Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000029174 (Tbc1d1)
Chromosomal location
Chr 5: 64551060 - 64742725 (+)
Description
TBC1 domain family, member 1 Gene [Source:MGI (curated);Acc:Tbc1d1-002]
RefSeq_dna
NM_019636 
RefSeq_peptide
NP_062610.2 
UniGene
Mm.286353 
MGI
MGI:1889508 
Uniprot/SWISSPROT
Q60949 
Uniprot/SPTREMBL
Q148X0 Q3TGE9 Q3TNW7 Q3TXH9 Q3U3T9 
Human Ortholog
ENSG00000065882 (TBC1D1)
Omim not available
UniTrap UNI13098
Vector Insertion
Chr 5: 64551745 - 64564626
Public Clones CMHD-GT_330B5-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16784
Vector Insertion
Chr 5: 64621770 - 64647953
Public Clones (ggtc) IST11562C8 (tigm)
Private Clones OST454075 (lexicon) OST433960 (lexicon) OST433563 (lexicon) OST177063 (lexicon)
OST137082 (lexicon) OST126024 (lexicon) OST30647 (lexicon)
Severity of mutation (?) Insertion after 12% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7615
Vector Insertion
Chr 5: 64666745 - 64669154
Public Clones RRR502 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 40% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7117
Vector Insertion
Chr 5: 64730971 - 64736490
Public Clones RRJ449 (baygenomics)
Private Clones OST406579 (lexicon) OST365228 (lexicon) OST323625 (lexicon) OST323621 (lexicon)
OST323617 (lexicon)
Severity of mutation (?) Insertion after 89% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000121370
Sequence
GACCACACATCCCGCCGGGAGGGCCATAATCACTT CTGCTGTCGCCGCCGCCGGCCACACCGCGGTGCCTGTTGCTGCAAGCCACCTCGGACCGACCGT

CTCTTCAACCCGCAAGAGAAGCAGAGACTGTGGAGTGGACCCCCACCCCAGCAGCGTGGGGCGGCAAGAGCACAGCCAGCTGAGGACCATGGACGCCCCG

CCCGCCCAGGCCATCTTCTGGGTGCCCGGGAGCACCTGCGCGCCCTAGCTCAGCCCGGAGTTCTGAGCGTGCCACCTCACTG - UNI13098 - GATT

CTGCCCTCAGAAGCACGTGAAATAGATCACTTCATTTAAAGTAGGAAAATAGTAGCACGTTTTCCTGGCTCTCCAGACCTCTCCCAGGATGGAGGCAATC

ACATTCACAGCGAGGAAGCATCCGTTCCCTAACGAAGTCTCCGTGGACTTCGGCTTGCAGCTGGTGGGCTCCTTACCCGTGCATTCTCTCACCACTATGC

CCATGCTGCCGTGGGTGGTAGCCGAGGTACGAAGACTCAGTGGCCAGTGCTCTAAAAAGGAGCCTAGGACAAAGCAAGTCCGCCTTTGGGTTTCGCCCTC

CGGACTGCGGTGCGAGCCTGACCTGGAGAAAAGTCAACCATGGGACCCGCTCATCTGTTCCAGCATCTTTGAGTGCAAGCCTCAGCGTGTGCACAAACTG

ATTCACAACAGTCACGACCCGAGCTACTTTGCTTGCCTCATTAAGGAGGATGCTGCGCACAGGCAGAGCCTCTGCTATGTGTTTAAAGCAGACGATCAAA

CAAAA - UNI16784 - GTGCCTGAGATCATCAGCTCCATCCGGCAGGCCGGGAAGATTGCCCGCCAGGAAGAGCTGCGTTGCCCCTCCGAGTTCGAC

GATACCTTCGCCAAAAAGTTCGAGGTGCTCTTCTGTGGCCGGGTGACTGTGGCTCACAAGAAGGCCCCACCCGCACTGATTGACGAGTGTATCGAGAAGT

TCAACCATGTGAGCTGTGGTCGCAGAACGGACTGGGAAGCGCCCACCGGGCAGCCATCAGCGCCTGGCCCCAGGCCCATGCGCAAATCCTTCTCACAGCC

TGGACTGCGCTCGCTGGCCTTCAGGAAGGAGTTCCAGGACGCTAGCCTCCGCAGTAGCACCTTTAGCTCCTTTGACAATGACATAGAGAACCACCTCATC

GGTGGGCACAATGTGGTTCAGCCCACAGACATGGAGGAGAACCGAACTATGCTGTTCACG ATTGGCCAATCTGAAGTTTACCTCATCAGTCCTGACACC

AAAAAGATTGCACTGGAGAAAAATTTTAAGGAGATATCCTTTTGCTCTCAG GGCATCAGACATGTGGACCACTTTGGATTCATCTGCCGAGAGTGCTCG

GGTGGCGGCAGTGGCGGCTTTCATTTTGTCTGTTACGTGTTCCAGTGCACAAATGAAGCTCTG GTTGACGAGATCATGATGACTCTGAAGCAGGCTTTC

ACGGTAGCTGCGGTGCAGCAGACGGCTAAGGCACCAGCCCAGCTCTGTGAGGGCTGCCCCTTGCAAGGCCTGCACAAGCTCTGCGAAAGGATAGAGG GA

ATGAATTCATCTAAAACCAAATTAGAACTCCAGAAGCACTTGACCACACTGACCAATCAGGAGCAGGCCACCATATTCGAGGAGGTTCAG AAATTGAGA

CCAAGAAACGAGCAGCGAGAGAATGAATTAATTATTTCTTTTCTGAGGTGCTTATATGAAGAGAAGCAAAAAGAGCACAGCCACACTGGGGAGCCAAAGC

AG - UNI7615 - ACACTACAGGTGGCAGCAGAGAATATTGGGAGTGACCTGCCACCCAGTGCTAGCCGGTTCAGGTTAGATTCGCTGAAGAACAGAG

CAAAGAGGTCCTTAACAGAGTCCCTAGAGAGCATTCTGTCCCGG GGTAATAAAGCCAGAGGCCTGCAGGACCATTCCGCCAGTGTGGATCTGGACAGCT

CCACTTCTAGTACTCTAAGTAACACCAGCAAA GAGCTGTCCATGGGTGACAAGGAGGCCTTCCCCGTCTCTGAGACCTCCTTCAAGCTCCTTGGCTCCT

CAGATGACCTGTCCAGTGACTCAGAGGGCCACATTGCAGAAGAGTCTGCCCTGTTGTCACCCCAGCAGGCGTTCAGAAGGAGAGCCAACACCCTGAGTCA

TTTCCCAGTAGAGTGCCCTGCGCCTCCAGAACCTGCCCAGAGCTCTCCAGGGGTCTCTCAAAGGAAACTCATGCGGTACCACTCCGTGAGCACAGAGACG

CCTCATGAACGCAA GGACTTTGAATCCAAAGCAAACCACCTGGGTGACACAGATGGGACCCCCGTGAAGACCCGGCGGCACTCGTGGAGACAGCAGATA

TTCCTTCGAGTGGCCACTCCACAGAAGGCTTGTGACTCCCCGAGCAGATATGAAG ATTATTCCGAGCTGGGAGAGCTCCCTCCACGCTCCCCTTTAGAA

CCGGTGTGTGAGGACGGCCCATTTGGCCCAGTACAGGAAGAAAAGAGGAAGACGTCACGCGAGCTTCGAGAGCTGTGGAAAAAGGCCATCTTGCAGCAGA

TCCTGCTGCTCAGGATGGAGAAGGAGAATCAGAAGCTACAAG CCTCTGAAAACGATTTGCTGAACAAACGCCTCAAGCTTGACTATGAAGAAATCACTC

CGTGTCTTAAAGAAGTCACTACAGTGTGGGAAAAGATGCTTAGCACTCCAGGAAGATCCAAAATTAAGTTTGACATGGAAAAAGTGCACTCAGCTGTTGG

GCAAG GTGTGCCACGTCATCACCGAGGTGAGATCTGGAAATTTCTAGCTGAGCAGTTCCACCTTAAACACCCATTTCCTAGTAAACAGCAGCCAAAGGA

CGTGCCCTACAAAGAGCTCCTGAAGAAGCTGACCTCGCAGCAGCACGCCATTCTCATCGACCTCG GGCGAACCTTTCCAACACATCCATACTTCTCTGC

CCAGCTTGGAGCAGGTCAGCTGTCACTTTACAACATTCTGAAGGCCTACTCGCTTCTGGACCAGGAGGTTGGATACTGCCAAGGTCTCAGCTTTGTGGCA

GGCATTTTGCTTCTTCACATGAGTGAGGAAGAGGCGTTCAAGATGCTCAAGTTCCTGATGTTTGACATGGGGCTGCGGAAACAGTATCGGCCAGACATGA

TTATTTTGCAG ATCCAGATGTACCAGCTGTCACGGCTCCTCCACGATTACCACCGAGACCTCTACAACCACCTGGAAGAGCACGAGATCGGCCCCAGCC

TCTACGCGGCTCCCTGGTTTCTCACTGTGTTCGCCTCACAGTTCCCACTCGGCTTTGTAGCCAGAGTCTTTG ATATGATCTTCCTTCAGGGATCAGAGG

TCATATTTAAAGTAGCTTTAAGTCTTTTGGGGAGCCATAAGCCCTTGATTCTACAGCATGAGAACCTGGAAACCATAGTGGACTTCATAAAGAACACACT

CCCCAACCTGGGCCTGGTGCAGATGGAGAAGACCATCAGTCAG - UNI7117 - GTGTTTGAGATGGACATCGCCAAGCAGCTCCAGGCCTATGAGGT

CGAGTACCACGTGCTCCAGGAGGAGCTTATTGAGTCCTCGCCTCTCAGTGACAACCAAAGAATGGAGAAATTGGAGAAAACCAACAGCAGCTTGCGCAAA

CAGAACCTTGACCTCCTGGAGCAGTTGCAG GTGGCAAATGCTAGGATCCAAAGCCTTGAAGCCACGGTAGAGAAACTTCTTACCAGCGAGAGTAAGCTG

AAGCAGGCTGCGCTGACCCTGGAGGTGGAGCGCTCCGCCCTGCTGCAGATGGTGGAGGAGCTGCGGAGGCAAAGCGCCCGGCCCAGCACTCCAGAGCCAG

ACTGCACCCAGCTGGAGCCCACAGGCGATTGACCGCTGCCAGAAGAGACTGTGCACCATTAACACTGTCCAAGCCTTAATCAAGAGAGATGGAAGTCAGA

GGCAGAGAAGAGAGAACTTCTCAGGGAGGAAACTGGCTGACCAGCCTGCAGATCCTTTTGAGCTCAGAACTTGGGATTGGAGGACAAAAGTCTCAGAGTT

ATTGTTGTTTTTGGTTCTAATCCGTCCCCTTTCCAGTCCTGGTTGTTGTAGCTTTAGATGGCATGGACATGAATAAATTACATTTATGGTTCCTCCTCCT

TCTTGCAGAGACACAGTGTGTGGAAAGAGCATTCATGACTGCAGTGTTCCAAAAACAAGATGGGTCTGAAATAATTCCTCAGGCAGAAGAAACGTGACCC

TTTGTCAGTCTGCAAGAAAGGTTCCTGGGAGGGTGCCCTTGATGTCACCTGAGGTGCAGTGGGCCCTTGTCCATTTTTATTATGGGACCTAAGGTGACCA

TGAGGAAGGAAGAAAGGGGTTTATTTAAATCAGATATATTGGTTGTTCCTGAATCCACGGTCACTCCCATTGGTACTGAAGAGAGCTCATCTTTTACAAA

CTCAGTGTTTTAGTATGGTTTTTGCTTACCCTTTCAAGTCACAGGTAAATGTTTCATAAGGAAATCACAGTTTTTAGATTCCCTGTTATTGCTAGTGTGG

GACCTGTAGCTGTGGGGTCTGACATATTTATTTCTTTTTGATTGTTTCATATCCACACTATAGGGTCACATATTTATTTTTGTCTGTTGATAAATGATGT

ACCACTGCCACATCTTCCTTTGAGCCTTGAACCCCTTGGAAATCTGATTTCTCATAGAAGGAACAAAACATACCAAGATTTCCAGGGGCTCCTAAGATGC

TGAAACATTGCAAAAGAAACCAGATTGCAATCAGGTGTATGGCAGCTGACAGCTTTTCAGAAGTAGGAAGTGTGTTTTGAAAGTACTCAAACACACGCAC

GCCTTCCTTGGGATGGCGAGGACCCTGTGCCTTCAAGCAGAGTGCAGCTCACACTCACCCTGCTTCTAGCTGGTCCTGTGTAGAGCATCACCCATGTGTG

CAACAGCTTTTTTTTTTCTTTTAACATACACACAAAGGCTTAGGTTAGGGAAGACCACCAGCCAGGAGCCCTGGCTATCGGAATTGGTCCTGCCTTGGGC

TCTGTTGGCCCTCCTGTTCCTGGAGGTCTGCTGCAGCGCTGTTGGTAGGAAAGGAGCCTTGTAAGTCTGGGCTGTAAGGAGAGACCATCACCGTTGGGGT

CATTTGGGATCTCCTAGCCCTATCAAAGGGACACTAAATGGCCAGGAGGGATGTAAGACTCCCACATGGTCTTGGGTCAGAGGAGAGGTCTCTCCATAAA

CCAACATGCCCAGTCCCAGTTGGTTGGAGCAGGGGTTGTCAGAGGAGGGTGACAGTGGACAGCTTCTTTCCACATTGTATTTTATTATTTGAATGTTTTA

ATGTTGAATTTTGGACATGTTATTACTGTTCAAAAAACACTGACTCTACAGTAAGAAAAGAGCAATAAAACAGATTATTC
Translation
  - UNI13098 - MEAITFTARKHPFPNEVSVDFGLQLVGSLPVHSLTTMPMLPWVVAEVRRLSGQCSKKEPRTKQVRLWVSPSGLRCEPDLEKSQPW

DPLICSSIFECKPQRVHKLIHNSHDPSYFACLIKEDAAHRQSLCYVFKADDQTK - UNI16784 - VPEIISSIRQAGKIARQEELRCPSEFDDTFAK

KFEVLFCGRVTVAHKKAPPALIDECIEKFNHVSCGRRTDWEAPTGQPSAPGPRPMRKSFSQPGLRSLAFRKEFQDASLRSSTFSSFDNDIENHLIGGHNV

VQPTDMEENRTMLFT IGQSEVYLISPDTKKIALEKNFKEISFCSQ GIRHVDHFGFICRECSGGGSGGFHFVCYVFQCTNEAL VDEIMMTLKQAFTVA

AVQQTAKAPAQLCEGCPLQGLHKLCERIEG GMNSSKTKLELQKHLTTLTNQEQATIFEEVQ KLRPRNEQRENELIISFLRCLYEEKQKEHSHTGEPKQ

 - UNI7615 - TLQVAAENIGSDLPPSASRFRLDSLKNRAKRSLTESLESILSR GNKARGLQDHSASVDLDSSTSSTLSNTSK ELSMGDKEAFPVS

ETSFKLLGSSDDLSSDSEGHIAEESALLSPQQAFRRRANTLSHFPVECPAPPEPAQSSPGVSQRKLMRYHSVSTETPHERK KDFESKANHLGDTDGTPV

KTRRHSWRQQIFLRVATPQKACDSPSRYED DYSELGELPPRSPLEPVCEDGPFGPVQEEKRKTSRELRELWKKAILQQILLLRMEKENQKLQA ASEND

LLNKRLKLDYEEITPCLKEVTTVWEKMLSTPGRSKIKFDMEKVHSAVGQG GVPRHHRGEIWKFLAEQFHLKHPFPSKQQPKDVPYKELLKKLTSQQHAI

LIDLG GRTFPTHPYFSAQLGAGQLSLYNILKAYSLLDQEVGYCQGLSFVAGILLLHMSEEEAFKMLKFLMFDMGLRKQYRPDMIILQ IQMYQLSRLLH

DYHRDLYNHLEEHEIGPSLYAAPWFLTVFASQFPLGFVARVFD DMIFLQGSEVIFKVALSLLGSHKPLILQHENLETIVDFIKNTLPNLGLVQMEKTIS

Q - UNI7117 - VFEMDIAKQLQAYEVEYHVLQEELIESSPLSDNQRMEKLEKTNSSLRKQNLDLLEQLQ VANARIQSLEATVEKLLTSESKLKQAA

LTLEVERSALLQMVEELRRQSARPSTPEPDCTQLEPTGD
Transcript ENSMUST00000119756
Sequence
TTCCCTTTCTCGCTGCCTGCCCGGCGGGCGCGACCTCTCAGGCTGTGACGCGCGGGGAGAGGAGGAGCCCGTAGGCTGGCCGCCGTCTCGGGACGATGCC

CGCACCCCGTCGCGCCCCGAGCCCGCCCCCGGCCGTCAGCAGGCCCACGGGCCGGCGCGTGTGAGCGGGAGCGGCGGACGAGGAGCCGCCGCTGGGCCCG

CGATGTCACCATTGTTCAGCTGGGTGGCCAAG - UNI16784 - GTGCCTGAGATCATCAGCTCCATCCGGCAGGCCGGGAAGATTGCCCGCCAGGAA

GAGCTGCGTTGCCCCTCCGAGTTCGACGATACCTTCGCCAAAAAGTTCGAGGTGCTCTTCTGTGGCCGGGTGACTGTGGCTCACAAGAAGGCCCCACCCG

CACTGATTGACGAGTGTATCGAGAAGTTCAACCATGTGAGCTGTGGTCGCAGAACGGACTGGGAAGCGCCCACCGGGCAGCCATCAGCGCCTGGCCCCAG

GCCCATGCGCAAATCCTTCTCACAGCCTGGACTGCGCTCGCTGGCCTTCAGGAAGGAGTTCCAGGACGCTAGCCTCCGCAGTAGCACCTTTAGCTCCTTT

GACAATGACATAGAGAACCACCTCATCGGTGGGCACAATGTGGTTCAGCCCACAGACATGGAGGAGAACCGAACTATGCTGTTCACG ATTGGCCAATCT

GAAGTTTACCTCATCAGTCCTGACACCAAAAAGATTGCACTGGAGAAAAATTTTAAGGAGATATCCTTTTGCTCTCAG GGCATCAGACATGTGGACCAC

TTTGGATTCATCTGCCGAGAGTGCTCGGGTGGCGGCAGTGGCGGCTTTCATTTTGTCTGTTACGTGTTCCAGTGCACAAATGAAGCTCTG GTTGACGAG

ATCATGATGACTCTGAAGCAGGCTTTCACGGTAGCTGCGGTGCAGCAGACGGCTAAGGCACCAGCCCAGCTCTGTGAGGGCTGCCCCTTGCAAGGCCTGC

ACAAGCTCTGCGAAAGGATAGAGG GAATGAATTCATCTAAAACCAAATTAGAACTCCAGAAGCACTTGACCACACTGACCAATCAGGAGCAGGCCACCA

TATTCGAGGAGGTTCAG AAATTGAGACCAAGAAACGAGCAGCGAGAGAATGAATTAATTATTTCTTTTCTGAGGTGCTTATATGAAGAGAAGCAAAAAG

AGCACAGCCACACTGGGGAGCCAAAGCAG - UNI7615 - ACACTACAGGTGGCAGCAGAGAATATTGGGAGTGACCTGCCACCCAGTGCTAGCCGGT

TCAGGTTAGATTCGCTGAAGAACAGAGCAAAGAGGTCCTTAACAGAGTCCCTAGAGAGCATTCTGTCCCGG GGTAATAAAGCCAGAGGCCTGCAGGACC

ATTCCGCCAGTGTGGATCTGGACAGCTCCACTTCTAGTACTCTAAGTAACACCAGCAAA GAGCTGTCCATGGGTGACAAGGAGGCCTTCCCCGTCTCTG

AGACCTCCTTCAAGCTCCTTGGCTCCTCAGATGACCTGTCCAGTGACTCAGAGGGCCACATTGCAGAAGAGTCTGCCCTGTTGTCACCCCAGCAGGCGTT

CAGAAGGAGAGCCAACACCCTGAGTCATTTCCCAGTAGAGTGCCCTGCGCCTCCAGAACCTGCCCAGAGCTCTCCAGGGGTCTCTCAAAGGAAACTCATG

CGGTACCACTCCGTGAGCACAGAGACGCCTCATGAACGCAA GGACTTTGAATCCAAAGCAAACCACCTGGGTGACACAGATGGGACCCCCGTGAAGACC

CGGCGGCACTCGTGGAGACAGCAGATATTCCTTCGAGTGGCCACTCCACAGAAGGCTTGTGACTCCCCGAGCAGATATGAAG ATTATTCCGAGCTGGGA

GAGCTCCCTCCACGCTCCCCTTTAGAACCGGTGTGTGAGGACGGCCCATTTGGCCCAGTACAGGAAGAAAAGAGGAAGACGTCACGCGAGCTTCGAGAGC

TGTGGAAAAAGGCCATCTTGCAGCAGATCCTGCTGCTCAGGATGGAGAAGGAGAATCAGAAGCTACAAG CCTCTGAAAACGATTTGCTGAACAAACGCC

TCAAGCTTGACTATGAAGAAATCACTCCGTGTCTTAAAGAAGTCACTACAGTGTGGGAAAAGATGCTTAGCACTCCAGGAAGATCCAAAATTAAGTTTGA

CATGGAAAAAGTGCACTCAGCTGTTGGGCAAG GTGTGCCACGTCATCACCGAGGTGAGATCTGGAAATTTCTAGCTGAGCAGTTCCACCTTAAACACCC

ATTTCCTAGTAAACAGCAGCCAAAGGACGTGCCCTACAAAGAGCTCCTGAAGAAGCTGACCTCGCAGCAGCACGCCATTCTCATCGACCTCG GGCGAAC

CTTTCCAACACATCCATACTTCTCTGCCCAGCTTGGAGCAGGTCAGCTGTCACTTTACAACATTCTGAAGGCCTACTCGCTTCTGGACCAGGAGGTTGGA

TACTGCCAAGGTCTCAGCTTTGTGGCAGGCATTTTGCTTCTTCACATGAGTGAGGAAGAGGCGTTCAAGATGCTCAAGTTCCTGATGTTTGACATGGGGC

TGCGGAAACAGTATCGGCCAGACATGATTATTTTGCAG ATCCAGATGTACCAGCTGTCACGGCTCCTCCACGATTACCACCGAGACCTCTACAACCACC

TGGAAGAGCACGAGATCGGCCCCAGCCTCTACGCGGCTCCCTGGTTTCTCACTGTGTTCGCCTCACAGTTCCCACTCGGCTTTGTAGCCAGAGTCTTTG 

ATATGATCTTCCTTCAGGGATCAGAGGTCATATTTAAAGTAGCTTTAAGTCTTTTGGGGAGCCATAAGCCCTTGATTCTACAGCATGAGAACCTGGAAAC

CATAGTGGACTTCATAAAGAACACACTCCCCAACCTGGGCCTGGTGCAGATGGAGAAGACCATCAGTCAG - UNI7117 - GTGTTTGAGATGGACAT

CGCCAAGCAGCTCCAGGCCTATGAGGTCGAGTACCACGTGCTCCAGGAGGAGCTTATTGAGTCCTCGCCTCTCAGTGACAACCAAAGAATGGAGAAATTG

GAGAAAACCAACAGCAGCTTGCGCAAACAGAACCTTGACCTCCTGGAGCAGTTGCAG GTGGCAAATGCTAGGATCCAAAGCCTTGAAGCCACGGTAGAG

AAACTTCTTACCAGCGAGAGTAAGCTGAAGCAGGCTGCGCTGACCCTGGAGGTGGAGCGCTCCGCCCTGCTGCAGATGGTGGAGGAGCTGCGGAGGCAAA

GCGCCCGGCCCAGCACTCCAGAGCCAGACTGCACCCAGCTGGAGCCCACAGGCGATTGACCGCTGCCAGAAGAGACTGTGCACCATTAACACTGTCCAAG

CCTTAATCAAGAGAGATGGAAGTCAGAGGCAGAGAAGAGAGAACTTCTCAGGGAGGAAACTGGCTGACCAGCCTGCAGATCCTTTTGAGCTCAGAACTTG

GGATTGGAGGACAAAAGTCTCAGAGTTATTGTTGTTTTTGGTTCTAATCCGTCCCCTTTCCAGTCCTGGTTGTTGTAGCTTTAGATGGCATGGACATGAA

TAAATTACATTTATGGTTCCTCCTCCTTCTTGCAGAGACACAGTGTGTGGAAAGAGCATTCATGACTGCAGTGTTCCAAAAACAAGATGGGTCTGAAATA

ATTCCTCAGGCAGAAGAAACGTGACCCTTTGTCAGTCTGCAAGAAAGGTTCCTGGGAGGGTGCCCTTGATGTCACCTGAGGTGCAGTGGGCCCTTGTCCA

TTTTTATTATGGGACCTAAGGTGACCATGAGGAAGGAAGAAAGGGGTTTATTTAAATCAGATATATTGGTTGTTCCTGAATCCACGGTCACTCCCATTGG

TACTGAAGAGAGCTCATCTTTTACAAACTCAGTGTTTTAGTATGGTTTTTGCTTACCCTTTCAAGTCACAGGTAAATGTTTCATAAGGAAATCACAGTTT

TTAGATTCCCTGTTATTGCTAGTGTGGGACCTGTAGCTGTGGGGTCTGACATATTTATTTCTTTTTGATTGTTTCATATCCACACTATAGGGTCACATAT

TTATTTTTGTCTGTTGATAAATGATGTACCACTGCCACATCTTCCTTTGAGCCTTGAACCCCTTGGAAATCTGATTTCTCATAGAAGGAACAAAACATAC

CAAGATTTCCAGGGGCTCCTAAGATGCTGAAACATTGCAAAAGAAACCAGATTGCAATCAGGTGTATGGCAGCTGACAGCTTTTCAGAAGTAGGAAGTGT

GTTTTGAAAGTACTCAAACACACGCACGCCTTCCTTGGGATGGCGAGGACCCTGTGCCTTCAAGCAGAGTGCAGCTCACACTCACCCTGCTTCTAGCTGG

TCCTGTGTAGAGCATCACCCATGTGTGCAACAGCTTTTTTTTTTCTTTTAACATACACACAAAGGCTTAGGTTAGGGAAGACCACCAGCCAGGAGCCCTG

GCTATCGGAATTGGTCCTGCCTTGGGCTCTGTTGGCCCTCCTGTTCCTGGAGGTCTGCTGCAGCGCTGTTGGTAGGAAAGGAGCCTTGTAAGTCTGGGCT

GTAAGGAGAGACCATCACCGTTGGGGTCATTTGGGATCTCCTAGCCCTATCAAAGGGACACTAAATGGCCAGGAGGGATGTAAGACTCCCACATGGTCTT

GGGTCAGAGGAGAGGTCTCTCCATAAACCAACATGCCCAGTCCCAGTTGGTTGGAGCAGGGGTTGTCAGAGGAGGGTGACAGTGGACAGCTTCTTTCCAC

ATTGTATTTTATTATTTGAATGTTTTAATGTTGAATTTTGGACATGTTATTACTGTTCAAAAAACACTGACTCTACAGTAAGAAAAGAGCAATAAAACAG

ATTATTCACAC
Translation
MSPLFSWVAK - UNI16784 - VPEIISSIRQAGKIARQEELRCPSEFDDTFAKKFEVLFCGRVTVAHKKAPPALIDECIEKFNHVSCGRRTDWEAPT

GQPSAPGPRPMRKSFSQPGLRSLAFRKEFQDASLRSSTFSSFDNDIENHLIGGHNVVQPTDMEENRTMLFT IGQSEVYLISPDTKKIALEKNFKEISFC

SQ GIRHVDHFGFICRECSGGGSGGFHFVCYVFQCTNEAL VDEIMMTLKQAFTVAAVQQTAKAPAQLCEGCPLQGLHKLCERIEG GMNSSKTKLELQK

HLTTLTNQEQATIFEEVQ KLRPRNEQRENELIISFLRCLYEEKQKEHSHTGEPKQ - UNI7615 - TLQVAAENIGSDLPPSASRFRLDSLKNRAKR

SLTESLESILSR GNKARGLQDHSASVDLDSSTSSTLSNTSK ELSMGDKEAFPVSETSFKLLGSSDDLSSDSEGHIAEESALLSPQQAFRRRANTLSHF

PVECPAPPEPAQSSPGVSQRKLMRYHSVSTETPHERK KDFESKANHLGDTDGTPVKTRRHSWRQQIFLRVATPQKACDSPSRYED DYSELGELPPRSP

LEPVCEDGPFGPVQEEKRKTSRELRELWKKAILQQILLLRMEKENQKLQA ASENDLLNKRLKLDYEEITPCLKEVTTVWEKMLSTPGRSKIKFDMEKVH

SAVGQG GVPRHHRGEIWKFLAEQFHLKHPFPSKQQPKDVPYKELLKKLTSQQHAILIDLG GRTFPTHPYFSAQLGAGQLSLYNILKAYSLLDQEVGYC

QGLSFVAGILLLHMSEEEAFKMLKFLMFDMGLRKQYRPDMIILQ IQMYQLSRLLHDYHRDLYNHLEEHEIGPSLYAAPWFLTVFASQFPLGFVARVFD 

DMIFLQGSEVIFKVALSLLGSHKPLILQHENLETIVDFIKNTLPNLGLVQMEKTISQ - UNI7117 - VFEMDIAKQLQAYEVEYHVLQEELIESSPL

SDNQRMEKLEKTNSSLRKQNLDLLEQLQ VANARIQSLEATVEKLLTSESKLKQAALTLEVERSALLQMVEELRRQSARPSTPEPDCTQLEPTGD
Transcript ENSMUST00000101195
Sequence
GGAGGAAACGCGAGCGAGCCGCGCGCAGACACCTCCTCCTCCTCCTCAGCTGCTGTCGCCGCCGCCGGCCACACCGCGGTGCCTGTTGCTGCAAGCCACC

TCGGACCGACCGTCTCTTCAACCCGCAAGAGAAGCAGAGACTGTGGAGTGGACCCCCACCCCAGCAGCGTGGGGCGGCAAGAGCACAGCCAGCTGAGGAC

CATGGACGCCCCGCCCGCCCAGGCCATCTTCTGGGTGCCCGGGAGCACCTGCGCGCCCTAGCTCAGCCCGGAGTTCTGAGCGTGCCACCTCACTG - UN

I13098 - GATTCTGCCCTCAGAAGCACGTGAAATAGATCACTTCATTTAAAGTAGGAAAATAGTAGCACGTTTTCCTGGCTCTCCAGACCTCTCCCAG

GATGGAGGCAATCACATTCACAGCGAGGAAGCATCCGTTCCCTAACGAAGTCTCCGTGGACTTCGGCTTGCAGCTGGTGGGCTCCTTACCCGTGCATTCT

CTCACCACTATGCCCATGCTGCCGTGGGTGGTAGCCGAGGTACGAAGACTCAGTGGCCAGTGCTCTAAAAAGGAGCCTAGGACAAAGCAAGTCCGCCTTT

GGGTTTCGCCCTCCGGACTGCGGTGCGAGCCTGACCTGGAGAAAAGTCAACCATGGGACCCGCTCATCTGTTCCAGCATCTTTGAGTGCAAGCCTCAGCG

TGTGCACAAACTGATTCACAACAGTCACGACCCGAGCTACTTTGCTTGCCTCATTAAGGAGGATGCTGCGCACAGGCAGAGCCTCTGCTATGTGTTTAAA

GCAGACGATCAAACAAAA - UNI16784 - GTGCCTGAGATCATCAGCTCCATCCGGCAGGCCGGGAAGATTGCCCGCCAGGAAGAGCTGCGTTGCCC

CTCCGAGTTCGACGATACCTTCGCCAAAAAGTTCGAGGTGCTCTTCTGTGGCCGGGTGACTGTGGCTCACAAGAAGGCCCCACCCGCACTGATTGACGAG

TGTATCGAGAAGTTCAACCATGTGAGCTGTGGTCGCAGAACGGACTGGGAAGCGCCCACCGGGCAGCCATCAGCGCCTGGCCCCAGGCCCATGCGCAAAT

CCTTCTCACAGCCTGGACTGCGCTCGCTGGCCTTCAGGAAGGAGTTCCAGGACGCTAGCCTCCGCAGTAGCACCTTTAGCTCCTTTGACAATGACATAGA

GAACCACCTCATCGGTGGGCACAATGTGGTTCAGCCCACAGACATGGAGGAGAACCGAACTATGCTGTTCACG ATTGGCCAATCTGAAGTTTACCTCAT

CAGTCCTGACACCAAAAAGATTGCACTGGAGAAAAATTTTAAGGAGATATCCTTTTGCTCTCAG GGCATCAGACATGTGGACCACTTTGGATTCATCTG

CCGAGAGTGCTCGGGTGGCGGCAGTGGCGGCTTTCATTTTGTCTGTTACGTGTTCCAGTGCACAAATGAAGCTCTG GTTGACGAGATCATGATGACTCT

GAAGCAGGCTTTCACGGTAGCTGCGGTGCAGCAGACGGCTAAGGCACCAGCCCAGCTCTGTGAGGGCTGCCCCTTGCAAGGCCTGCACAAGCTCTGCGAA

AGGATAGAGG GAATGAATTCATCTAAAACCAAATTAGAACTCCAGAAGCACTTGACCACACTGACCAATCAGGAGCAGGCCACCATATTCGAGGAGGTT

CAG AAATTGAGACCAAGAAACGAGCAGCGAGAGAATGAATTAATTATTTCTTTTCTGAGGTGCTTATATGAAGAGAAGCAAAAAGAGCACAGCCACACT

GGGGAGCCAAAGCAG - UNI7615 - ACACTACAGGTGGCAGCAGAGAATATTGGGAGTGACCTGCCACCCAGTGCTAGCCGGTTCAGGTTAGATTCG

CTGAAGAACAGAGCAAAGAGGTCCTTAACAGAGTCCCTAGAGAGCATTCTGTCCCGG GGTAATAAAGCCAGAGGCCTGCAGGACCATTCCGCCAGTGTG

GATCTGGACAGCTCCACTTCTAGTACTCTAAGTAACACCAGCAAA GAGCTGTCCATGGGTGACAAGGAGGCCTTCCCCGTCTCTGAGACCTCCTTCAAG

CTCCTTGGCTCCTCAGATGACCTGTCCAGTGACTCAGAGGGCCACATTGCAGAAGAGTCTGCCCTGTTGTCACCCCAGCAGGCGTTCAGAAGGAGAGCCA

ACACCCTGAGTCATTTCCCAGTAGAGTGCCCTGCGCCTCCAGAACCTGCCCAGAGCTCTCCAGGGGTCTCTCAAAGGAAACTCATGCGGTACCACTCCGT

GAGCACAGAGACGCCTCATGAACGCAA GGACTTTGAATCCAAAGCAAACCACCTGGGTGACACAGATGGGACCCCCGTGAAGACCCGGCGGCACTCGTG

GAGACAGCAGATATTCCTTCGAGTGGCCACTCCACAGAAGGCTTGTGACTCCCCGAGCAGATATGAAG ATTATTCCGAGCTGGGAGAGCTCCCTCCACG

CTCCCCTTTAGAACCGGTGTGTGAGGACGGCCCATTTGGCCCAGTACAGGAAGAAAAGAGGAAGACGTCACGCGAGCTTCGAGAGCTGTGGAAAAAGGCC

ATCTTGCAGCAGATCCTGCTGCTCAGGATGGAGAAGGAGAATCAGAAGCTACAAG CCTCTGAAAACGATTTGCTGAACAAACGCCTCAAGCTTGACTAT

GAAGAAATCACTCCGTGTCTTAAAGAAGTCACTACAGTGTGGGAAAAGATGCTTAGCACTCCAGGAAGATCCAAAATTAAGTTTGACATGGAAAAAGTGC

ACTCAGCTGTTGGGCAAG GTGTGCCACGTCATCACCGAGGTGAGATCTGGAAATTTCTAGCTGAGCAGTTCCACCTTAAACACCCATTTCCTAGTAAAC

AGCAGCCAAAGGACGTGCCCTACAAAGAGCTCCTGAAGAAGCTGACCTCGCAGCAGCACGCCATTCTCATCGACCTCG GGCGAACCTTTCCAACACATC

CATACTTCTCTGCCCAGCTTGGAGCAGGTCAGCTGTCACTTTACAACATTCTGAAGGCCTACTCGCTTCTGGACCAGGAGGTTGGATACTGCCAAGGTCT

CAGCTTTGTGGCAGGCATTTTGCTTCTTCACATGAGTGAGGAAGAGGCGTTCAAGATGCTCAAGTTCCTGATGTTTGACATGGGGCTGCGGAAACAGTAT

CGGCCAGACATGATTATTTTGCAG ATCCAGATGTACCAGCTGTCACGGCTCCTCCACGATTACCACCGAGACCTCTACAACCACCTGGAAGAGCACGAG

ATCGGCCCCAGCCTCTACGCGGCTCCCTGGTTTCTCACTGTGTTCGCCTCACAGTTCCCACTCGGCTTTGTAGCCAGAGTCTTTG ATATGATCTTCCTT

CAGGGATCAGAGGTCATATTTAAAGTAGCTTTAAGTCTTTTGGGGAGCCATAAGCCCTTGATTCTACAGCATGAGAACCTGGAAACCATAGTGGACTTCA

TAAAGAACACACTCCCCAACCTGGGCCTGGTGCAGATGGAGAAGACCATCAGTCAG - UNI7117 - GTGTTTGAGATGGACATCGCCAAGCAGCTCC

AGGCCTATGAGGTCGAGTACCACGTGCTCCAGGAGGAGCTTATTGAGTCCTCGCCTCTCAGTGACAACCAAAGAATGGAGAAATTGGAGAAAACCAACAG

CAGCTTGCGCAAACAGAACCTTGACCTCCTGGAGCAGTTGCAG GTGGCAAATGCTAGGATCCAAAGCCTTGAAGCCACGGTAGAGAAACTTCTTACCAG

CGAGAGTAAGCTGAAGCAGGCTGCGCTGACCCTGGAGGTGGAGCGCTCCGCCCTGCTGCAGATGGTGGAGGAGCTGCGGAGGCAAAGCGCCCGGCCCAGC

ACTCCAGAGCCAGACTGCACCCAGCTGGAGCCCACAGGCGATTGACCGCTGCCAGAAGAGACTGTGCACCATTAACACTGTCCAAGCCTTAATCAAGAGA

GATGGAAGTCAGAGGCAGAGAAGAGAGAACTTCTCAGGGAGGAAACTGGCTGACCAGCCTGCAGATCCTTTTGAGCTCAGAACTTGGGATTGGAGGACAA

AAGTCTCAGAGTTATTGTTGTTTTTGGTTCTAATCCGTCCCCTTTCCAGTCCTGGTTGTTGTAGCTTTAGATGGCATGGACATGAATAAATTACATTTAT

GGTTCCTCCTCCTTCTTGCAGAGACACAGTGTGTGGAAAGAGCATTCATGACTGCAGTGTTCCAAAAACAAGATGGGTCTGAAATAATTCCTCAGGCAGA

AGAAACGTGACCCTTTGTCAGTCTGCAAGAAAGGTTCCTGGGAGGGTGCCCTTGATGTCACCTGAGGTGCAGTGGGCCCTTGTCCATTTTTATTATGGGA

CCTAAGGTGACCATGAGGAAGGAAGAAAGGGGTTTATTTAAATCAGATATATTGGTTGTTCCTGAATCCACGGTCACTCCCATTGGTACTGAAGAGAGCT

CATCTTTTACAAACTCAGTGTTTTAGTATGGTTTTTGCTTACCCTTTCAAGTCACAGGTAAATGTTTCATAAGGAAATCACAGTTTTTAGATTCCCTGTT

ATTGCTAGTGTGGGACCTGTAGCTGTGGGGTCTGACATATTTATTTCTTTTTGATTGTTTCATATCCACACTATAGGGTCACATATTTATTTTTGTCTGT

TGATAAATGATGTACCACTGCCACATCTTCCTTTGAGCCTTGAACCCCTTGGAAATCTGATTTCTCATAGAAGGAACAAAACATACCAAGATTTCCAGGG

GCTCCTAAGATGCTGAAACATTGCAAAAGAAACCAGATTGCAATCAGGTGTATGGCAGCTGACAGCTTTTCAGAAGTAGGAAGTGTGTTTTGAAAGTACT

CAAACACACGCACGCCTTCCTTGGGATGGCGAGGACCCTGTGCCTTCAAGCAGAGTGCAGCTCACACTCACCCTGCTTCTAGCTGGTCCTGTGTAGAGCA

TCACCCATGTGTGCAACAGCTTTTTTTTTTCTTTTAACATACACACAAAGGCTTAGGTTAGGGAAGACCACCAGCCAGGAGCCCTGGCTATCGGAATTGG

TCCTGCCTTGGGCTCTGTTGGCCCTCCTGTTCCTGGAGGTCTGCTGCAGCGCTGTTGGTAGGAAAGGAGCCTTGTAAGTCTGGGCTGTAAGGAGAGACCA

TCACCGTTGGGGTCATTTGGGATCTCCTAGCCCTATCAAAGGGACACTAAATGGCCAGGAGGGATGTAAGACTCCCACATGGTCTTGGGTCAGAGGAGAG

GTCTCTCCATAAACCAACATGCCCAGTCCCAGTTGGTTGGAGCAGGGGTTGTCAGAGGAGGGTGACAGTGGACAGCTTCTTTCCACATTGTATTTTATTA

TTTGAATGTTTTAATGTTGAATTTTGGACATGTTATTACTGTTCAAAAAACACTGACTCTACAGTAAGAAAAGAGCAATAAAACAGATTATTCACACCTG

T
Translation
 - UNI13098 - MEAITFTARKHPFPNEVSVDFGLQLVGSLPVHSLTTMPMLPWVVAEVRRLSGQCSKKEPRTKQVRLWVSPSGLRCEPDLEKSQPWD

PLICSSIFECKPQRVHKLIHNSHDPSYFACLIKEDAAHRQSLCYVFKADDQTK - UNI16784 - VPEIISSIRQAGKIARQEELRCPSEFDDTFAKK

FEVLFCGRVTVAHKKAPPALIDECIEKFNHVSCGRRTDWEAPTGQPSAPGPRPMRKSFSQPGLRSLAFRKEFQDASLRSSTFSSFDNDIENHLIGGHNVV

QPTDMEENRTMLFT IGQSEVYLISPDTKKIALEKNFKEISFCSQ GIRHVDHFGFICRECSGGGSGGFHFVCYVFQCTNEAL VDEIMMTLKQAFTVAA

VQQTAKAPAQLCEGCPLQGLHKLCERIEG GMNSSKTKLELQKHLTTLTNQEQATIFEEVQ KLRPRNEQRENELIISFLRCLYEEKQKEHSHTGEPKQ 

- UNI7615 - TLQVAAENIGSDLPPSASRFRLDSLKNRAKRSLTESLESILSR GNKARGLQDHSASVDLDSSTSSTLSNTSK ELSMGDKEAFPVSE

TSFKLLGSSDDLSSDSEGHIAEESALLSPQQAFRRRANTLSHFPVECPAPPEPAQSSPGVSQRKLMRYHSVSTETPHERK KDFESKANHLGDTDGTPVK

TRRHSWRQQIFLRVATPQKACDSPSRYED DYSELGELPPRSPLEPVCEDGPFGPVQEEKRKTSRELRELWKKAILQQILLLRMEKENQKLQA ASENDL

LNKRLKLDYEEITPCLKEVTTVWEKMLSTPGRSKIKFDMEKVHSAVGQG GVPRHHRGEIWKFLAEQFHLKHPFPSKQQPKDVPYKELLKKLTSQQHAIL

IDLG GRTFPTHPYFSAQLGAGQLSLYNILKAYSLLDQEVGYCQGLSFVAGILLLHMSEEEAFKMLKFLMFDMGLRKQYRPDMIILQ IQMYQLSRLLHD

YHRDLYNHLEEHEIGPSLYAAPWFLTVFASQFPLGFVARVFD DMIFLQGSEVIFKVALSLLGSHKPLILQHENLETIVDFIKNTLPNLGLVQMEKTISQ

 - UNI7117 - VFEMDIAKQLQAYEVEYHVLQEELIESSPLSDNQRMEKLEKTNSSLRKQNLDLLEQLQ VANARIQSLEATVEKLLTSESKLKQAAL

TLEVERSALLQMVEELRRQSARPSTPEPDCTQLEPTGD
Transcript ENSMUST00000043893
Sequence
GGAGGAAACGCGAGCGAGCCGCGCGCAGACACCTCCTCCTCCTCCTCAGCTGCTGTCGCCGCCGCCGGCCACACCGCGGTGCCTGTTGCTGCAAGCCACC

TCGGACCGACCGTCTCTTCAACCCGCAAGAGAAGCAGAGACTGTGGAGTGGACCCCCACCCCAGCAGCGTGGGGCGGCAAGAGCACAGCCAGCTGAGGAC

CATGGACGCCCCGCCCGCCCAGGCCATCTTCTGGGTGCCCGGGAGCACCTGCGCGCCCTAGCTCAGCCCGGAGTTCTGAGCGTGCCACCTCACTG - UN

I13098 - GATTCTGCCCTCAGAAGCACGTGAAATAGATCACTTCATTTAAAGTAGGAAAATAGTAGCACGTTTTCCTGGCTCTCCAGACCTCTCCCAG

GATGGAGGCAATCACATTCACAGCGAGGAAGCATCCGTTCCCTAACGAAGTCTCCGTGGACTTCGGCTTGCAGCTGGTGGGCTCCTTACCCGTGCATTCT

CTCACCACTATGCCCATGCTGCCGTGGGTGGTAGCCGAGGTACGAAGACTCAGTGGCCAGTGCTCTAAAAAGGAGCCTAGGACAAAGCAAGTCCGCCTTT

GGGTTTCGCCCTCCGGACTGCGGTGCGAGCCTGACCTGGAGAAAAGTCAACCATGGGACCCGCTCATCTGTTCCAGCATCTTTGAGTGCAAGCCTCAGCG

TGTGCACAAACTGATTCACAACAGTCACGACCCGAGCTACTTTGCTTGCCTCATTAAGGAGGATGCTGCGCACAGGCAGAGCCTCTGCTATGTGTTTAAA

GCAGACGATCAAACAAAA - UNI16784 - GTGCCTGAGATCATCAGCTCCATCCGGCAGGCCGGGAAGATTGCCCGCCAGGAAGAGCTGCGTTGCCC

CTCCGAGTTCGACGATACCTTCGCCAAAAAGTTCGAGGTGCTCTTCTGTGGCCGGGTGACTGTGGCTCACAAGAAGGCCCCACCCGCACTGATTGACGAG

TGTATCGAGAAGTTCAACCATGTGAGCTGTGGTCGCAGAACGGACTGGGAAGCGCCCACCGGGCAGCCATCAGCGCCTGGCCCCAGGCCCATGCGCAAAT

CCTTCTCACAGCCTGGACTGCGCTCGCTGGCCTTCAGGAAGGAGTTCCAGGACGCTAGCCTCCGCAGTAGCACCTTTAGCTCCTTTGACAATGACATAGA

GAACCACCTCATCGGTGGGCACAATGTGGTTCAGCCCACAGACATGGAGGAGAACCGAACTATGCTGTTCACG ATTGGCCAATCTGAAGTTTACCTCAT

CAGTCCTGACACCAAAAAGATTGCACTGGAGAAAAATTTTAAGGAGATATCCTTTTGCTCTCAG GGCATCAGACATGTGGACCACTTTGGATTCATCTG

CCGAGAGTGCTCGGGTGGCGGCAGTGGCGGCTTTCATTTTGTCTGTTACGTGTTCCAGTGCACAAATGAAGCTCTG GTTGACGAGATCATGATGACTCT

GAAGCAGGCTTTCACGGTAGCTGCGGTGCAGCAGACGGCTAAGGCACCAGCCCAGCTCTGTGAGGGCTGCCCCTTGCAAGGCCTGCACAAGCTCTGCGAA

AGGATAGAGG GAATGAATTCATCTAAAACCAAATTAGAACTCCAGAAGCACTTGACCACACTGACCAATCAGGAGCAGGCCACCATATTCGAGGAGGTT

CAG AAATTGAGACCAAGAAACGAGCAGCGAGAGAATGAATTAATTATTTCTTTTCTGAGGTGCTTATATGAAGAGAAGCAAAAAGAGCACAGCCACACT

GGGGAGCCAAAGCAG - UNI7615 - ACACTACAGGTGGCAGCAGAGAATATTGGGAGTGACCTGCCACCCAGTGCTAGCCGGTTCAGGTTAGATTCG

CTGAAGAACAGAGCAAAGAGGTCCTTAACAGAGTCCCTAGAGAGCATTCTGTCCCGG GGTAATAAAGCCAGAGGCCTGCAGGACCATTCCGCCAGTGTG

GATCTGGACAGCTCCACTTCTAGTACTCTAAGTAACACCAGCAAA GAGCTGTCCATGGGTGACAAGGAGGCCTTCCCCGTCTCTGAGACCTCCTTCAAG

CTCCTTGGCTCCTCAGATGACCTGTCCAGTGACTCAGAGGGCCACATTGCAGAAGAGTCTGCCCTGTTGTCACCCCAGCAGGCGTTCAGAAGGAGAGCCA

ACACCCTGAGTCATTTCCCAGTAGAGTGCCCTGCGCCTCCAGAACCTGCCCAGAGCTCTCCAGGGGTCTCTCAAAGGAAACTCATGCGGTACCACTCCGT

GAGCACAGAGACGCCTCATGAACGCAA TGTGGACCATCTTCCTGGGGGTGAGTCTCAGGGCTGCCCAGGGCAGCCTTCAGCTCCGCCTCCACCTCGTCT

TAACCCCTCCGCCTCCTCACCAAACTTCTTTAAGTACCTAAAACACAATTCCAGTGGAGAGCAAAGTGGGAATGCTGTGCCAAAAAG TGTCTCCTACCG

TAATGCCCTGCGGAAAAAACTCCATTCTTCCTCCTCTGTGCCAAATTTTCTAAAATTTCTGGCTCCCGTAGATGAAAATAACACCTGTGACTTTAAGAAC

ACGAACAG GGACTTTGAATCCAAAGCAAACCACCTGGGTGACACAGATGGGACCCCCGTGAAGACCCGGCGGCACTCGTGGAGACAGCAGATATTCCTT

CGAGTGGCCACTCCACAGAAGGCTTGTGACTCCCCGAGCAGATATGAAG ATTATTCCGAGCTGGGAGAGCTCCCTCCACGCTCCCCTTTAGAACCGGTG

TGTGAGGACGGCCCATTTGGCCCAGTACAGGAAGAAAAGAGGAAGACGTCACGCGAGCTTCGAGAGCTGTGGAAAAAGGCCATCTTGCAGCAGATCCTGC

TGCTCAGGATGGAGAAGGAGAATCAGAAGCTACAAG CCTCTGAAAACGATTTGCTGAACAAACGCCTCAAGCTTGACTATGAAGAAATCACTCCGTGTC

TTAAAGAAGTCACTACAGTGTGGGAAAAGATGCTTAGCACTCCAGGAAGATCCAAAATTAAGTTTGACATGGAAAAAGTGCACTCAGCTGTTGGGCAAG 

GTGTGCCACGTCATCACCGAGGTGAGATCTGGAAATTTCTAGCTGAGCAGTTCCACCTTAAACACCCATTTCCTAGTAAACAGCAGCCAAAGGACGTGCC

CTACAAAGAGCTCCTGAAGAAGCTGACCTCGCAGCAGCACGCCATTCTCATCGACCTCG GGCGAACCTTTCCAACACATCCATACTTCTCTGCCCAGCT

TGGAGCAGGTCAGCTGTCACTTTACAACATTCTGAAGGCCTACTCGCTTCTGGACCAGGAGGTTGGATACTGCCAAGGTCTCAGCTTTGTGGCAGGCATT

TTGCTTCTTCACATGAGTGAGGAAGAGGCGTTCAAGATGCTCAAGTTCCTGATGTTTGACATGGGGCTGCGGAAACAGTATCGGCCAGACATGATTATTT

TGCAG ATCCAGATGTACCAGCTGTCACGGCTCCTCCACGATTACCACCGAGACCTCTACAACCACCTGGAAGAGCACGAGATCGGCCCCAGCCTCTACG

CGGCTCCCTGGTTTCTCACTGTGTTCGCCTCACAGTTCCCACTCGGCTTTGTAGCCAGAGTCTTTG ATATGATCTTCCTTCAGGGATCAGAGGTCATAT

TTAAAGTAGCTTTAAGTCTTTTGGGGAGCCATAAGCCCTTGATTCTACAGCATGAGAACCTGGAAACCATAGTGGACTTCATAAAGAACACACTCCCCAA

CCTGGGCCTGGTGCAGATGGAGAAGACCATCAGTCAG - UNI7117 - GTGTTTGAGATGGACATCGCCAAGCAGCTCCAGGCCTATGAGGTCGAGTA

CCACGTGCTCCAGGAGGAGCTTATTGAGTCCTCGCCTCTCAGTGACAACCAAAGAATGGAGAAATTGGAGAAAACCAACAGCAGCTTGCGCAAACAGAAC

CTTGACCTCCTGGAGCAGTTGCAG GTGGCAAATGCTAGGATCCAAAGCCTTGAAGCCACGGTAGAGAAACTTCTTACCAGCGAGAGTAAGCTGAAGCAG

GCTGCGCTGACCCTGGAGGTGGAGCGCTCCGCCCTGCTGCAGATGGTGGAGGAGCTGCGGAGGCAAAGCGCCCGGCCCAGCACTCCAGAGCCAGACTGCA

CCCAGCTGGAGCCCACAGGCGATTGACCGCTGCCAGAAGAGACTGTGCACCATTAACACTGTCCAAGCCTTAATCAAGAGAGATGGAAGTCAGAGGCAGA

GAAGAGAGAACTTCTCAGGGAGGAAACTGGCTGACCAGCCTGCAGATCCTTTTGAGCTCAGAACTTGGGATTGGAGGACAAAAGTCTCAGAGTTATTGTT

GTTTTTGGTTCTAATCCGTCCCCTTTCCAGTCCTGGTTGTTGTAGCTTTAGATGGCATGGACATGAATAAATTACATTTATGGTTCCTCCTCCTTCTTGC

AGAGACACAGTGTGTGGAAAGAGCATTCATGACTGCAGTGTTCCAAAAACAAGATGGGTCTGAAATAATTCCTCAGGCAGAAGAAACGTGACCCTTTGTC

AGTCTGCAAGAAAGGTTCCTGGGAGGGTGCCCTTGATGTCACCTGAGGTGCAGTGGGCCCTTGTCCATTTTTATTATGGGACCTAAGGTGACCATGAGGA

AGGAAGAAAGGGGTTTATTTAAATCAGATATATTGGTTGTTCCTGAATCCACGGTCACTCCCATTGGTACTGAAGAGAGCTCATCTTTTACAAACTCAGT

GTTTTAGTATGGTTTTTGCTTACCCTTTCAAGTCACAGGTAAATGTTTCATAAGGAAATCACAGTTTTTAGATTCCCTGTTATTGCTAGTGTGGGACCTG

TAGCTGTGGGGTCTGACATATTTATTTCTTTTTGATTGTTTCATATCCACACTATAGGGTCACATATTTATTTTTGTCTGTTGATAAATGATGTACCACT

GCCACATCTTCCTTTGAGCCTTGAACCCCTTGGAAATCTGATTTCTCATAGAAGGAACAAAACATACCAAGATTTCCAGGGGCTCCTAAGATGCTGAAAC

ATTGCAAAAGAAACCAGATTGCAATCAGGTGTATGGCAGCTGACAGCTTTTCAGAAGTAGGAAGTGTGTTTTGAAAGTACTCAAACACACGCACGCCTTC

CTTGGGATGGCGAGGACCCTGTGCCTTCAAGCAGAGTGCAGCTCACACTCACCCTGCTTCTAGCTGGTCCTGTGTAGAGCATCACCCATGTGTGCAACAG

CTTTTTTTTTTCTTTTAACATACACACAAAGGCTTAGGTTAGGGAAGACCACCAGCCAGGAGCCCTGGCTATCGGAATTGGTCCTGCCTTGGGCTCTGTT

GGCCCTCCTGTTCCTGGAGGTCTGCTGCAGCGCTGTTGGTAGGAAAGGAGCCTTGTAAGTCTGGGCTGTAAGGAGAGACCATCACCGTTGGGGTCATTTG

GGATCTCCTAGCCCTATCAAAGGGACACTAAATGGCCAGGAGGGATGTAAGACTCCCACATGGTCTTGGGTCAGAGGAGAGGTCTCTCCATAAACCAACA

TGCCCAGTCCCAGTTGGTTGGAGCAGGGGTTGTCAGAGGAGGGTGACAGTGGACAGCTTCTTTCCACATTGTATTTTATTATTTGAATGTTTTAATGTTG

AATTTTGGACATGTTATTACTGTTCAAAAAACACTGACTCTACAGTAAGAAAAGAGCAATAAAACAGATTATTCACACCTGT
Translation
 - UNI13098 - MEAITFTARKHPFPNEVSVDFGLQLVGSLPVHSLTTMPMLPWVVAEVRRLSGQCSKKEPRTKQVRLWVSPSGLRCEPDLEKSQPWD

PLICSSIFECKPQRVHKLIHNSHDPSYFACLIKEDAAHRQSLCYVFKADDQTK - UNI16784 - VPEIISSIRQAGKIARQEELRCPSEFDDTFAKK

FEVLFCGRVTVAHKKAPPALIDECIEKFNHVSCGRRTDWEAPTGQPSAPGPRPMRKSFSQPGLRSLAFRKEFQDASLRSSTFSSFDNDIENHLIGGHNVV

QPTDMEENRTMLFT IGQSEVYLISPDTKKIALEKNFKEISFCSQ GIRHVDHFGFICRECSGGGSGGFHFVCYVFQCTNEAL VDEIMMTLKQAFTVAA

VQQTAKAPAQLCEGCPLQGLHKLCERIEG GMNSSKTKLELQKHLTTLTNQEQATIFEEVQ KLRPRNEQRENELIISFLRCLYEEKQKEHSHTGEPKQ 

- UNI7615 - TLQVAAENIGSDLPPSASRFRLDSLKNRAKRSLTESLESILSR GNKARGLQDHSASVDLDSSTSSTLSNTSK ELSMGDKEAFPVSE

TSFKLLGSSDDLSSDSEGHIAEESALLSPQQAFRRRANTLSHFPVECPAPPEPAQSSPGVSQRKLMRYHSVSTETPHERN NVDHLPGGESQGCPGQPSA

PPPPRLNPSASSPNFFKYLKHNSSGEQSGNAVPKS SVSYRNALRKKLHSSSSVPNFLKFLAPVDENNTCDFKNTNR RDFESKANHLGDTDGTPVKTRR

HSWRQQIFLRVATPQKACDSPSRYED DYSELGELPPRSPLEPVCEDGPFGPVQEEKRKTSRELRELWKKAILQQILLLRMEKENQKLQA ASENDLLNK

RLKLDYEEITPCLKEVTTVWEKMLSTPGRSKIKFDMEKVHSAVGQG GVPRHHRGEIWKFLAEQFHLKHPFPSKQQPKDVPYKELLKKLTSQQHAILIDL

G GRTFPTHPYFSAQLGAGQLSLYNILKAYSLLDQEVGYCQGLSFVAGILLLHMSEEEAFKMLKFLMFDMGLRKQYRPDMIILQ IQMYQLSRLLHDYHR

DLYNHLEEHEIGPSLYAAPWFLTVFASQFPLGFVARVFD DMIFLQGSEVIFKVALSLLGSHKPLILQHENLETIVDFIKNTLPNLGLVQMEKTISQ - 

UNI7117 - VFEMDIAKQLQAYEVEYHVLQEELIESSPLSDNQRMEKLEKTNSSLRKQNLDLLEQLQ VANARIQSLEATVEKLLTSESKLKQAALTLE

VERSALLQMVEELRRQSARPSTPEPDCTQLEPTGD

For any suggestions or comments, please send an email to unitrap@crg.es