Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000029171 (Pgm1)
Chromosomal location
Chr 5: 64484189 - 64519395 (+)
Description
phosphoglucomutase 1 Gene [Source:MGI (curated);Acc:Pgm1-001]
RefSeq_dna
NM_025700 
RefSeq_peptide
NP_079976.1 
UniGene
Mm.2325 
MGI
MGI:97564 
Uniprot/SWISSPROT
Q7TSV4 
Human Ortholog
ENSG00000169299 (PGM2)
Omim not available
UniTrap UNI23335
Vector Insertion
Chr 5: 64507673 - 64519015
Public Clones IST10548E2 (tigm)
Private Clones OST263398 (lexicon) OST76850 (lexicon) OST17288 (lexicon)
Severity of mutation (?) Insertion after 95% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000087324
Sequence
CCGGCCTCCTCCGCCCGGTTGTGACTGCTGCGGGATGGCGGCGGCGACACCGACAGAGACACCGGCTCCGGAAGGCAGTGGCTTGGGTATGGACGCGCGA

CTGGACCAGGAGACCGCGCAGTGGCTGCGTTGGGACCAG AACCCTTTAACCTCTGAGTCAGTGAAACAGCTCATTGCTGGAGGTAATAAAGAAGAGCTG

CGGAAATGCTTTGGGGCCCGGATGGAGTTTGGGACAGCTGGCCTTCGAGCGCCTATGGGAGCAGGGATTTCTCGAATGAATGACCTGACCATCATCCAGA

CCACACAG GGATTTTGCAGGTACCTGGAAAAGCAGTTCAGTGACCTGAAGCAGAGGGGCGTGGTGATCAGCTTCGATGCGAGAGCTCACCCCGCCAGCG

GGGGCAGCAGCCGGAG GTTTGCCCGGCTGGCTGCGACTGCATTTATCACCCAGGGTGTTCCTGTATACCTCTTCTCTGATATAACCCCCACCCCCTTTG

TG CCGTACACCGTGTCGCACCTGAAACTCTGCGCAGGCATCATGATCACTGCCTCGCACAATCCAAAGCAGGACAATGGCTATAAG GTCTACTGGGAC

AACGGAGCTCAGATCATCTCTCCCCACGATCGCGGCATTTCTCAGGCCATTGAGGAAAATCTAGAGCCCTGGCCTCAGGCTTGGGAGGAGTCTTTGGTTG

ACAGTAGTCCCCTTCTTCACAACCCCAGCGCGTCCATCGGTAATGACTACTTTGAAGACCTTAAAAAATACTGTTTTCACAG AACGGTAAACAAGGAGA

GCAAGGTGAAGTTCGTGCACACCTCTGTCCATGGTGTGGGCCACGAGTTTGTGCAGTTGGCCTTCAAGGCTTTTGACCTTGCTCCTCCCGAAGCTGTTCC

CCAACAGAAAGATCCGGATCCCGAGTTTCCAACTGTCAAATACCCGAATCCTGAGGAGGGCAAAGGTGTCTTG ACTTTATCTTTTGCCTTGGCTGACAA

AATCAAGGCCAAAATCGTCCTAGCCAATGACCCAGATGCTGACAGGCTCGCTGTGGCTGAGAAGCAAGACAG TGGTGAGTGGAGAGTGTTCTCAGGCAA

TGAGCTGGGGGCCCTGCTGGGATGGTGGCTCTTCACTTCCTGGAAAGAAAAGAACCAAGATCAAAGTAACCTCAAAGACACATACATGCTGTCCAGCACT

GTTTCCTCCAAAATCTTGCGGGCCATAGCCCTGAAGGAAGGCTTTCATTTCGAG GAAACATTAACCGGCTTCAAGTGGATGGGAAACAGAGCCCAACAG

CTCGGAGACCAGGGGAAAACAGTCCTATTTGCATTTGAAGAAGCTATCG GATACATGTGCTGTCCCTTTGTTCTGGACAAAGATGGCGTCAGTGCTGCT

GTTATTTGTGCAGAGCTGGCGAGCTTTCTAGCAACGAAGAATTTGTCTTTATCTCAGCAGCTAAATGCCATCTATGTGGA GTACGGCTATCATATTACC

ACAGCTTCATATTTTATCTGCCATGATCAGGGCACAATTCAAAACTTATTTGGAAACCTGAGAAACTATGACGGGAAGAATAATTATCCCAAAATGTGTG

GCAAGTTTGAAATCTCTGCTATCAGGGACCTTACAACTGGCTATGATGATAGCCAGCCTGACAAGAAAGCT GTTCTTCCTACCAGTAAGAGCAGCCAAA

TGATCACCTTCACCTTTGCTAATGGAGGTGTGGCCACCATGCGGACCAGTGGGACTGAGCCCAAAATCAAGTACTACGCAGAGTTGTGTGCTCCCCCTGG

CAACAG - UNI23335 - TGATCCGGAGCATCTGAAAAAGGAACTGGATGAGTTAGTCGGTGCCATTGAAGAACATTTTTTCCAGCCACAAAAATATA

ACCTACAGCCAAAAGCAGAATAAAACATTCCAGTACTGGATAGGATTAAATTTACCTCCAATAAACTGAACTTGATTGTTAAAGCAATAATATTTTAGGG

CCAAGTGATTCAGATAATCACCACAAGTATTTACATATTTTCAACAGCTCTATCTTCCTTGTGATTTTTTTTTTAATTATTATTATTTTTAGCCTGAAAA

GTGAATAAAAAAGCTTGGCCAAACCCAACAAACTAACATCTCTATGAAAATGTTAAATCTGGGCATTATCTGAATTTTTTAAATAAAGATTTAATTTTCT

Translation
MAAATPTETPAPEGSGLGMDARLDQETAQWLRWDQ NPLTSESVKQLIAGGNKEELRKCFGARMEFGTAGLRAPMGAGISRMNDLTIIQTTQ GFCRYLE

KQFSDLKQRGVVISFDARAHPASGGSSRR RFARLAATAFITQGVPVYLFSDITPTPFV PYTVSHLKLCAGIMITASHNPKQDNGYK VYWDNGAQIIS

PHDRGISQAIEENLEPWPQAWEESLVDSSPLLHNPSASIGNDYFEDLKKYCFHR RTVNKESKVKFVHTSVHGVGHEFVQLAFKAFDLAPPEAVPQQKDP

DPEFPTVKYPNPEEGKGVL TLSFALADKIKAKIVLANDPDADRLAVAEKQDS SGEWRVFSGNELGALLGWWLFTSWKEKNQDQSNLKDTYMLSSTVSS

KILRAIALKEGFHFE ETLTGFKWMGNRAQQLGDQGKTVLFAFEEAIG GYMCCPFVLDKDGVSAAVICAELASFLATKNLSLSQQLNAIYVE EYGYHI

TTASYFICHDQGTIQNLFGNLRNYDGKNNYPKMCGKFEISAIRDLTTGYDDSQPDKKA VLPTSKSSQMITFTFANGGVATMRTSGTEPKIKYYAELCAP

PGNS - UNI23335 - SDPEHLKKELDELVGAIEEHFFQPQKYNLQPKAE

For any suggestions or comments, please send an email to unitrap@crg.es