Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000029247 (Paics)
Chromosomal location
Chr 5: 77380373 - 77396534 (+)
Description
phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoribosylaminoimidazole, succinocarboxamide synthetase Gene [Source:MGI (curated);Acc:Paics-001]
RefSeq_dna
NM_025939 
RefSeq_peptide
NP_080215.1 
UniGene
Mm.390298 Mm.425529 Mm.458177 Mm.474321 Mm.475564 
MGI
MGI:1914304 
Uniprot/SWISSPROT
Q9DCL9 
Uniprot/SPTREMBL
Q9CQ38 
Human Ortholog
ENSG00000128050 (PAICS)
Omim not available
UniTrap UNI5422
Vector Insertion
Chr 5: 77380829 - 77380861
Public Clones CSJ163 (baygenomics) CSD075 (baygenomics) CSD085 (baygenomics) (ggtc)
M121A08 (ggtc) W266C03 (ggtc) P023B10 (ggtc) W071E06 (ggtc) Q012D03 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15132
Vector Insertion
Chr 5: 77380861 - 77383979
Public Clones (sanger) E087A09 (ggtc) D143F09 (ggtc) E001E06 (ggtc) D030C04 (ggtc)
D185D03 (ggtc) PST9021-NR (escells) PST1491-1 (escells) PST6562-NR (escells)
PST1520-1 (escells) PST945-2 (escells) PST516-1 (escells) PSTVU01.HL7 (vanderbilt)
IST14780H4 (tigm) IST10609D6 (tigm) IST10017E7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14346
Vector Insertion
Chr 5: 77383990 - 77385567
Public Clones (sanger) E121G12 (ggtc) E326D12 (ggtc) FHCRC-GT-S18-12F1 (fhcrc) PST10569-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17853
Vector Insertion
Chr 5: 77385570 - 77385769
Public Clones not available
Private Clones OST434865 (lexicon) OST430909 (lexicon) OST405929 (lexicon) OST217391 (lexicon)
OST193759 (lexicon) OST172751 (lexicon) OST130902 (lexicon) OST67095 (lexicon)
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI667
Vector Insertion
Chr 5: 77385769 - 77388339
Public Clones DC0414 (sanger) (sanger) D051D10 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 17% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37762
Vector Insertion
Chr 5: 77388519 - 77390134
Public Clones (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 31% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27926
Vector Insertion
Chr 5: 77393648 - 77395271
Public Clones not available
Private Clones OST43743 (lexicon)
Severity of mutation (?) Insertion after 75% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000056317
Sequence
GCCAGAGCAG - UNI14346 - CAGTAGTGAACATCGGGAAGAAGCTCTACGAGGGTAAAACAAAAGAAGTCTATGAGTTGTTAGACACCCCAGGCAG

AGTCCTCCTGCAGTCCAAGGACCAGATCACAGCAGGGAATGCAGCTAGGAAGAACCACCTGGAAGGCAAAGCCGCCATCTCCAACAAGATCACCAGCTGC

ATATTTCAGTTGTTACAGGAAGCTG - UNI667 - - UNI17853 - GTATAAAAACTGCTTTCACCAAGAAATGCGGGGAGACTGCTTTCATTGCA

CCCCAGTGTGAAATGATCCCCATTGAGTGGGTGTGCCGAAGAATAGCAACTGGGTCTTTCCTCAAAAGGAACCCTGGGGTACAGGAGGGGTACAAGTTCT

ATCCACCCAAAGTGGAGATGTTCTTCAAG GACGATGCCAATAATGATCCACAGTGGTCTGAGGAGCAACTCATTGCTGCAAAATTCTGTTTTGCTGGCC

TTGTTATAGGGCAGACTGAAGTGGACATCATGAGTCATGCCACACAAGCTATTTTTGAAATTCTGGAGAAATCCTGGCTGCCCCAGGACTGTACGCTGGT

TGATATGAAG ATTGAATTTGGTGTTGATGTAACCACCAAAGAGATTGTTCTTGCTGATGTCATTGATAATGATTCCTGGAGACTATGGCCATCGGGAGA

TCGGAGCCAGCAGAAGGACAAACAG TCTTACCGTGATCTCAAAGAAGTAACTCCAGAAGGACTCCAGATGGTAAAGAAAAACTTTGAGTGGGTTGCAGA

CCGAGTGGAG TTGCTTCTCAAGTCAGACAGTCAGTGCAGGGTGGTAGTGCTGATGGGCTCCACCTCTGACCTTGGTCACTGTGAGAAAATTAAGAAGGC

TTGTGGAAATTTTGGGATTCCATGTGAACTTAGAGTAACATCTGCGCATAAAGGACCAGATGAGACTTTGAGGATTAAAGCAGAATATGAAG - UNI27

926 - GGGATGGCATACCTACTGTATTTGTCTCTGTGGCGGGCAGAAGCAATGGTCTAGGCCCAGTGCTGTCTGGCAATACTGCATATCCGGTTATCAG

CTGTCCCCCGATCACACCAGACTGGGGCGCTCAGGATGTGTGGTCATCTCTTCGACTGCCCAGTG GTATTGGCTGTTCAACTATACTTTCTCCAGAAGG

ATCAGCTCAGTTTGCTGCTCAGATATTTGGGTTAAACAATCATTTGGTGTGGGCCAAACTTCGAGCGAGCATATTAAACACGTGGATATCCTTAAAGCAG

GCTGATAAGAAGGTCAGACAATGCAATTTGTAAAGAAGCAATTTAATTTTTAGGAGAAAAGTTACGTAGTCCTAGTTTGGATTTAAAGAAAAAAGTCAAG

CAAAATGATTTCACATAAGAGAAAACAATTTAGTTACTAATGAACAAATGTTACTCAGTGTTTATGAGTTGGCACATTGTCAGTGGATATTACTAATATT

TCTAGCTCTACAAAGTGATATGTCCCTGTAACCTTAGCACTCCAGAGGCTGAGGCAGCAGCAGGACCTCTTAAGTTCAGGGCCACCCTGAGCTGTGTATT

GAGACTCAACTTGCCGTGGAGGGAATCTTTCTAGCTAGTAAAATTGGCATGACACTACTAAATTTATTCTCACGCTCTGTATAGTCACTGTTGGGTAAAT

ATGTAACTATGGAACTGGAACAATGTGTCTGCTGTCTGAACCACTATGAAGAACCAGTGTGGCTCTCTTGCAGACGACCTGAATTTGCTTCCCAGCATCT

CTGTAGACTGTTTCACAATAAATACCCTTTAAATCAGGGGATCTGACCCCATGGCTTCCTCATGCACCTGCTTTCAAATACTATTACATTCCCCCACCCA

ACACACACAATTTTAAAAAGTAAACTTTTTAAAAAGAGTAATAGCATTTTTTGTTGTTGTTAATCAGTAGATAATGCTTGAACTGAGTTGATACATTGAA

AATTAAAATACTTGTGTATAAC
Translation
ARAA - UNI14346 - AVVNIGKKLYEGKTKEVYELLDTPGRVLLQSKDQITAGNAARKNHLEGKAAISNKITSCIFQLLQEAG - UNI667 - - 

UNI17853 - GIKTAFTKKCGETAFIAPQCEMIPIEWVCRRIATGSFLKRNPGVQEGYKFYPPKVEMFFK DDANNDPQWSEEQLIAAKFCFAGLVIGQ

TEVDIMSHATQAIFEILEKSWLPQDCTLVDMK IEFGVDVTTKEIVLADVIDNDSWRLWPSGDRSQQKDKQ SYRDLKEVTPEGLQMVKKNFEWVADRVE

 LLLKSDSQCRVVVLMGSTSDLGHCEKIKKACGNFGIPCELRVTSAHKGPDETLRIKAEYEG - UNI27926 - GDGIPTVFVSVAGRSNGLGPVLSG

NTAYPVISCPPITPDWGAQDVWSSLRLPSG GIGCSTILSPEGSAQFAAQIFGLNNHLVWAKLRASILNTWISLKQADKKVRQCNL
Transcript ENSMUST00000117536
Sequence
GTGGGAGGCTCCGTTATTTTCCCGCGCCCAAGGA AACACTGCCCTTTTTTCCCGCGCGGTCTGCTCCTCTAGTTCACCTCGGATAATGGCGACAGCCGT

AG - UNI5422 - - UNI14346 - - UNI15132 - - UNI17853 - TAGTGAACATCGGGAAGAAGCTCTACGAGGGTAAAACAAAAGAAGT

CTATGAGTTGTTAGACACCCCAGGCAGAGTCCTCCTGCAGTCCAAGGACCAGATCACAGCAGGGAATGCAGCTAGGAAGAACCACCTGGAAGGCAAAGCC

GCCATCTCCAACAAGATCACCAGCTGCATATTTCAGTTGTTACAGGAAGCTG - UNI667 - - UNI17853 - GTATAAAAACTGCTTTCACCAAG

AAATGCGGGGAGACTGCTTTCATTGCACCCCAGTGTGAAATGATCCCCATTGAGTGGGTGTGCCGAAGAATAGCAACTGGGTCTTTCCTCAAAAGGAACC

CTGGGGTACAGGAGGGGTACAAGTTCTATCCACCCAAAGTGGAGATGTTCTTCAAG GACGATGCCAATAATGATCCACAGTGGTCTGAGGAGCAACTCA

TTGCTGCAAAATTCTGTTTTGCTGGCCTTGTTATAGGGCAGACTGAAGTGGACATCATGAGTCATGCCACACAAGCTATTTTTGAAATTCTGGAGAAATC

CTGGCTGCCCCAGGACTGTACGCTGGTTGATATGAAG ATTGAATTTGGTGTTGATGTAACCACCAAAGAGATTGTTCTTGCTGATGTCATTGATAATGA

TTCCTGGAGACTATGGCCATCGGGAGATCGGAGCCAGCAGAAGGACAAACAG TCTTACCGTGATCTCAAAGAAGTAACTCCAGAAGGACTCCAGATGGT

AAAGAAAAACTTTGAGTGGGTTGCAGACCGAGTGGAG TTGCTTCTCAAGTCAGACAGTCAGTGCAGGGTGGTAGTGCTGATGGGCTCCACCTCTGACCT

TGGTCACTGTGAGAAAATTAAGAAGGCTTGTGGAAATTTTGGGATTCCATGTGAACTTAGAGTAACATCTGCGCATAAAGGACCAGATGAGACTTTGAGG

ATTAAAGCAGAATATGAAG - UNI27926 - GGGATGGCATACCTACTGTATTTGTCTCTGTGGCGGGCAGAAGCAATGGTCTAGGCCCAGTGCTGTC

TGGCAATACTGCATATCCGGTTATCAGCTGTCCCCCGATCACACCAGACTGGGGCGCTCAGGATGTGTGGTCATCTCTTCGACTGCCCAGTG GTATTGG

CTGTTCAACTATACTTTCTCCAGAAGGATCAGCTCAGTTTGCTGCTCAGATATTTGGGTTAAACAATCATTTGGTGTGGGCCAAACTTCGAGCGAGCATA

TTAAACACGTGGATATCCTTAAAGCAGGCTGATAAGAAGGTCAGACAATGCAATTTGTAAAGAAGCAATTTAATTTTTAGGAGAAAAGTTACGTAGTCCT

AGTTTGGATTTAAAGAAAAAAGTCAAGCAAAATGATTTCACATAAGAGAAAACAATTTAGTTACTAATGAACAAATGTTACTCAGTGTTTATGAGTTGGC

ACATTGTCAGTGGATATTACTAATATTTCTAGCTCTACAAAGTGATATGTCCCTGTAACCTTAGCACTCCAGAGGCTGAGGCAGCAGCAGGACCTCTTAA

GTTCAGGGCCACCCTGAGCTGTGTATTGAGACTCAACTTGCCGTGGAGGGAATCTTTCTAGCTAGTAAAATTGGCATGACACTACTAAATTTATTCTCAC

GCTCTGTATAGTCACTGTTGGGTAAATATGTAACTATGGAACTGGAACAATGTGTCTGCTGTCTGAACCACTATGAAGAACCAGTGTGGCTCTCTTGCAG

ACGACCTGAATTTGCTTCCCAGCATCTCTGTAGACTGTTTCACAATAAATACCCTTTAA
Translation
 MATAVV - UNI5422 - - UNI14346 - - UNI15132 - - UNI17853 - VVNIGKKLYEGKTKEVYELLDTPGRVLLQSKDQITAGNAAR

KNHLEGKAAISNKITSCIFQLLQEAG - UNI667 - - UNI17853 - GIKTAFTKKCGETAFIAPQCEMIPIEWVCRRIATGSFLKRNPGVQEGYK

FYPPKVEMFFK DDANNDPQWSEEQLIAAKFCFAGLVIGQTEVDIMSHATQAIFEILEKSWLPQDCTLVDMK IEFGVDVTTKEIVLADVIDNDSWRLWP

SGDRSQQKDKQ SYRDLKEVTPEGLQMVKKNFEWVADRVE LLLKSDSQCRVVVLMGSTSDLGHCEKIKKACGNFGIPCELRVTSAHKGPDETLRIKAEY

EG - UNI27926 - GDGIPTVFVSVAGRSNGLGPVLSGNTAYPVISCPPITPDWGAQDVWSSLRLPSG GIGCSTILSPEGSAQFAAQIFGLNNHLVW

AKLRASILNTWISLKQADKKVRQCNL
Transcript ENSMUST00000120912
Sequence
GATCGCTACTTTCTCTGCACGTGGGAGGCTCCGTTATTTTCCCGCGCCCAAGGAGTAGGTGATGAGAGTGGCGCAGCTGATCGCGTGGGTCCCTCAGAAA

ACCTGAGCCGTTCGTGCCCCCTGGTCTCACGCCGTCCCCCGGCCGTCAGGACTTGGTCCGCTCCAACCCAGAAACCTCTCCGGCCAGCGGGGGCCTTGCA

GCATGCGCGCCACTTTTTGGCTGCCTGCGGGGAGGGGCCGCCCGGAAGCGGGGTCGCGTCAGCGCGCCTGCGCGGCGGGAAGCCTGGGGACACGACTCCA

GCCCCAAGCACAGCCAGCCCG AACACTGCCCTTTTTTCCCGCGCGGTCTGCTCCTCTAGTTCACCTCGGATAATGGCGACAGCCGTAG - UNI5422 

- - UNI14346 - - UNI15132 - - UNI17853 - TAGTGAACATCGGGAAGAAGCTCTACGAGGGTAAAACAAAAGAAGTCTATGAGTTGTTA

GACACCCCAGGCAGAGTCCTCCTGCAGTCCAAGGACCAGATCACAGCAGGGAATGCAGCTAGGAAGAACCACCTGGAAGGCAAAGCCGCCATCTCCAACA

AGATCACCAGCTGCATATTTCAGTTGTTACAGGAAGCTG - UNI667 - - UNI17853 - GTATAAAAACTGCTTTCACCAAGAAATGCGGGGAGA

CTGCTTTCATTGCACCCCAGTGTGAAATGATCCCCATTGAGTGGGTGTGCCGAAGAATAGCAACTGGGTCTTTCCTCAAAAGGAACCCTGGGGTACAGGA

GGGGTACAAGTTCTATCCACCCAAAGTGGAGATGTTCTTCAAG GACGATGCCAATAATGATCCACAGTGGTCTGAGGAGCAACTCATTGCTGCAAAATT

CTGTTTTGCTGGCCTTGTTATAGGGCAGACTGAAGTGGACATCATGAGTCATGCCACACAAGCTATTTTTGAAATTCTGGAGAAATCCTGGCTGCCCCAG

GACTGTACGCTGGTTGATATGAAG ATTGAATTTGGTGTTGATGTAACCACCAAAGAGATTGTTCTTGCTGATGTCATTGATAATGATTCCTGGAGACTA

TGGCCATCGGGAGATCGGAGCCAGCAGAAGGACAAACAG TCTTACCGTGATCTCAAAGAAGTAACTCCAGAAGGACTCCAGATGGTAAAGAAAAACTTT

GAGTGGGTTGCAGACCGAGTGGAG TTGCTTCTCAAGTCAGACAGTCAGTGCAGGGTGGTAGTGCTGATGGGCTCCACCTCTGACCTTGGTCACTGTGAG

AAAATTAAGAAGGCTTGTGGAAATTTTGGGATTCCATGTGAACTTAGAGTAACATCTGCGCATAAAGGACCAGATGAGACTTTGAGGATTAAAGCAGAAT

ATGAAG - UNI27926 - GGGATGGCATACCTACTGTATTTGTCTCTGTGGCGGGCAGAAGCAATGGTCTAGGCCCAGTGCTGTCTGGCAATACTGCA

TATCCGGTTATCAGCTGTCCCCCGATCACACCAGACTGGGGCGCTCAGGATGTGTGGTCATCTCTTCGACTGCCCAGTG GTATTGGCTGTTCAACTATA

CTTTCTCCAGAAGGATCAGCTCAGTTTGCTGCTCAGATATTTGGGTTAAACAATCATTTGGTGTGGGCCAAACTTCGAGCGAGCATATTAAACACGTGGA

TATCCTTAAAGCAGGCTGATAAGAAGGTCAGACAATGCAATTTGTAAAGAAGCAATTTAATTTTTAGGAGAAAAGTTACGTAGTCCTAGTTTGGATTTAA

AGAAAAAAGTCAAGCAAAATGATTTCACATAAGAGAAAACAATTTAGTTACTAATGAACAAATGTTACTCAGTGTTTATGAGTTGGCACATTGTCAGTGG

ATATTACTAATATTTCTAGCTCTACAAAGTGATATGTCCCTGTAACCTTAGCACTCCAGAGGCTGAGGCAGCAGCAGGACCTCTTAAGTTCAGGGCCACC

CTGAGCTGTGTATTGAGACTCAACTTGCCGTGGAGGGAATCTTTCTAGCTAGTAAAATTGGCATGACACTACTAAATTTATTCTCACGCTCTGTATAGTC

ACTGTTGGGTAAATATGTAACTATGGAACTGGAACAATGTGTCTGCTGTCTGAACCACTATGAAGAACCAGTGTGGCTCTCTTGCAGACGACCTGAATTT

GCTTCCCAGCATCTCTGTAGACTGTTTCACAATAAATACCCTTTAAATCAGGGGATCTGACCCCATGGCTTCCTCATGCACCTGCTTTCAAATACTATTA

CATTCCCCCACCCAACACACACAATTTTAAAAAGTAAACTTTTTAAAAAGAGTAATAGCATTTTTTGTTGTTGTTAATCAGTAGATAATGCTTGAACTGA

GTTGATACATTGAAAATTAAAATACTTGTGTATAACAATATA
Translation
 MATAVV - UNI5422 - - UNI14346 - - UNI15132 - - UNI17853 - VVNIGKKLYEGKTKEVYELLDTPGRVLLQSKDQITAGNAAR

KNHLEGKAAISNKITSCIFQLLQEAG - UNI667 - - UNI17853 - GIKTAFTKKCGETAFIAPQCEMIPIEWVCRRIATGSFLKRNPGVQEGYK

FYPPKVEMFFK DDANNDPQWSEEQLIAAKFCFAGLVIGQTEVDIMSHATQAIFEILEKSWLPQDCTLVDMK IEFGVDVTTKEIVLADVIDNDSWRLWP

SGDRSQQKDKQ SYRDLKEVTPEGLQMVKKNFEWVADRVE LLLKSDSQCRVVVLMGSTSDLGHCEKIKKACGNFGIPCELRVTSAHKGPDETLRIKAEY

EG - UNI27926 - GDGIPTVFVSVAGRSNGLGPVLSGNTAYPVISCPPITPDWGAQDVWSSLRLPSG GIGCSTILSPEGSAQFAAQIFGLNNHLVW

AKLRASILNTWISLKQADKKVRQCNL
Transcript ENSMUST00000031160
Sequence
AGTTCACCTCGGATAATGGCGACAGCCGTAG - UNI5422 - - UNI14346 - - UNI15132 - - UNI17853 - TAGTGAACATCGGGAAG

AAGCTCTACGAGGGTAAAACAAAAGAAGTCTATGAGTTGTTAGACACCCCAGGCAGAGTCCTCCTGCAGTCCAAGGACCAGATCACAGCAGGGAATGCAG

CTAGGAAGAACCACCTGGAAGGCAAAGCCGCCATCTCCAACAAGATCACCAGCTGCATATTTCAGTTGTTACAGGAAGCTG - UNI667 - - UNI17

853 - GTATAAAAACTGCTTTCACCAAGAAATGCGGGGAGACTGCTTTCATTGCACCCCAGTGTGAAATGATCCCCATTGAGTGGGTGTGCCGAAGAAT

AGCAACTGGGTCTTTCCTCAAAAGGAACCCTGGGGTACAGGAGGGGTACAAGTTCTATCCACCCAAAGTGGAGATGTTCTTCAAG GACGATGCCAATAA

TGATCCACAGTGGTCTGAGGAGCAACTCATTGCTGCAAAATTCTGTTTTGCTGGCCTTGTTATAGGGCAGACTGAAGTGGACATCATGAGTCATGCCACA

CAAGCTATTTTTGAAATTCTGGAGAAATCCTGGCTGCCCCAGGACTGTACGCTGGTTGATATGAAG ATTGAATTTGGTGTTGATGTAACCACCAAAGAG

ATTGTTCTTGCTGATGTCATTGATAATGATTCCTGGAGACTATGGCCATCGGGAGATCGGAGCCAGCAGAAGGACAAACAG TCTTACCGTGATCTCAAA

GAAGTAACTCCAGAAGGACTCCAGATGGTAAAGAAAAACTTTGAGTGGGTTGCAGACCGAGTGGAG TTGCTTCTCAAGTCAGACAGTCAGTGCAGGGTG

GTAGTGCTGATGGGCTCCACCTCTGACCTTGGTCACTGTGAGAAAATTAAGAAGGCTTGTGGAAATTTTGGGATTCCATGTGAACTTAGAGTAACATCTG

CGCATAAAGGACCAGATGAGACTTTGAGGATTAAAGCAGAATATGAAG - UNI27926 - GGGATGGCATACCTACTGTATTTGTCTCTGTGGCGGGC

AGAAGCAATGGTCTAGGCCCAGTGCTGTCTGGCAATACTGCATATCCGGTTATCAGCTGTCCCCCGATCACACCAGACTGGGGCGCTCAGGATGTGTGGT

CATCTCTTCGACTGCCCAGTG GTATTGGCTGTTCAACTATACTTTCTCCAGAAGGATCAGCTCAGTTTGCTGCTCAGATATTTGGGTTAAACAATCATT

TGGTGTGGGCCAAACTTCGAGCGAGCATATTAAACACGTGGATATCCTTAAAGCAGGCTGATAAGAAGGTCAGACAATGCAATTTGTAAAGAAGCAATTT

AATTTTTAGGAGAAAAGTTACGTAGTCCTAGTTTGGATTTAAAGAAAAAAGTCAAGCAAAATGATTTCACATAAGAGAAAACAATTTAGTTACTAATGAA

CAAATGTTACTCAGTGTTTATGAGTTGGCACATTGTCAGTGGATATTACTAATATTTCTAGCTCTACAAAGTGATATGTCCCTGTAACCTTAGCACTCCA

GAGGCTGAGGCAGCAGCAGGACCTCTTAAGTTCAGGGCCACCCTGAGCTGTGTATTGAGACTCAACTTGCCGTGGAGGGAATCTTTCTAGCTAGTAAAAT

TGGCATGACACTACTAAATTTATTCTCACGCTCTGTATAGTCACTGTTGGGTAAATATGTAACTATGGAACTGGAACAATGTGTCTGCTGTCTGAACCAC

TATGAAGAACCAGTGTGGCTCTCTTGCAGACGACCTGAATTTGCTTCCCAGCATCTCTGTAGACTGTTTCACAATAAATACCCTTTAAATCAGGGGATCT

GACCCCATGGCTTCCTCATGCACCTGCTTTCAAATACTATTACATTCCCCCACCCAACACACACAATTTTAAAAAGTAAACTTTTTAAAAAGAGTAATAG

CATTTTTTGTTGTTGTTAATCAGTAGATAATGCTTGAACTGAGTTGATACATTGAAAATTAAAATACTTGTGTATAAC
Translation
MATAVV - UNI5422 - - UNI14346 - - UNI15132 - - UNI17853 - VVNIGKKLYEGKTKEVYELLDTPGRVLLQSKDQITAGNAARK

NHLEGKAAISNKITSCIFQLLQEAG - UNI667 - - UNI17853 - GIKTAFTKKCGETAFIAPQCEMIPIEWVCRRIATGSFLKRNPGVQEGYKF

YPPKVEMFFK DDANNDPQWSEEQLIAAKFCFAGLVIGQTEVDIMSHATQAIFEILEKSWLPQDCTLVDMK IEFGVDVTTKEIVLADVIDNDSWRLWPS

GDRSQQKDKQ SYRDLKEVTPEGLQMVKKNFEWVADRVE LLLKSDSQCRVVVLMGSTSDLGHCEKIKKACGNFGIPCELRVTSAHKGPDETLRIKAEYE

G - UNI27926 - GDGIPTVFVSVAGRSNGLGPVLSGNTAYPVISCPPITPDWGAQDVWSSLRLPSG GIGCSTILSPEGSAQFAAQIFGLNNHLVWA

KLRASILNTWISLKQADKKVRQCNL

For any suggestions or comments, please send an email to unitrap@crg.es