Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000029178 (Klf3)
Chromosomal location
Chr 5: 65194628 - 65221367 (+)
Description
Kruppel-like factor 3 (basic) Gene [Source:MGI Symbol;Acc:MGI:1342773]
RefSeq_dna
NM_008453 
RefSeq_peptide
NP_032479.1 
MGI
MGI:1342773 
Uniprot/SWISSPROT
Q60980 
Uniprot/SPTREMBL
Q545J5 Q8BV07 
Human Ortholog
ENSG00000109787 (KLF3)
Omim not available
UniTrap UNI770
Vector Insertion
Chr 5: 65195031 - 65207973
Public Clones (sanger) CH0516 (sanger) M032E02 (ggtc) P133H03 (ggtc) M123H09 (ggtc)
D154A04 (ggtc) D040F11 (ggtc) D022D07 (ggtc) P141B04 (ggtc) P124D07 (ggtc)
E129A11 (ggtc) D139D10 (ggtc) D035A03 (ggtc) D005H02 (ggtc) P135F03 (ggtc)
P100F05 (ggtc) E044B03 (ggtc) D047E07 (ggtc) D031B08 (ggtc) P128G01 (ggtc)
H009B06 (ggtc) D020C04 (ggtc) P138B04 (ggtc) P123B02 (ggtc) E125B12 (ggtc)
D135B09 (ggtc) D034H10 (ggtc) P096G07 (ggtc) D042G10 (ggtc) D028B06 (ggtc)
E139C10 (ggtc) D143H10 (ggtc) D039B11 (ggtc) D017A12 (ggtc) E078F05 (ggtc)
D064A07 (ggtc) PST25512-NR (escells) PST17489-NR (escells) PSTVU01.HM16 (vanderbilt)
IST10466A3 (tigm) IST15021F2 (tigm) IST11272D10 (tigm) IST10091D1 (tigm)
IST11188G2 (tigm) IST14207F11 (tigm) IST14191G2 (tigm) IST14524E12 (tigm)
IST10888G2 (tigm)
Private Clones OST472465 (lexicon) OST459752 (lexicon) OST413277 (lexicon) OST402565 (lexicon)
OST389366 (lexicon) OST367537 (lexicon) OST325270 (lexicon) OST321118 (lexicon)
OST320973 (lexicon) OST317291 (lexicon) OST305264 (lexicon) OST304387 (lexicon)
OST303304 (lexicon) OST303082 (lexicon) OST298189 (lexicon) OST287720 (lexicon)
OST280798 (lexicon) OST271935 (lexicon) OST264581 (lexicon) OST263381 (lexicon)
OST259261 (lexicon) OST258279 (lexicon) OST257665 (lexicon) OST253362 (lexicon)
OST252078 (lexicon) OST247309 (lexicon) OST237434 (lexicon) OST218006 (lexicon)
OST208400 (lexicon) OST196394 (lexicon) OST195741 (lexicon) OST194535 (lexicon)
OST188170 (lexicon) OST183614 (lexicon) OST179545 (lexicon) OST172198 (lexicon)
OST170234 (lexicon) OST170219 (lexicon) OST170051 (lexicon) OST165705 (lexicon)
OST143625 (lexicon) OST137083 (lexicon) OST131897 (lexicon) OST119087 (lexicon)
OST118802 (lexicon) OST79563 (lexicon) OST55084 (lexicon) OST52150 (lexicon)
OST45295 (lexicon) OST41153 (lexicon) OST39917 (lexicon) OST38020 (lexicon)
OST35867 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2083
Vector Insertion
Chr 5: 65208070 - 65213112
Public Clones (sanger) XS0187 (sanger) P127H07 (ggtc) D173D06 (ggtc) IST13659E9 (tigm)
IST14593A12 (tigm)
Private Clones OST448750 (lexicon) OST424934 (lexicon) OST280469 (lexicon) OST248574 (lexicon)
OST247690 (lexicon) OST240511 (lexicon) OST234028 (lexicon) OST180464 (lexicon)
OST141985 (lexicon) OST40079 (lexicon)
Severity of mutation (?) Insertion after 5% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25427
Vector Insertion
Chr 5: 65213597 - 65214117
Public Clones not available
Private Clones OST184307 (lexicon) OST86629 (lexicon)
Severity of mutation (?) Insertion after 52% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30320
Vector Insertion
Chr 5: 65214269 - 65218348
Public Clones D014C10 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 67% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17963
Vector Insertion
Chr 5: 65218510 - 65220215
Public Clones not available
Private Clones OST432724 (lexicon) OST275488 (lexicon) OST30344 (lexicon)
Severity of mutation (?) Insertion after 83% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000031074
Sequence
GGCGGCTGCCTCCACCCAAGTGGGTGGGGACCCCTCCCAGCCCGGGCGGCTGTGGCGGCTCCCGCTGCCCCTCCCTGACCCTCCCACCCCGGCTCCCAGC

CTCTACTTACCCCGCCAGCCCCGGGGAGGCTCGCAGAGCGAGCGGCGCCGGCGTCATGTGACTGCCCAGAGTTGGTGCCAAGGAGCCAGAGGGGAGCGGG

GAGCCGAGCCGCGCGGAGCCGCGGCCGGAGCGCAGTGCGAGCGCCACCCGAGCCAACCCCACCCGCGCGTCCGTGCGGTCGCGGTCCCTATCCCGGACGC

CGTCCGGCCCGAAGCGCTTGACCTGCCGGCCCGCGGGGTTCCGGGCGCCGGGGAGCCGGGCCTGGGTTTCTTGGCCGCTGCGCTCGGCACCGCGCTTGGC

AGA - UNI770 - GCCAGACATCAGAACACCCTAGAAGGCGTGGCTGAAAGGATGCTCATGTTTGATCCAGTCCCTGTCAAGCAGGAGGCCATGGACC

CTGTCTCGGTG - UNI2083 - TCCTTCCCGTCGAATTACATAGAATCGATGAAGCCCAACAAATATGGGGTCATTTACTCCACACCGTTGCCTGATA

AGTTCTTCCAGACCCCAGAAGGCCTCACTCACGGGATACAGGTGGAGCCGGTGGACCTCACGGTGAACAAGCGGGGCTCCCCGCCTGCTGCGGGCGGTTC

TCCTTCCTCTCTGAAGTTCCCGTCCCACCGGAGAGCGTCACCTGGCCTCAGCATGCCCTCCTCCAGTCCGCCCATTAAGAAGTACTCGCCCCCTTCTCCT

GGCGTGCAGCCCTTTGGAGTACCCCTGTCTATGCCGCCTGTGATGGCAGCCGCGCTGTCCAGACACGGAATCCGGAGCCCAGGCATCCTCCCCGTCATTC

AGCCCGTCGTGGTCCAGCCCGTTCCTTTTATGTATACCAGCCACCTGCAGCAGCCTCTCATGGTTTCCTTGTCGGAAGAGATGGACAATTCAAACAGCGG

CATGCCAG - UNI25427 - TACCTGTAATTGAATCATATGAGAAGCCCTTATTACAGAAAAAAATTAAAATAGAGCCTGGAATTGAACCACAGAGGA

CTGACTATTACCCTGAAGAAATGTCACCCCCTTTAATGAACCCAGTGTCCCCCCCGCAAGCCTTGTTGCAAGA - UNI30320 - GAACCATCCTTCC

GTCATCGTGCAGCCTGGGAAGAGACCTCTACCTGTGGAATCCCCGGATACCCAAAGGAAGCGCAGGATACACAGATGCGACTATGATGGGTGCAATAAGG

TCTACACTAAGAGCTCGCACTTGAAAGCACACAGAAGAACTCATACAG - UNI17963 - GAGAAAAGCCGTACAAATGCACCTGGGAAGGCTGCACG

TGGAAGTTCGCTCGGTCTGATGAACTGACGAGACATTTCCGAAAACACACTGGGATCAAACCTTTCCAGTGTCCAGACTGTGACCGAAGCTTCTCTCGCT

CTGACCACCTTGCCCTACACAGGAAACGCCACATGCTAGTCTGAAAACCTGTCTCCAGCTCAGTGTGATTCCCCGCTCTTCCTGGCCTCTCTCTCTTTCT

CTCTCTCTCTCTCCTATCTCTTTCTCTTCTCCTTCTGCCCGTTATCTAACTCATTTTTATATGTACATTTTAATTTCGATTCAGCTGGTCTGGATCTCTG

AATTTATATCATTCAAGACTTCCATATGGTCAGTAGTTGATACTCTAACCCTCCCCTCCTTACCACGGGTCAGACCTAAAGAATGTGAACATTATTTTTT

CCGGGGATGCTAAGCAAACCCTCCTTACAGATACATTTAATGTAACGAGAACAAGGGAACATGTAAACTAACGACCAATTTGTCGGTTTCTCCATGTATT

CCTCAAAAGAATGTCAAAGTAAATGTATTAGAAATGCAGTATCCAGCCTATTAGTCCTTGCCAGAGACCTTCGACTTTCTGCCACATTTTGTGTTTGACG

ACAGAAAGAATTCTGTCCCTGTTACCAGCTAGCGAGACCTACAAGATGTCAAGCTGGACCCACCGTCTCGCCTTCGCCCTCCCCACGATTCGCCTGTTGA

CCTGGCTCACCTGCTCAGCTAAATCAGCTCCTTTGTCCTCTGTGGCACCTGAAGCTCATGTGGAGGGCTTTGACATCCCTGGGAGCTGAGCAGGAGCTGT

TGCCTTAGGTGGGCCATGTGCTCCCATAGTGTGAGGAAGAAGGAGAAGATATTGGAAATGGAGGAGGGAGTCAGCGATTCCTGGCTAGGACCGGCTGGAC

CATCAACATCTGGGAAATTCACATTAGCTGTGCAGTGCATTTGTTAAATGTCCATCCCCAGGCACAACTTGGCCGAGCACACCTTTGCTGCAAAGCTGGA

TACCGAGAGGGTTATCCATCTGTGCCACCACCACCTCCGTTCCTGCAGGATCCTTCATTGTCGATCATGAAGCCTTGAGAGTAAGGAATCCACAGAAATA

TTTGTTCAGTCATG
Translation
 - UNI770 - MLMFDPVPVKQEAMDPVSV - UNI2083 - SFPSNYIESMKPNKYGVIYSTPLPDKFFQTPEGLTHGIQVEPVDLTVNKRGSPPAA

GGSPSSLKFPSHRRASPGLSMPSSSPPIKKYSPPSPGVQPFGVPLSMPPVMAAALSRHGIRSPGILPVIQPVVVQPVPFMYTSHLQQPLMVSLSEEMDNS

NSGMPV - UNI25427 - VPVIESYEKPLLQKKIKIEPGIEPQRTDYYPEEMSPPLMNPVSPPQALLQE - UNI30320 - ENHPSVIVQPGKRPL

PVESPDTQRKRRIHRCDYDGCNKVYTKSSHLKAHRRTHTG - UNI17963 - GEKPYKCTWEGCTWKFARSDELTRHFRKHTGIKPFQCPDCDRSFSR

SDHLALHRKRHMLV

For any suggestions or comments, please send an email to unitrap@crg.es