCCAGGACCTGGTAGTCAGCTGGGAGGTACTGCTGGGGAGAAACTTCCAGCTGGCCGGAGTAAGGCAGAACTTCGCGCCGAAAGGAGAGCCAAGCAGGA

GGCAGAGCGGGCCCTGAAACAGGCAAGAAAAGGGGAACAAGGAGGCGTCCCTCCTCAGGCCTGCCCCAGCACTGCTGGAGAAACCACCTCAG GAGTGAA

GCGTGTCCCCGAGCACACCCCAGCTGATGACCCCACACTTCTGAGGAGGCTCCTTAGAAAGCCAGATCGACAACAG GTTCCTACACGAAAGGATTACGG

ATCCAAAGTCAGTCTCTTCTCCCACCTGCCTCAGTACAGCAGACAAAGCTCCTTGACCCAGTACATGAG CATCCCATCCTCTGTGATCCACCCAGCCAT

GGTGAGACTCGGTCTGCAGTACTCCCAGGGCCTCATCAGTGGCTCCAATGCCCGGTGCATCGCACTGCTTCACGCCCTGCAGCAG GTGATTCAGGATTA

CACAACACCTCCCAGTGAGGAACTCTCCAGGGATCTTGTAAATAAACTAAAACCCTACATCAG CTTCCTGACGCAGTGCCGCCCCATGTCGGCAAGTAT

GTGCAACGCCATCAAGTTCCTAACCAAGGAAGTCACTGGCATGAGCAGCTCCAAGCGGGAAGAGGAG GCCAAGTCAGAACTTAGAGAAGCCCTCGACCG

GTACGTGCAAGAGAAGATCGTGCTTGCAGCTCAGGCAATTTCACGATTTGCTTCTACAAAGATCAGTGATGGGGACGTGATCCTGGTATATGGATG CTC

ATCTTTGGTGTCGAGAATTCTCCAGGAGGCCAGGGTCGAGGGCAGGCGGTTTCGGGTGGTGGTGGTGGACAGCCGGCCCCGGCTGGAAGGAAGGCACATG

CTCCACTCTCTTGTCCGTGCTGGGGTCCCTACCTCCTATCTGCTGATTCCTGCAGCCTCCTATGTGCTTCCAGAG GTTTCTAAGGTGCTATTGGGAGCT

CATGCACTCCTGGCCAATGGATCTGTGATGTCTCGGGTAGGGACAGCACAGTTGGCCCTGGTGGCTCGAGCTCATAACGTTCCAGTACTGGTCTGCTGTG

AAACGTACAAGTTCTGTGAACGTGTGCAGACTGATGCCTTTGTCTCCAACGAGCTAG ATGATCCCGATGATCTGCAGTGTAAGCGGGGAGACCAGGTGG

CCCTGGCTAACTGGCAGAGCCACCCGTCCCTCCGGTTGTTGAATCTGGTCTATGACGTGACTCCACCTGAGCTCGTGGATCTGGTGATCACAGAGTTGGG

CATGATCCCTTGCAGTTCTGTGCCTGTTGTTCTTCGAGTCAAGAGCAGTGACCAGTGAAGGGAACAAGGGTCAATAAAAAGCTTACTCCCTA
Translation
MHQVVEEQMNTGSLMRGPERLWALPPGFCTSRDSGLQDLGRSRVLLAGCSQKE ESRSEMKTELSPRPG - UNI21185 - AAGRELTQEEKLQLRKE

KKQQKKKRKEEKGADQEIGSAVSAAQRQD DPIRELPGPGSQLGGTAGEKLPAGRSKAELRAERRAKQEAERALKQARKGEQGGVPPQACPSTAGETTSG

 GVKRVPEHTPADDPTLLRRLLRKPDRQQ VPTRKDYGSKVSLFSHLPQYSRQSSLTQYMS SIPSSVIHPAMVRLGLQYSQGLISGSNARCIALLHALQ

Q VIQDYTTPPSEELSRDLVNKLKPYIS SFLTQCRPMSASMCNAIKFLTKEVTGMSSSKREEE AKSELREALDRYVQEKIVLAAQAISRFASTKISDG

DVILVYGC CSSLVSRILQEARVEGRRFRVVVVDSRPRLEGRHMLHSLVRAGVPTSYLLIPAASYVLPE VSKVLLGAHALLANGSVMSRVGTAQLALVA

RAHNVPVLVCCETYKFCERVQTDAFVSNELD DDPDDLQCKRGDQVALANWQSHPSLRLLNLVYDVTPPELVDLVITELGMIPCSSVPVVLRVKSSDQ
Transcript ENSMUST00000077693
Sequence
GGGGAGCCAGCAGCCCAGGTGGCGCTGTAGTGTGAGTGACCTCGGCGGGAGGAGCCTAGGACCCACAGTCATGGCTGCGGTGGCGGTGGCTGTTCGCGAA

G AATCGAGATCCGAGATGAAGACTGAACTTTCTCCTCGGCCCGGG - UNI21185 - GCAGCAGGGCGGGAGTTGACCCAAGAAGAGAAGCTTCAGC

TTCGAAAAGAAAAGAAACAGCAGAAGAAGAAACGGAAGGAGGAAAAGGGGGCAGACCAAGAAATTGGCTCTGCTGTGTCTGCAGCTCAACGGCAAG ACC

CAATCAGAGAACTCCCAGGACCTGGTAGTCAGCTGGGAGGTACTGCTGGGGAGAAACTTCCAGCTGGCCGGAGTAAGGCAGAACTTCGCGCCGAAAGGAG

AGCCAAGCAGGAGGCAGAGCGGGCCCTGAAACAGGCAAGAAAAGGGGAACAAGGAGGCGTCCCTCCTCAGGCCTGCCCCAGCACTGCTGGAGAAACCACC

TCAG GAGTGAAGCGTGTCCCCGAGCACACCCCAGCTGATGACCCCACACTTCTGAGGAGGCTCCTTAGAAAGCCAGATCGACAACAG GTTCCTACACG

AAAGGATTACGGATCCAAAGTCAGTCTCTTCTCCCACCTGCCTCAGTACAGCAGACAAAGCTCCTTGACCCAGTACATGAG CATCCCATCCTCTGTGAT

CCACCCAGCCATGGTGAGACTCGGTCTGCAGTACTCCCAGGGCCTCATCAGTGGCTCCAATGCCCGGTGCATCGCACTGCTTCACGCCCTGCAGCAG GT

GATTCAGGATTACACAACACCTCCCAGTGAGGAACTCTCCAGGGATCTTGTAAATAAACTAAAACCCTACATCAG CTTCCTGACGCAGTGCCGCCCCAT

GTCGGCAAGTATGTGCAACGCCATCAAGTTCCTAACCAAGGAAGTCACTGGCATGAGCAGCTCCAAGCGGGAAGAGGAG GCCAAGTCAGAACTTAGAGA

AGCCCTCGACCGGTACGTGCAAGAGAAGATCGTGCTTGCAGCTCAGGCAATTTCACGATTTGCTTCTACAAAGATCAGTGATGGGGACGTGATCCTGGTA

TATGGATG CTCATCTTTGGTGTCGAGAATTCTCCAGGAGGCCAGGGTCGAGGGCAGGCGGTTTCGGGTGGTGGTGGTGGACAGCCGGCCCCGGCTGGAA

GGAAGGCACATGCTCCACTCTCTTGTCCGTGCTGGGGTCCCTACCTCCTATCTGCTGATTCCTGCAGCCTCCTATGTGCTTCCAGAG GTTTCTAAGGTG

CTATTGGGAGCTCATGCACTCCTGGCCAATGGATCTGTGATGTCTCGGGTAGGGACAGCACAGTTGGCCCTGGTGGCTCGAGCTCATAACGTTCCAGTAC

TGGTCTGCTGTGAAACGTACAAGTTCTGTGAACGTGTGCAGACTGATGCCTTTGTCTCCAACGAGCTAG ATGATCCCGATGATCTGCAGTGTAAGCGGG

GAGACCAGGTGGCCCTGGCTAACTGGCAGAGCCACCCGTCCCTCCGGTTGTTGAATCTGGTCTATGACGTGACTCCACCTGAGCTCGTGGATCTGGTGAT

CACAGAGTTGGGCATGATCCCTTGCAGTTCTGTGCCTGTTGTTCTTCGAGTCAAGAGCAGTGACCAGTGAAGGGAACAAGGGTCAATAAAAAGCTTACTC

CCT
Translation
MAAVAVAVREE ESRSEMKTELSPRPG - UNI21185 - AAGRELTQEEKLQLRKEKKQQKKKRKEEKGADQEIGSAVSAAQRQD DPIRELPGPGSQ

LGGTAGEKLPAGRSKAELRAERRAKQEAERALKQARKGEQGGVPPQACPSTAGETTSG GVKRVPEHTPADDPTLLRRLLRKPDRQQ VPTRKDYGSKVS

LFSHLPQYSRQSSLTQYMS SIPSSVIHPAMVRLGLQYSQGLISGSNARCIALLHALQQ VIQDYTTPPSEELSRDLVNKLKPYIS SFLTQCRPMSASM

CNAIKFLTKEVTGMSSSKREEE AKSELREALDRYVQEKIVLAAQAISRFASTKISDGDVILVYGC CSSLVSRILQEARVEGRRFRVVVVDSRPRLEGR

HMLHSLVRAGVPTSYLLIPAASYVLPE VSKVLLGAHALLANGSVMSRVGTAQLALVARAHNVPVLVCCETYKFCERVQTDAFVSNELD DDPDDLQCKR

GDQVALANWQSHPSLRLLNLVYDVTPPELVDLVITELGMIPCSSVPVVLRVKSSDQ

For any suggestions or comments, please send an email to unitrap@crg.es