Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000029270 (2900024C23Rik)
Chromosomal location
Chr 5: 108337357 - 108416052 (-)
Description
RIKEN cDNA 2900024C23 gene Gene [Source:MGI Symbol;Acc:MGI:1914516]
RefSeq_dna
NM_026062 
RefSeq_peptide
NP_080338.1 
UniGene
Mm.475894 
MGI
MGI:1914516 
Uniprot/SWISSPROT
Q9D6I7 
Human Ortholog
ENSG00000154511 (FAM69A)
Omim not available
UniTrap UNI15792
Vector Insertion
Chr 5: 108353739 - 108415967
Public Clones IST14271A7 (tigm) IST13501A12 (tigm) IST14159A6 (tigm) IST14701E3 (tigm)
Private Clones OST473165 (lexicon) OST448607 (lexicon) OST439346 (lexicon) OST434065 (lexicon)
OST433495 (lexicon) OST401965 (lexicon) OST311922 (lexicon) OST311580 (lexicon)
OST301994 (lexicon) OST301564 (lexicon) OST276962 (lexicon) OST248688 (lexicon)
OST144403 (lexicon) OST123902 (lexicon) OST110981 (lexicon) OST90943 (lexicon)
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19580
Vector Insertion
Chr 5: 108343473 - 108353603
Public Clones not available
Private Clones OST388569 (lexicon) OST288379 (lexicon) OST231437 (lexicon)
Severity of mutation (?) Insertion after 15% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16406
Vector Insertion
Chr 5: 108340808 - 108343364
Public Clones not available
Private Clones OST461642 (lexicon) OST440947 (lexicon)
Severity of mutation (?) Insertion after 23% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22748
Vector Insertion
Chr 5: 108339236 - 108340630
Public Clones not available
Private Clones OST285695 (lexicon)
Severity of mutation (?) Insertion after 37% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000031198
Sequence
GACTGCGGCGCGGCGGGGCGATGTGAGTGCCATGGCGAGGAGTCTCTGCGCGGGGGCCTGGCTGAGGAAACCCCATTACCTCCAG - UNI15792 - G

CTCGGTTGTCCTACATGCGGGTGAAGTATCTTTTCTTTTCCTGGCTGGTGGTTTTTGTCGGAAGCTGGATCATATATGTGCAGTATTCAACCTATACAGA

GCTATGCAGAGGGAAGGACTGTAAGAAAATCATA - UNI19580 - TGTGACAAATACAAGACCGGAGTTATTGACGGACCTGCATGCAACAGCCTCT

GTGTCACAGAAACACTGTACTTTGGAAAATGTCTGTCCAACAAGCCCAGCAACCAG - UNI16406 - ATGTATTTAGGAGTTTGGGATAATCTACCA

GGTGTTGTGAAGTGTCAAATGGAACAAGCTCTTCATCTTGATTTTGGAACTGAATTGGAGCCAAGAAAAGAAATAGTGCTATTTGATAAACCAACCAGGG

GAACTACTGTACAGAAATTCAAAGAAATGGTGTACAGTCTCTTTAAG - UNI22748 - GCAAAATTAGGTGACCAAGGGAACCTCTCTGAATTGGTT

AATCTCATCTTGACAGTGGCTGACGGAGACAGAGATGGCCAGGTCTCCCTAGGAGAAGCCAAGTCAGCATGGGCACTTCTTCAGTTGAATGAGTTTCTCC

TGATGGTGATACTTCAAGATAAAGAACACACCCCCAAACTAATGGGATTCTGTGGTGATCTCTACGTGATGGAAAGTGTTGAATATACCTCTCTGTATGG

AATAAGTCTACCATGGGTTATGGAACTTTTTATTCCATCTGGGTTCAGAAGGAGCATGGATCAATTGTTCACACCATCATGGCCCAGAAAGGCAAAGATA

GCCATAGGACTTCTAGAATTTGTAGAGGATGTTTTCCATGGCCCCTATGGAAACTTTCTCATGTGTGACACCAGTGCCAAAAACCTAGGATATAATGAGA

AGTATGACTTGAAAATGGTGGATATGAGAAAAATTGTGCCAGAGACAAACCTAAAGGAACTTATTAAGGACCGCCACTGTGAGTCTGACCTGGACTGTGT

CTACGGTACAGACTGTAGAACTAGCTGTGACCTGAGTACAATGAAGTGCACTTCTGAAGTAATACAACCAAACTTGGCAAAAGCCTGTCAGTTACTCAAA

GACTACCTACTGCACGGTGCTCCCAGTGAAATTCGGGAAGAATTAGAAAAACAGCTTTATTCTTGTATTGCTCTCAAAGTCACAGCAAATCAAATGGAAA

TGGAACATTCTTTGATATTAAATAACCTAAAAACGTTATTGTGGAAGAAAATTTCCTACACAAATGACTCTTAGTTCATTTGGACTACTGCCATCATTGA

GAATCTACTTATGATTTTGAGCATTTAAAGAGTGGCTTCTGCCCCCCAGGCCTGTGGAGTCATCATCTTAAATGCATGTTGTAACAATAATGGCAGGTGT

AGGGCCAAGATGTCCAAAACTCATCCCTGCCCTTTTACAAGTCCACAAGTATATTCACTGTTAACTATCTTGACTTTAAAAAAAAAAAATTAATGCTGTG

AAAATCCTCATTCCATAAACAGTGAGTGTTCTGTAGATGTTAGCCAGTCCCATTGCCGGACATTGTTTGCATTGAAGCTGCTGTTTAAACAAGGAAATTT

ATACATGAATTTACTAATGTTTTAGCATGGTAAAACTTTGCACATTAACACAAATTAAGAATGCCACACAGGTAAATTCAAATGACTCATTTATTAAAAA

GTTCAGTTAATATAGCATGATTTACTGTGTACTTACACACTTTAACTTCAGATGGAGTCAACTGTGGAATGGCTTTTAGCTTCGGCATATATTCTACATG

CTGAAGTTAGCATGCAGTTATCACTGTGACTGAAACTCATTATCTTTAAGCTCTGATAGGTTCATCTTAGTATCGTCACATTATCTTTGCTGGGGATGTA

GGTAAGCAGTTAACTGTTTACCTGACCTGTGTAGCCCCAGTACCACAGAGCCTGACACTGTGAGGCAAGGCAAAGATGATAAAGATGCACAGCACCTCAG

CTAAGACTGGATTAAGTCAGGAAGACAATTCTTGCTCCTTCTGGGATGAAGGGCTATTTACTAAGAGGCATAAGCACCTAATGCTTTCCCAAGTGAACCT

GATATTCAAGGTTTAATATTTGACCCTTTCAAGTTATTTTCCTATGTACATTCATGTCTGGCATGTACCATAAAAATGAAACGTCCTAGACACCCCCTTC

TCCTCAAACCAAATTTCACCGTTGTTCTCAAATCTTTAAAGCCATGGATTAGCACCAGTTGTTCACTTCCAAGATTGACCTTGAGATACTTTCTTCCCAC

TAATCAATTTGTTTGTAATAAATGTCCTGATGATCATGCT
Translation
MARSLCAGAWLRKPHYLQ - UNI15792 - ARLSYMRVKYLFFSWLVVFVGSWIIYVQYSTYTELCRGKDCKKII - UNI19580 - CDKYKTGVI

DGPACNSLCVTETLYFGKCLSNKPSNQ - UNI16406 - MYLGVWDNLPGVVKCQMEQALHLDFGTELEPRKEIVLFDKPTRGTTVQKFKEMVYSLFK

 - UNI22748 - AKLGDQGNLSELVNLILTVADGDRDGQVSLGEAKSAWALLQLNEFLLMVILQDKEHTPKLMGFCGDLYVMESVEYTSLYGISLPWV

MELFIPSGFRRSMDQLFTPSWPRKAKIAIGLLEFVEDVFHGPYGNFLMCDTSAKNLGYNEKYDLKMVDMRKIVPETNLKELIKDRHCESDLDCVYGTDCR

TSCDLSTMKCTSEVIQPNLAKACQLLKDYLLHGAPSEIREELEKQLYSCIALKVTANQMEMEHSLILNNLKTLLWKKISYTNDS

For any suggestions or comments, please send an email to unitrap@crg.es