Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000029162 (Khk)
Chromosomal location
Chr 5: 31224206 - 31233618 (+)
Description
ketohexokinase Gene [Source:MGI (curated);Acc:Khk-002]
RefSeq_dna
NM_008439 
RefSeq_peptide
NP_032465.2 
MGI
MGI:1096353 
Uniprot/SWISSPROT
P97328 
Uniprot/SPTREMBL
Q9CPP1 
Human Ortholog
ENSG00000138030 (KHK)
Omim 229800 - FRUCTOSURIA  
UniTrap UNI31218
Vector Insertion
Chr 5: 31227229 - 31229060
Public Clones IST12391C9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 20% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000117435
Sequence
GGACACGGTCCTCCAGTAGATAAGAGGCAGAGCCCAGCAGGAACCCCCTCTGCTTGCGGGTAGGAAGCTTGGGGAGCAGCCTCATGGAAGAGAAGCAGAT

CCTGTGCGTGGGGCTGGTGGTGCTGGACATCATCAATGTGGTGGACAAATACCCAGAGGAAGACACGGATCGCAG GTGCCTGTCCCAGAGATGGCAGCG

TGGAGGCAACGCATCCAACTCCTGCACTGTCCTTTCCTTGCTTGGAGCCCGCTGTGCCTTCATGGGCTCTTTGGCCCCTGGCCACGTTGCCGA - UNI3

1218 - TTTTGTCCTGGATGACCTCCGCCAACATTCTGTGGACTTACGATATGTGGTCCTTCAGACCGAGGGCTCCATCCCCACTTCTACAGTCATCAT

CAACGAGGCCAGCGGCAGCCGCACCATTCTGCACGCCTACAG CTTCCTGGTGGCTGACTTCAGGCAGAGGGGCGTGGATGTGTCTCAAGTGACTTGGCA

GAGCCAGGGAGATACCCCTTGCTCTTGCTGCATCGTCAACAACTCCAATGGCTCCCGTACCATTATACTCTACGACAC GAACCTGCCAGATGTGTCTGC

TAAGGACTTTGAGAAGGTCGATCTGACCCGGTTCAAGTGGATCCACATTGAG GGCCGGAATGCATCGGAACAGGTGAAGATGCTGCAGCGGATAGAGGA

GCACAATGCCAAGCAGCCTCTGCCACAGAAGGTCCGGGTGTCGGTGGAGATAGAGAAGCCCCGTGAGGAGCTCTTCCAGTTGTTTAGCTATGGTGAGGTG

 GTGTTTGTCAGCAAAGATGTGGCCAAGCACCTGGGGTTCCAGTCAGCAGTGGAGGCCCTGAGGGGCTTGTACAGTCGAGTGAAGAAAGG GGCTACGCT

TGTCTGTGCCTGGGCTGAGGAGGGTGCCGATGCCCTGGGCCCCGATGGTCAGCTGCTCCACTCAGATGCCTTCCCACCGCCCCGAGTAGTAGACACTCTT

GGGGCTGGAGACACCTTCAATGCCTCTGTCATCTTCAGCCTCTCGAAGG GAAACAGCATGCAAGAGGCCCTGAGATTCGGGTGCCAGGTGGCTGGCAAG

AAGTGTGGCTTGCAGGGGTTTGATGGCATTGTGTGAGAGGCAAGCGGCACCAGCTCGATACCTCAGAGGCTGGCACCATGCCTGCCACTGCCTTCTCTAC

TTCCTCCAGCTTAGCATCCAGCTGCCATTCCCCGGCAGGTGTGGGATGTGGGACAGCCTCTGTCTGTGTCTGCGTCTC
Translation
MEEKQILCVGLVVLDIINVVDKYPEEDTDRR RCLSQRWQRGGNASNSCTVLSLLGARCAFMGSLAPGHVAD - UNI31218 - DFVLDDLRQHSVDL

RYVVLQTEGSIPTSTVIINEASGSRTILHAYS SFLVADFRQRGVDVSQVTWQSQGDTPCSCCIVNNSNGSRTIILYDT TNLPDVSAKDFEKVDLTRFK

WIHIE GRNASEQVKMLQRIEEHNAKQPLPQKVRVSVEIEKPREELFQLFSYGEV VFVSKDVAKHLGFQSAVEALRGLYSRVKKG GATLVCAWAEEGA

DALGPDGQLLHSDAFPPPRVVDTLGAGDTFNASVIFSLSKG GNSMQEALRFGCQVAGKKCGLQGFDGIV
Transcript ENSMUST00000031053
Sequence
GGAAGCTTGGGGAGCAGCCTCATGGAAGAGAAGCAGATCCTGTGCGTGGGGCTGGTGGTGCTGGACATCATCAATGTGGTGGACAAATACCCAGAGGAAG

ACACGGATCGCAG GTGCCTGTCCCAGAGATGGCAGCGTGGAGGCAACGCATCCAACTCCTGCACTGTCCTTTCCTTGCTTGGAGCCCGCTGTGCCTTCA

TGGGCTCTTTGGCCCCTGGCCACGTTGCCGA - UNI31218 - CTTCCTGGTGGCTGACTTCAGGCAGAGGGGCGTGGATGTGTCTCAAGTGACTTGG

CAGAGCCAGGGAGATACCCCTTGCTCTTGCTGCATCGTCAACAACTCCAATGGCTCCCGTACCATTATACTCTACGACAC GAACCTGCCAGATGTGTCT

GCTAAGGACTTTGAGAAGGTCGATCTGACCCGGTTCAAGTGGATCCACATTGAG GGCCGGAATGCATCGGAACAGGTGAAGATGCTGCAGCGGATAGAG

GAGCACAATGCCAAGCAGCCTCTGCCACAGAAGGTCCGGGTGTCGGTGGAGATAGAGAAGCCCCGTGAGGAGCTCTTCCAGTTGTTTAGCTATGGTGAGG

TG GTGTTTGTCAGCAAAGATGTGGCCAAGCACCTGGGGTTCCAGTCAGCAGTGGAGGCCCTGAGGGGCTTGTACAGTCGAGTGAAGAAAGG GGCTACG

CTTGTCTGTGCCTGGGCTGAGGAGGGTGCCGATGCCCTGGGCCCCGATGGTCAGCTGCTCCACTCAGATGCCTTCCCACCGCCCCGAGTAGTAGACACTC

TTGGGGCTGGAGACACCTTCAATGCCTCTGTCATCTTCAGCCTCTCGAAGG GAAACAGCATGCAAGAGGCCCTGAGATTCGGGTGCCAGGTGGCTGGCA

AGAAGTGTGGCTTGCAGGGGTTTGATGGCATTGTGTGAGAGGCAAGCGGCACCAGCTCGATACCTCAGAGGCTGGCACCATGCCTGCCACTGCCTTCTCT

ACTTCCTCCAGCTTAGCATCCAGCTGCCATTCCCCGGCAGGTGTGGGATGTGGGACAGCCTCTGTCTGTGTCTGCGTCTCTGTATACCTATCTCCTCTCT

GCAGATACCTGGAGCAAATAAATCTTCCCCTGAGCC
Translation
MEEKQILCVGLVVLDIINVVDKYPEEDTDRR RCLSQRWQRGGNASNSCTVLSLLGARCAFMGSLAPGHVAD - UNI31218 - DFLVADFRQRGVDV

SQVTWQSQGDTPCSCCIVNNSNGSRTIILYDT TNLPDVSAKDFEKVDLTRFKWIHIE GRNASEQVKMLQRIEEHNAKQPLPQKVRVSVEIEKPREELF

QLFSYGEV VFVSKDVAKHLGFQSAVEALRGLYSRVKKG GATLVCAWAEEGADALGPDGQLLHSDAFPPPRVVDTLGAGDTFNASVIFSLSKG GNSMQ

EALRFGCQVAGKKCGLQGFDGIV

For any suggestions or comments, please send an email to unitrap@crg.es