Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000029190 (D5Ertd579e)
Chromosomal location
Chr 5: 36943153 - 37087193 (-)
Description
Uncharacterized protein KIAA0232  [Source:UniProtKB/Swiss-Prot;Acc:Q80U59]
RefSeq_peptide
NP_001074701.2 
UniGene
Mm.471849 Mm.26480 
MGI
MGI:1261849 
Uniprot/SWISSPROT
Q80U59 
Human Ortholog
not available
Omim not available
UniTrap UNI34885
Vector Insertion
Chr 5: 37062640 - 37087194
Public Clones (ggtc) IST14605B4 (tigm) IST14462F3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000066244
Sequence
GCCGCTTTACGTAAGGCGCAGGCCAGGGCCGCCCGGCGCTCGGCAGCCGCCTGCAGCCCTCGGAGCGCAAGGAGAGGCGCCCACCCGGTAGCCTTGGCAG

 - UNI34885 - GGACTGCCAGAGACTGACATTGCCTCAATGTGAAATGAAAGTTGAAAACCTCATCTCCTTGTGTGTTGCTATCATGGTGTTGATTC

ACTGGTCATGCCTGAAGAGGGAAATTGTGTTGTAGAGAGCTGACTGCTGCGCGGTCACTGCCTATCCTCCATGTTCAGCTCCTCTCCTTTCTGCTGGAGT

GAAATCCTCTCCGGATTCCAACAGAACGTCCACTGTAGAAAATGCTTTGCATTTTAAGAATGTCAGCAACCTAAGTTCATGCGCCCTGTCTGTACAGTTG

TTGTGGATGGTTTGCCATCTGAAAGCACCTCAAGTTCTTATCCAGGCCCTGTGTCTGTTTCTGACATGTCGCTGCTTCATGCATTGGGCCCAGTGCAAAC

CTGGCTGGGACAAGAGCTGGAGAAATGTGGCATTGATGCCATGATTTATTCACGGTATATCCTCAGTCTTCTGCTGCATGACAGCTATGACTACGACCTG

CAGGAACAGGTAGGTATTGACGCATGTTAAGTGTTTTCTGACGACAGTTGATGATGACGACTATGTCTGTGTCTAGTTACATTCTGTTGTTGTGATAAAA

TACCCCAACAGAAGCTTAACTTAAGGGAGAGAGTTTATAAGTCCAGATTATGACTCATCATGGCTGGGAAGCCACAGTGGCAGGAGCCCGAGAGAACTGG

TCACGGTATGTTCAGGTGAGCGGAGAGCGATGAATGCATCCATGCTAGTGCTCAGCTTGCCCTCTCCAGGCCATTCAGTCCAAGGTCCTTTGCACAGCAA

ATGATGCTGCCCACGATTAAGATGGGTCTTCCCACATGAGCTCAATCAAGATAATCCTTCACACATTCTTAGAGATGCCTTAATGTAGACCAGTGTTTCT

CAACCTTCTAAATGCTGTAACCCTTTAATACAGTTCTTCATGTTGTGGTGACCCCAACCATAAAATTAACTGTAATGTTGCCACTGTTAAGAATCATAAT

GTAAGTATCTGATATGCAGGATATCTGATATGTGACTCCCAAAGGGGTTTCCACCCACAGGTTGAGAACTAATGATCTAGGCAGTCCTTCACAAGTGTAC

CTTTAGGCTTGCCTCCCAGGTATCAAGATGACAGTATTAACTGTATTTGCATATTCTTTTATTTATTTTTGAGGTGGAAGGGAACATGTGCCACGGCATT

CGTGTGAAGATGAGAGGACAACTTGTAGGAGCTGACTCTCCTTTCCACCTTGTAGGTTCCAGGGATTGAACCCAGGTTGTCAGGCTTAACAGCAGGCAAC

TTTGAGGATCATCTTCTGTCTCTGTCTCAGGCTCACTCCTTCTTGGGGCCTGCCATCCCACTCAGTCTTGGGTTTGCTCCTGACTCCGAGATCCTGGCCC

TGAACTCAAGCTAGCTTCCTGTCCCAGCCCCCTGGTACCAGTCTGGTGGTCATCTGAGGCTCACTGTTTTCAGGGAATGTTAGGCTACTAATCATCCATT

CATATGTTCACAGATCAGAGCATAGCCTATGTCCTCTCTGCCACCTACTGATGCACATGTGACACAGCAGCCACACCTGTAACACTCTGGGGAGGAAGAA

CAAACTTATATTGACAAGAATCTGGCTTTACCTTTCCAAACTCACACAAAAGCCCTAGAGACAGTTGGCTGCCATGCCTGCTTAGCTTTTAACTTAGGTT

GTGGAAATCTAAACTCTGGTCCTCACACTTTTCTAGCAAATGCTTTTTCCACTGAGCATCTCCCCCGGTGCCAAAAATACTTTTTTACTTAGCCGTAAGG

CAAAGAATACCATGGCTTGTAAGGGAAGGTCAAATAAAAAAACAATTTTATTGTT
Translation
 - UNI34885 - MRPVCTVVVDGLPSESTSSSYPGPVSVSDMSLLHALGPVQTWLGQELEKCGIDAMIYSRYILSLLLHDSYDYDLQEQVGIDAC
Transcript ENSMUST00000087545
Sequence
GAGAAGTGGATTATAATTGCGGGCCTCATTACACCTTGACCGTTATG AGCTCTGGGATCGAGACTTTAGTAGAAGAGCTCTGCTGCAGACTGAAAGACC

TACAGAGCGAGCAAG AAGAGAAGATTCACAAAAAGTTAGAAGGTTCTCCTTCTCCAGAGGAAGAATTGTCCCCTACAGCAAAAGATCAAGTGGAAAT G

TACTATGAAGCATTTCCACCACTGTCTGAGAAACCGGTTTGCCTGCAAGAGATCATGACCGTGTGGAACAAGTCCAAACCCTGTTCTTACTCTAGCTCCT

CGTCATCATCCACAGTCCCACCAGCAAGCACGGATACATCTTCTCCAAAGGACTGCAACAGTGAGAGTGAAGCCGTCAGAGAGAGAAGCAGTGTCGCCTC

TGTCCCCATGCATGAGAAAGCCCAGAGCAGGAGCAGACACGAGAAGGAGAGCAAGCTGAGCAGTAGCACCATCGAAGAAAAGCCTGCCTTTTACAAAAGG

CAGATCCGACACAAACCTGAAGGGAAGACGCGCCCTCGCTCATGGTCATCTGGCTCTAGTGAAGCAGGTTCAAGTTCAAGTGGTAACCAAGGAGAGTTAA

AAGCATCCATGAAGTATGTTAAAGTCAGACACAAGGCACGAGAAATTCGAAACAGAAAAGGGCGGAATGGGCAAAACAGGCATTCACTGAAGCATTGTGG

AAAGGCAGAGAGAGGAGTCCATGCAGGCAGTGGTGGCAGCAGCAGCAGCAGCAGCAATGGGTCCATCAGGCAGCTGTGCAAGCGGGGTAAAAGACCAGCA

AAGGAGACGGGAAGGAGCGACTCTGGGAACACTGCAGTGAAAGACCTGTATGTGGACAGCAGAAACAACAAAGAGTACAAGGAAGAGCCCCTGTGGTACA

CAGAGCCCATTGCTGAGTATTTTGTTCCTTTGAGTAGAAAAAGCAAACTAGAGACCACATACCGAAACAGGGAAGATACAAGTACTCTGACAGCAGAGGC

AGTGGAAGACTTGTCTGACTCTGTGCGTGGTCTGTGTATCAGTAACAGTAATATCCACAGAACATACCTCGCAGCAGGTACTTTCATTGATGGTCATTTT

GTAGAAATGCCTGCAGTTATAAACGAGGATATTGACCTCGCTGGGACCTCATTATGTTCTCTACCAGAGGACAATAAGTATCTGGATGATATTCATCTAT

CAGAACTAACACACTTCTATGAAGTGGATATTGATCAATCCATGTTGGATCCTGGTGCCTCAGAAACAATGCAAGGAGAAAGTCGGATTTTGAATATGAT

TCGACAAAAAAGCAAGGAGAATACAGATTTTGAGGCAGAATGTTGCATAGTGTTAGATGGTATGGAGTTGCAAGGGGAACGTGCAATATGGACAGATTCT

ACCAGCTCTGTGGGTGCTGAGGGCTTCTTCCTGCAAGACCTTGGCAATCTGGCTCAGTTTTGGGAGTGTTGTTCATCTAGTTCTGGTGATGCTGATGGAG

AGAGTTTTGGAGGAGACTCTCCAGTTAGACTCTCTCCTATCTTGGACAGCACGATGCTCAGTTCACACATACTTGCTGGCAATCAAGAGCCCTTTTCCAA

TATTAATGAAGGATCTGGTATAAACTCTTGTTTTTCAGTATTTGAAGTGCAATGCAGTAATTCTGTTTTACCATTTTCTTTTGAAACACTCAACTTGGGA

AGTGAACATGCAGATTCTAGTGCTAATATGCTGGGGAAAACACAGTCTAGATTGCTCATATGGACCAAAAATAGTGCCTTTGAAGAAAACGAACACTGTT

CTAATCTTTCAACAAGAACTTGTAGTCCGTGGTCCCATTCGGAAGAAGCACGCTCAGACAATGAGACACTAAACATTCAGTTTGAAGAATCGACACAGTT

TACTGCAGAAGATATTAATTATGTGGTTCCCAGAGTCTCGTCAGATTTTGTAGATGAAGAGCTTCTAGATTTTTTGCAGGATGAAACTTGCCAGCAAAAC

AGTAGAACTTTAGGAGAAATTCCTACATTAGTTTTCAAAAAACGATCTAAGCTAGAATCTGTGTGTGGTATTCAGCTAGAACAAAAGGCAGAAAGCAAGA

ACTTTGAAACTACACATGCATGTAGTGAAAGCAGTCCACATGGAGATGGCTACAGCTCAGGGGTTATTAAAGACATTTGGACAAAGATGGTAGGTAGGAG

TTCTGTGGCTGCAGTAGAGACAGAAAGAACTGGGGAGGAATTGTTTTCCACAGATGTAAATAACTACTGCTGCTGTTTGGATACTGAGGCGAAGATGGAA

GCCCTTCAAGAGCCTAGTAGGGCTGTGCAGAGATCAGAGTATCATCTCTGGGAGGGACAGAAGGAGAACATGGAGAAGAGAGCATTTGTCTCTAGTGAGC

TGTCCAAGGTGGATGGTGGCGATTACACCACACCCTCTAAACCTTGGGATGTGGCCCAAGATAAGGAGAACACATTCATTCTTGGAGGAGTTTATGGAGA

GCTCAAAACATTCAACAGTGATGGGGAGTGGGCAGTTGTACCACCTGGTCACACAAAAGGGAGCTTGCTACAGTGTGCAGCCTCTGATGTGGTGACAATC

GCCGGTACAGATGTCTTTATGACCCCTGGAAACAGCTTTGCTCCTGGTCACAGGCAGCTCTGGAAGCCCTTTGTGTCATTTGAACAGAGTGACATGCCGA

AGAGCGGGGAAAATGGAGTAAACAAGGGGTTTTCTTTTATCTTCCATGAAGACTTGCTAGGAGCCTGCAGTAACTTTCAAGTTGAAGATCCTGGCCTTGA

ATACTCACTCTCTTCCTTTGACCTAAGCAACCCCTTCTCACAAGTTCTCCACGTAGAGTGTTCATTTGAACCAGAAGGGATTGCATCTTTTAGCCCCAGT

TTCAAGCCGAAATCAATCCTCTGCTCTGATTCAGACAGTGAGGTTTTTCACCCCAGAATATGTGGTGTCGAAAGGACACAGTACAGGGCTATTCGAATCT

CTCCCCGGACTCACTTTCGCCCGATTTCTGCATCTGAACTATCCCCTGGAGGAGGAAGTGAGTCAGAATTCGAATCTGAAAAAGATGAAGCGAGTGTTCC

CATTCCTTCCCAAGTTGATGTATTTGAAGACCCACAAGCAGATCTCAAACCTTTAGAGGAAGATGCAGAGAAAGAAGGTCACTACTATGGAAAGTTAGAG

CTTGAGTCTGGGAAGTTCCTGCCCAGGTTAAAAAAATCTGGAATGGAGAAGAGTGCTCAGACATCACTGGATTCCCAGGAGGAGGCAACTGGGATTCTGC

CGAAACAAAATCAGTGTTTGGAATGTAACTTTAACGAATCTCTAGAAATTAATTTAGAAAGCTCAGCAGCAAACTGTAAAATAATGACACAATGTGAGGA

AGAGATGAGTGAGTTTTGCAGTTGCAAAGCAGGTTGTCAGTTCCCTGCTTGTGAAGATAATCCAGTTTCTTCAGGACAATTGGAAGAG TTTCCTGTACT

GAACACTGATGTGCAAGAAGTAACAAGAAATCAAGAAAAGCAGAGCTGGTGGGAAAAAGCTTTGTACTCTCCCCTTTTCCCCACGTCAGAGTGTGAAG A

ATGTTATACAAATGCCAAGGGAGAGAATGGTATAGAAGAATGTCCAGATGCTAAAGAGACACCCAGTCGTGAAGAGCGTCTGTTAGATTTTAATAGG GT

GTCTTCTGTTTATGAAGCAAGATGCACAGGAGAGAGAGGTTCTGAGACAAAACCAAATGGCCTCCACAGGAAGATGTGTTCCAGTGCCAGCTCTGACACG

GGCGACACAGGCTCCGAAGCCGGCGGAGAGTGGGTGGGCCCCAGCAGAGAGGAGCTCTTCTCCCGAACACATCTCTGACCCTGCAGAGTAGTACCAGTCA

TTGAAAATGGCTGTGATGGGCAATTGCCTTGTGTGAGGCCTGTTAGTCTAAAGCAGCAACTTAGGTTTCTTCTTCAATTAACTGATCCACATCAGTGATT

ACCTTTCTCTTCTTGCTTATTTTAGCGTTGAGGACGGCTGTCCTGTTGAAGATTTGTTTCCAAGCTGTTAAGTTCTTGCTCTCTGAAGTAGACTAGACTG

TGCTGTCCATGAGGAATGGGTGTGCATGTGCTTGTCCTAGTGCGTCCCGCTTCTGCATCGCAGCTGCAGGCCTCCCTCTGGCGGCTGTGTCGCCATCACC

TTGTCAGCACCGTGGCGACAACCGCCACCGTCCAGAGACTCTAGCTCTGTTCTCTGAGCCAGGAGATCAGTCCTCCCCTGCAGTGGGTCAGGGCCTTGCT

GAAGGAGGAGGGAAGCATGGTGACTCATCTGCAGGCTCATTCAGAAGATCTCATGGACATTGCTGTAGGAACACAAGGGTGTGCTTTAGAGACTTACAGA

ATACTGTGCTTTCTCTTAGGATTCCCCTAAAGTACCATGGAAGTTACTGTGGCTTGTGACTTTCTTGCTAGCTGAAGAAGCCAAGGATTTGAGGCCTGGG

TTAGATGGGTGAGTTCTGCTACTGCAGTGTGTCCATAGCAGGCATAGTGGGGTTCTCTGAGCTGCCTCTCCAGTGCATAGTTGAGGACCTTACTTGTAAA

TTGTTATCTGGTGACGACACTGAACTTAATTCTCCAAGTGAACTTCAAAACATTGGACATGCAGTGAGGCCACCTCTTACCCCAAAGAAATCTTTGGCTG

CTGCAGCTAGCTGCTCTCGTGGCTGTGATGTAGTGTAGCTTGTATCTCATTTTGTGTTTGAGAGAATGCTCTGGGCAAGTTCTGCTTGTGGGCTGGGGTT

GGTAGAGGAACTTCCCACACACTTCCCTGTGTGATTGCTGTTCTGATTATCGACTCGTGGGACTTGGTGCAGCAGGCAGGCAGCAGGCCTCACACAGTTG

CATCTAAGCGTGCTGATCACCTCGGATCTCTCTCGCAGCACTGCCACAGGTGCTAGTAGGGCCAATTGTGTAAAACCTAAACATCCAAAATGATTTTTCT

CTTTTAACTAACTTGTTGTTTTTAAAAACACCTTGTCTGTGACATGAGCTCAGCATGTCCAGAACATCAGGAGTAGCGGAGAGGTCTTAAGTAGTTGAAC

TGGCCTCACCAGCAAGTGGGACGGCACTGGGCATGCGTGTGGCTTCTTAGCTGGGAGTGGAGCTGCCCCTCGGGCCTTGCTGGTAGTACTTGAGTTTGTT

GCCTGTTTCTCAGGAACACAGGAAACACCGTGGAGCCTGTGCAGGCACTGTCGTTCTGGCTTGCTGGCTGGGGCCTCTTGCCATCTTAGGGTCTGTTTCA

TACAGCACATCCTGACACTGACAGTGGTGCGTGTGCGTGTGTGCATGTAGAAGGGTTCATGTTGCTCTTATTTATTTACAGGTATCAGATACATTTTATG

TATTTTTTTCTTCTGGAGCTTCCTAAAATCTGATTAACATCTGCACTGAAATATAACCTATCATCAAAGGCAAAAAGGATTGGAAGTTGTAAATTCCTAA

AATCAATGCCATCAAGATTACCCTAGAAATTGTTGCTATGACCAAATGGATTTCATACTCAGCCATGAGCTTGGGTGACCTGGACAGCCAATGTTTATCA

GGAAAAGGCTCCAGGTGGCAAAGAAGCCTCCCTCCTCAGCTGTGGTTGTGGGGAGAGGCCCCCCACAGGGGATACGGTGGGTCATCAAAGGCAAAGGGAT

GACTAGATTCTGTATTTGGTTTCTTTTGTAGTAAGTGGCTGAAGCTCAGAGGCTTTGGTACAGAATTAAAGTGTGGTTTTAGTTTCTTGAATGGATGATC

ACAAAAAAAGCATTAAAAAAAGTTGGCAAACGCTGAAGCGCACTGTGGTATGAAGCGCGTTGCACATCCGTAGCACTGAAGTATCAGCTCCGTTCCTGGG

CTGATTTTCCCCCCGTGGTTGTATTGTTCTGATTTCACGTACACCAGAGTAACTGATTTTTTTTTTGTTTTGTTTTGTTTTCTTGTGGAGTTAACACC
Translation
M SSGIETLVEELCCRLKDLQSEQE EEKIHKKLEGSPSPEEELSPTAKDQVEM MYYEAFPPLSEKPVCLQEIMTVWNKSKPCSYSSSSSSSTVPPAST

DTSSPKDCNSESEAVRERSSVASVPMHEKAQSRSRHEKESKLSSSTIEEKPAFYKRQIRHKPEGKTRPRSWSSGSSEAGSSSSGNQGELKASMKYVKVRH

KAREIRNRKGRNGQNRHSLKHCGKAERGVHAGSGGSSSSSSNGSIRQLCKRGKRPAKETGRSDSGNTAVKDLYVDSRNNKEYKEEPLWYTEPIAEYFVPL

SRKSKLETTYRNREDTSTLTAEAVEDLSDSVRGLCISNSNIHRTYLAAGTFIDGHFVEMPAVINEDIDLAGTSLCSLPEDNKYLDDIHLSELTHFYEVDI

DQSMLDPGASETMQGESRILNMIRQKSKENTDFEAECCIVLDGMELQGERAIWTDSTSSVGAEGFFLQDLGNLAQFWECCSSSSGDADGESFGGDSPVRL

SPILDSTMLSSHILAGNQEPFSNINEGSGINSCFSVFEVQCSNSVLPFSFETLNLGSEHADSSANMLGKTQSRLLIWTKNSAFEENEHCSNLSTRTCSPW

SHSEEARSDNETLNIQFEESTQFTAEDINYVVPRVSSDFVDEELLDFLQDETCQQNSRTLGEIPTLVFKKRSKLESVCGIQLEQKAESKNFETTHACSES

SPHGDGYSSGVIKDIWTKMVGRSSVAAVETERTGEELFSTDVNNYCCCLDTEAKMEALQEPSRAVQRSEYHLWEGQKENMEKRAFVSSELSKVDGGDYTT

PSKPWDVAQDKENTFILGGVYGELKTFNSDGEWAVVPPGHTKGSLLQCAASDVVTIAGTDVFMTPGNSFAPGHRQLWKPFVSFEQSDMPKSGENGVNKGF

SFIFHEDLLGACSNFQVEDPGLEYSLSSFDLSNPFSQVLHVECSFEPEGIASFSPSFKPKSILCSDSDSEVFHPRICGVERTQYRAIRISPRTHFRPISA

SELSPGGGSESEFESEKDEASVPIPSQVDVFEDPQADLKPLEEDAEKEGHYYGKLELESGKFLPRLKKSGMEKSAQTSLDSQEEATGILPKQNQCLECNF

NESLEINLESSAANCKIMTQCEEEMSEFCSCKAGCQFPACEDNPVSSGQLEE FPVLNTDVQEVTRNQEKQSWWEKALYSPLFPTSECEE ECYTNAKGE

NGIEECPDAKETPSREERLLDFNR VSSVYEARCTGERGSETKPNGLHRKMCSSASSDTGDTGSEAGGEWVGPSREELFSRTHL
Transcript ENSMUST00000031091
Sequence
TATCCAGGCCCTGTGTCTGTTTCTGACATGTCGCTGCTTCATGCATTGGGCCCAGTGCAAACCTGGCTGGGACAAGAGCTGGAGAAATGTGGCATTGATG

CCATGATTTATTCACGGTATATCCTCAGTCTTCTGCTGCATGACAGCTATGACTACGACCTGCAGGAACAG - UNI34885 - AGCAACAAAACACTG

GGTTGGGCAGA GAAGAGCTACATG ATGTGGGGTG CGACTTCCCCTCGCTGCTT GGGTTTAAACCTTCAGGAATTAAAGTCTGAAGCTG AGCTCCC

ATGTGTGCTTTCAGCATTGGCCTGT AGCTCTGGGATCGAGACTTTAGTAGAAGAGCTCTGCTGCAGACTGAAAGACCTACAGAGCGAGCAAG AAGAGA

AGATTCACAAAAAGTTAGAAGGTTCTCCTTCTCCAGAGGAAGAATTGTCCCCTACAGCAAAAGATCAAGTGGAAAT GTACTATGAAGCATTTCCACCAC

TGTCTGAGAAACCGGTTTGCCTGCAAGAGATCATGACCGTGTGGAACAAGTCCAAACCCTGTTCTTACTCTAGCTCCTCGTCATCATCCACAGTCCCACC

AGCAAGCACGGATACATCTTCTCCAAAGGACTGCAACAGTGAGAGTGAAGCCGTCAGAGAGAGAAGCAGTGTCGCCTCTGTCCCCATGCATGAGAAAGCC

CAGAGCAGGAGCAGACACGAGAAGGAGAGCAAGCTGAGCAGTAGCACCATCGAAGAAAAGCCTGCCTTTTACAAAAGGCAGATCCGACACAAACCTGAAG

GGAAGACGCGCCCTCGCTCATGGTCATCTGGCTCTAGTGAAGCAGGTTCAAGTTCAAGTGGTAACCAAGGAGAGTTAAAAGCATCCATGAAGTATGTTAA

AGTCAGACACAAGGCACGAGAAATTCGAAACAGAAAAGGGCGGAATGGGCAAAACAGGCATTCACTGAAGCATTGTGGAAAGGCAGAGAGAGGAGTCCAT

GCAGGCAGTGGTGGCAGCAGCAGCAGCAGCAGCAATGGGTCCATCAGGCAGCTGTGCAAGCGGGGTAAAAGACCAGCAAAGGAGACGGGAAGGAGCGACT

CTGGGAACACTGCAGTGAAAGACCTGTATGTGGACAGCAGAAACAACAAAGAGTACAAGGAAGAGCCCCTGTGGTACACAGAGCCCATTGCTGAGTATTT

TGTTCCTTTGAGTAGAAAAAGCAAACTAGAGACCACATACCGAAACAGGGAAGATACAAGTACTCTGACAGCAGAGGCAGTGGAAGACTTGTCTGACTCT

GTGCGTGGTCTGTGTATCAGTAACAGTAATATCCACAGAACATACCTCGCAGCAGGTACTTTCATTGATGGTCATTTTGTAGAAATGCCTGCAGTTATAA

ACGAGGATATTGACCTCGCTGGGACCTCATTATGTTCTCTACCAGAGGACAATAAGTATCTGGATGATATTCATCTATCAGAACTAACACACTTCTATGA

AGTGGATATTGATCAATCCATGTTGGATCCTGGTGCCTCAGAAACAATGCAAGGAGAAAGTCGGATTTTGAATATGATTCGACAAAAAAGCAAGGAGAAT

ACAGATTTTGAGGCAGAATGTTGCATAGTGTTAGATGGTATGGAGTTGCAAGGGGAACGTGCAATATGGACAGATTCTACCAGCTCTGTGGGTGCTGAGG

GCTTCTTCCTGCAAGACCTTGGCAATCTGGCTCAGTTTTGGGAGTGTTGTTCATCTAGTTCTGGTGATGCTGATGGAGAGAGTTTTGGAGGAGACTCTCC

AGTTAGACTCTCTCCTATCTTGGACAGCACGATGCTCAGTTCACACATACTTGCTGGCAATCAAGAGCCCTTTTCCAATATTAATGAAGGATCTGGTATA

AACTCTTGTTTTTCAGTATTTGAAGTGCAATGCAGTAATTCTGTTTTACCATTTTCTTTTGAAACACTCAACTTGGGAAGTGAACATGCAGATTCTAGTG

CTAATATGCTGGGGAAAACACAGTCTAGATTGCTCATATGGACCAAAAATAGTGCCTTTGAAGAAAACGAACACTGTTCTAATCTTTCAACAAGAACTTG

TAGTCCGTGGTCCCATTCGGAAGAAGCACGCTCAGACAATGAGACACTAAACATTCAGTTTGAAGAATCGACACAGTTTACTGCAGAAGATATTAATTAT

GTGGTTCCCAGAGTCTCGTCAGATTTTGTAGATGAAGAGCTTCTAGATTTTTTGCAGGATGAAACTTGCCAGCAAAACAGTAGAACTTTAGGAGAAATTC

CTACATTAGTTTTCAAAAAACGATCTAAGCTAGAATCTGTGTGTGGTATTCAGCTAGAACAAAAGGCAGAAAGCAAGAACTTTGAAACTACACATGCATG

TAGTGAAAGCAGTCCACATGGAGATGGCTACAGCTCAGGGGTTATTAAAGACATTTGGACAAAGATGGTAGGTAGGAGTTCTGTGGCTGCAGTAGAGACA

GAAAGAACTGGGGAGGAATTGTTTTCCACAGATGTAAATAACTACTGCTGCTGTTTGGATACTGAGGCGAAGATGGAAGCCCTTCAAGAGCCTAGTAGGG

CTGTGCAGAGATCAGAGTATCATCTCTGGGAGGGACAGAAGGAGAACATGGAGAAGAGAGCATTTGTCTCTAGTGAGCTGTCCAAGGTGGATGGTGGCGA

TTACACCACACCCTCTAAACCTTGGGATGTGGCCCAAGATAAGGAGAACACATTCATTCTTGGAGGAGTTTATGGAGAGCTCAAAACATTCAACAGTGAT

GGGGAGTGGGCAGTTGTACCACCTGGTCACACAAAAGGGAGCTTGCTACAGTGTGCAGCCTCTGATGTGGTGACAATCGCCGGTACAGATGTCTTTATGA

CCCCTGGAAACAGCTTTGCTCCTGGTCACAGGCAGCTCTGGAAGCCCTTTGTGTCATTTGAACAGAGTGACATGCCGAAGAGCGGGGAAAATGGAGTAAA

CAAGGGGTTTTCTTTTATCTTCCATGAAGACTTGCTAGGAGCCTGCAGTAACTTTCAAGTTGAAGATCCTGGCCTTGAATACTCACTCTCTTCCTTTGAC

CTAAGCAACCCCTTCTCACAAGTTCTCCACGTAGAGTGTTCATTTGAACCAGAAGGGATTGCATCTTTTAGCCCCAGTTTCAAGCCGAAATCAATCCTCT

GCTCTGATTCAGACAGTGAGGTTTTTCACCCCAGAATATGTGGTGTCGAAAGGACACAGTACAGGGCTATTCGAATCTCTCCCCGGACTCACTTTCGCCC

GATTTCTGCATCTGAACTATCCCCTGGAGGAGGAAGTGAGTCAGAATTCGAATCTGAAAAAGATGAAGCGAGTGTTCCCATTCCTTCCCAAGTTGATGTA

TTTGAAGACCCACAAGCAGATCTCAAACCTTTAGAGGAAGATGCAGAGAAAGAAGGTCACTACTATGGAAAGTTAGAGCTTGAGTCTGGGAAGTTCCTGC

CCAGGTTAAAAAAATCTGGAATGGAGAAGAGTGCTCAGACATCACTGGATTCCCAGGAGGAGGCAACTGGGATTCTGCCGAAACAAAATCAGTGTTTGGA

ATGTAACTTTAACGAATCTCTAGAAATTAATTTAGAAAGCTCAGCAGCAAACTGTAAAATAATGACACAATGTGAGGAAGAGATGAGTGAGTTTTGCAGT

TGCAAAGCAGGTTGTCAGTTCCCTGCTTGTGAAGATAATCCAGTTTCTTCAGGACAATTGGAAGAG TTTCCTGTACTGAACACTGATGTGCAAGAAGTA

ACAAGAAATCAAGAAAAGCAGAGCTGGTGGGAAAAAGCTTTGTACTCTCCCCTTTTCCCCACGTCAGAGTGTGAAG AATGTTATACAAATGCCAAGGGA

GAGAATGGTATAGAAGAATGTCCAGATGCTAAAGAGACACCCAGTCGTGAAGAGCGTCTGTTAGATTTTAATAGG GTGTCTTCTGTTTATGAAGCAAGA

TGCACAGGAGAGAGAGGTTCTGAGACAAAACCAAATGGCCTCCACAGGAAGATGTGTTCCAGTGCCAGCTCTGACACGGGCGACACAGGCTCCGAAGCCG

GCGGAGAGTGGGTGGGCCCCAGCAGAGAGGAGCTCTTCTCCCGAACACATCTCTGACCCTGCAGAGTAGTACCAGTCATTGAAAATGGCTGTGATGGGCA

ATTGCCTTGTGTGAGGCCTGTTAGTCTAAAGCAGCAACTTAGGTTTCTTCTTCAATTAACTGATCCACATCAGTGATTACCTTTCTCTTCTTGCTTATTT

TAGCGTTGAGGACGGCTGTCCTGTTGAAGATTTGTTTCCAAGCTGTTAAGTTCTTGCTCTCTGAAGTAGACTAGACTGTGCTGTCCATGAGGAATGGGTG

TGCATGTGCTTGTCCTAGTGCGTCCCGCTTCTGCATCGCAGCTGCAGGCCTCCCTCTGGCGGCTGTGTCGCCATCACCTTGTCAGCACCGTGGCGACAAC

CGCCACCGTCCAGAGACTCTAGCTCTGTTCTCTGAGCCAGGAGATCAGTCCTCCCCTGCAGTGGGTCAGGGCCTTGCTGAAGGAGGAGGGAAGCATGGTG

ACTCATCTGCAGGCTCATTCAGAAGATCTCATGGACATTGCTGTAGGAACACAAGGGTGTGCTTTAGAGACTTACAGAATACTGTGCTTTCTCTTAGGAT

TCCCCTAAAGTACCATGGAAGTTACTGTGGCTTGTGACTTTCTTGCTAGCTGAAGAAGCCAAGGATTTGAGGCCTGGGTTAGATGGGTGAGTTCTGCTAC

TGCAGTGTGTCCATAGCAGGCATAGTGGGGTTCTCTGAGCTGCCTCTCCAGTGCATAGTTGAGGACCTTACTTGTAAATTGTTATCTGGTGACGACACTG

AACTTAATTCTCCAAGTGAACTTCAAAACATTGGACATGCAGTGAGGCCACCTCTTACCCCAAAGAAATCTTTGGCTGCTGCAGCTAGCTGCTCTCGTGG

CTGTGATGTAGTGTAGCTTGTATCTCATTTTGTGTTTGAGAGAATGCTCTGGGCAAGTTCTGCTTGTGGGCTGGGGTTGGTAGAGGAACTTCCCACACAC

TTCCCTGTGTGATTGCTGTTCTGATTATCGACTCGTGGGACTTGGTGCAGCAGGCAGGCAGCAGGCCTCACACAGTTGCATCTAAGCGTGCTGATCACCT

CGGATCTCTCTCGCAGCACTGCCACAGGTGCTAGTAGGGCCAATTGTGTAAAACCTAAACATCCAAAATGATTTTTCTCTTTTAACTAACTTGTTGTTTT

TAAAAACACCTTGTCTGTGACATGAGCTCAGCATGTCCAGAACATCAGGAGTAGCGGAGAGGTCTTAAGTAGTTGAACTGGCCTCACCAGCAAGTGGGAC

GGCACTGGGCATGCGTGTGGCTTCTTAGCTGGGAGTGGAGCTGCCCCTCGGGCCTTGCTGGTAGTACTTGAGTTTGTTGCCTGTTTCTCAGGAACACAGG

AAACACCGTGGAGCCTGTGCAGGCACTGTCGTTCTGGCTTGCTGGCTGGGGCCTCTTGCCATCTTAGGGTCTGTTTCATACAGCACATCCTGACACTGAC

AGTGGTGCGTGTGCGTGTGTGCATGTAGAAGGGTTCATGTTGCTCTTATTTATTTACAGGTATCAGATACATTTTATGTATTTTTTTCTTCTGGAGCTTC

CTAAAATCTGATTAACATCTGCACTGAAATATAACCTATCATCAAAGGCAAAAAGGATTGGAAGTTGTAAATTCCTAAAATCAATGCCATCAAGATTACC

CTAGAAATTGTTGCTATGACCAAATGGATTTCATACTCAGCCATGAGCTTGGGTGACCTGGACAGCCAATGTTTATCAGGAAAAGGCTCCAGGTGGCAAA

GAAGCCTCCCTCCTCAGCTGTGGTTGTGGGGAGAGGCCCCCCACAGGGGATACGGTGGGTCATCAAAGGCAAAGGGATGACTAGATTCTGTATTTGGTTT

CTTTTGTAGTAAGTGGCTGAAGCTCAGAGGCTTTGGTACAGAATTAAAGTGTGGTTTTAGTTTCTTGAATGGATGATCACAAAAAAAGCATTAAAAAAAG

TTGGCAAACGCTGAAGCGCACTGTGGTATGAAGCGCGTTGCACATCCGTAGCACTGAAGTATCAGCTCCGTTCCTGGGCTGATTTTCCCCCCGTGGTTGT

ATTGTTCTGATTTCACGTACACCAGAGTAACTGATTTTTTTTTTGTTTTGTTTTGTTTTCTTGTGGAGTTAACACC
Translation
YPGPVSVSDMSLLHALGPVQTWLGQELEKCGIDAMIYSRYILSLLLHDSYDYDLQEQ - UNI34885 - SNKTLGWAE EKSYM MWGA ATSPRCL 

LGLNLQELKSEAE ELPCVLSALAC SSGIETLVEELCCRLKDLQSEQE EEKIHKKLEGSPSPEEELSPTAKDQVEM MYYEAFPPLSEKPVCLQEIMT

VWNKSKPCSYSSSSSSSTVPPASTDTSSPKDCNSESEAVRERSSVASVPMHEKAQSRSRHEKESKLSSSTIEEKPAFYKRQIRHKPEGKTRPRSWSSGSS

EAGSSSSGNQGELKASMKYVKVRHKAREIRNRKGRNGQNRHSLKHCGKAERGVHAGSGGSSSSSSNGSIRQLCKRGKRPAKETGRSDSGNTAVKDLYVDS

RNNKEYKEEPLWYTEPIAEYFVPLSRKSKLETTYRNREDTSTLTAEAVEDLSDSVRGLCISNSNIHRTYLAAGTFIDGHFVEMPAVINEDIDLAGTSLCS

LPEDNKYLDDIHLSELTHFYEVDIDQSMLDPGASETMQGESRILNMIRQKSKENTDFEAECCIVLDGMELQGERAIWTDSTSSVGAEGFFLQDLGNLAQF

WECCSSSSGDADGESFGGDSPVRLSPILDSTMLSSHILAGNQEPFSNINEGSGINSCFSVFEVQCSNSVLPFSFETLNLGSEHADSSANMLGKTQSRLLI

WTKNSAFEENEHCSNLSTRTCSPWSHSEEARSDNETLNIQFEESTQFTAEDINYVVPRVSSDFVDEELLDFLQDETCQQNSRTLGEIPTLVFKKRSKLES

VCGIQLEQKAESKNFETTHACSESSPHGDGYSSGVIKDIWTKMVGRSSVAAVETERTGEELFSTDVNNYCCCLDTEAKMEALQEPSRAVQRSEYHLWEGQ

KENMEKRAFVSSELSKVDGGDYTTPSKPWDVAQDKENTFILGGVYGELKTFNSDGEWAVVPPGHTKGSLLQCAASDVVTIAGTDVFMTPGNSFAPGHRQL

WKPFVSFEQSDMPKSGENGVNKGFSFIFHEDLLGACSNFQVEDPGLEYSLSSFDLSNPFSQVLHVECSFEPEGIASFSPSFKPKSILCSDSDSEVFHPRI

CGVERTQYRAIRISPRTHFRPISASELSPGGGSESEFESEKDEASVPIPSQVDVFEDPQADLKPLEEDAEKEGHYYGKLELESGKFLPRLKKSGMEKSAQ

TSLDSQEEATGILPKQNQCLECNFNESLEINLESSAANCKIMTQCEEEMSEFCSCKAGCQFPACEDNPVSSGQLEE FPVLNTDVQEVTRNQEKQSWWEK

ALYSPLFPTSECEE ECYTNAKGENGIEECPDAKETPSREERLLDFNR VSSVYEARCTGERGSETKPNGLHRKMCSSASSDTGDTGSEAGGEWVGPSRE

ELFSRTHL

For any suggestions or comments, please send an email to unitrap@crg.es