Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000029320 (1700016H13Rik)
Chromosomal location
Chr 5: 104077058 - 104085029 (-)
Description
RIKEN cDNA 1700016H13 gene Gene [Source:MGI Symbol;Acc:MGI:1921468]
UniGene
Mm.159141 
MGI
MGI:1921468 
Uniprot/SWISSPROT
Q9DAA3 
Human Ortholog
ENSG00000163633 (C4orf36)
Omim not available
UniTrap UNI26090
Vector Insertion
Chr 5: 104083940 - 104084076
Public Clones not available
Private Clones OST138691 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000120688
Sequence
GGCGCACCAGCAAGCAGGAGCACGAGCAAGCAAGCCGGCGCAAGTCGGCGGCTGGGCCGCTGCGAGTGCGCGGCCATGTGCACCTAGCGCGAGCTGCCCT

GGGTCGGGGGCGCGGCCAGGGTGCGGCTGACCTGTGGG - UNI26090 - GCAAAGTGCAAACAGCGGTGCAGATGTTACATCAGGCTCCTATGTAAG

GAAACCACTGTGATCATTTGTCATGGCGTATGGCTTGCCAAGAAGGAACACAGTACAAACCATTTTGAAGGGCAGCTGTTATAAAGT - UNI26090 -

 ACAGGAGCCATGGGACCTTGCGGAACTCACAAAGACCTGGTACACAAACTTGACGAACATCAGGCTGCCATTCTTGGGAGAAATCGTATTTGGTAGTCC

TATGAATCTCTTGGCAAGCCAAACCAAACAGGAATGCCAGTTTCCTTCAATGCAAT CCATGGCACTTGAAAAGGAGTATGAAGCAAAGCGCCTAACAAA

ACTGAAGTGTCAGGAGAATGTGTGTAAGGAAATCCAGGCTTCACTGAGAGAAAAGAAAGTCGGCCTGAGAAGACCACTTCAGCCCAAGTGACCCAACATA

TTGTTGAAGCTGAACCTGTTTCCGGCATCCATGGAGATGAA
Translation
 - UNI26090 - MAYGLPRRNTVQTILKGSCYKV - UNI26090 - VQEPWDLAELTKTWYTNLTNIRLPFLGEIVFGSPMNLLASQTKQECQFPS

MQS SMALEKEYEAKRLTKLKCQENVCKEIQASLREKKVGLRRPLQPK
Transcript ENSMUST00000120108
Sequence
GATGAGCCCCGCACCTGAGCAATCAGGCGCACCAGCAAGCAGGAGCACGAGCAAGCAAGCCGGCGCAAGTCGGCGGCTGGGCCGCTGCGAGTGCGCGGCC

ATGTGCACCTAGCGCGAGCTGCCCTGGGTCGGGGGCGCGGCCAGG - UNI26090 - GCAAAGTGCAAACAGCGGTGCAGATGTTACATCAGGCTCCT

ATGTAAGGAAACCACTGTGATCATTTGTCATGGCGTATGGCTTGCCAAGAAGGAACACAGTACAAACCATTTTGAAGGGCAGCTGTTATAAAGT - UNI

26090 - ACAGGAGCCATGGGACCTTGCGGAACTCACAAAGACCTGGTACACAAACTTGACGAACATCAGGCTGCCATTCTTGGGAGAAATCGTATTTG

GTAGTCCTATGAATCTCTTGGCAAGCCAAACCAAACAGGAATGCCAGTTTCCTTCAATGCAAT CCATGGCACTTGAAAAGGAGTATGAAGCAAAGCGCC

TAACAAAACTGAAGTGTCAGGAGAATGTGTGTAAGGAAATCCAGGCTTCACTGAGAGAAAAGAAAGTCGGCCTGAGAAGACCACTTCAGCCCAAGTGACC

CAACATATTGTTGAAGCTGAACCTGTTTCCGGCATCCATGGAGATGAAGCTCTTGGACTCTTTCATAGTGTCAAGTCGACACAGCAGTGTGCCTATGGCG

ATGAGGCCAGTGTTTCCAGACACGGCTCGGTGGATGCTATGACAGAGCCCCCAGGTTCCTGCTACACTCTTGTTCTTTGTGTCCCATACAGCAGCCCTCC

CTGTAAGTAGATGAAAACACATCTGG
Translation
 - UNI26090 - MAYGLPRRNTVQTILKGSCYKV - UNI26090 - VQEPWDLAELTKTWYTNLTNIRLPFLGEIVFGSPMNLLASQTKQECQFPS

MQS SMALEKEYEAKRLTKLKCQENVCKEIQASLREKKVGLRRPLQPK
Transcript ENSMUST00000119824
Sequence
GGAATGTCCTGGTGTTAGCAAGGGACAACTCTAGCAAAACCCTCCCGCATAGTGCCACGGTTTGCTTGGGACCCTAAGAGGTGCCTACATGAACAGGAAC

ACGGAGCTGTCGCTGGATCCTCGAGAGTGGGCGTGGGACAATGACTGTCACCCACTGGGGCGAAGTGACTCCCATTAGGCAGGCTGGATCTGCGCCCCGC

GCGCACACAAAGCCCTTTATTGAGGCACCGGGTGACGCAGG - UNI26090 - GCAAAGTGCAAACAGCGGTGCAGATGTTACATCAGGCTCCTATGT

AAGGAAACCACTGTGATCATTTGTCATGGCGTATGGCTTGCCAAGAAGGAACACAGTACAAACCATTTTGAAGGGCAGCTGTTATAAAGT - UNI2609

0 - ACAGGAGCCATGGGACCTTGCGGAACTCACAAAGACCTGGTACACAAACTTGACGAACATCAGGCTGCCATTCTTGGGAGAAATCGTATTTGGTAG

TCCTATGAATCTCTTGGCAAGCCAAACCAAACAGGAATGCCAGTTTCCTTCAATGCAAT CCATGGCACTTGAAAAGGAGTATGAAGCAAAGCGCCTAAC

AAAACTGAAGTGTCAGGAGAATGTGTGTAAGGAAATCCAGGCTTCACTGAGAGAAAAGAAAGTCGGCCTGAGAAGACCACTTCAGCCCAAGTGACCCAAC

ATATTGTTGAAGCTGAACCTGTTTCCGGCATCCATGGAGATGAAGCTCTTGGACTCTTTCATAGTGTCAAGTCGACACAGCAGTGTGCCTATGGCGATGA

GGCCAGTGTTTCCAGACACGGCTCGGTGGATGCTATGACAGAGCCCCCAGGTTCCTGCTACACTCTTGTTCTTTGTGTCCCATACAGCAGCCCTCCCTGT

AAGTAGATGAAAACACATCTGGAGTTGAGTCATTTTGTGTTACGTGTTTCAATGCTTATAAGATTGCGTGCGGAAGAGGACAGTTCTTGTGAGAGGCAGC

GTTCTGAAGAGACATTTAAGATCCCAAGGAGATTTCTCAAAATGAAGGTCAGAAAGAAGTTCTTTTACAATGAGAAACTGCATTTTTTTTTTCTGCTTAA

GATTTCATTTCTGTTAACGCTACAGTTACCAATTTTCGGTAAAGTGTCGTTTATCATTCTCACGTGGCACTTTACTTTTAATTTTTTTTTTTTTTTAATT

CACGTAGTACTTTAAAATAAGACTTACTTTGTCTTTGTTCTCCTGGAAAAAATCGTGAAGCTGCTTTCCTTCTGGCTAACATTTTTTCTACAATGGACCT

GGAGCAGGTGTGGCACACATGCGTGAAGGGGACACGGAGGGACAAAGACGGCCTAACTGTGAGGAAAACTTATACTTGCAGAGTGGCTGGGGAATGAGCA

AATAAAGAGGAAGAACTGAGTTTGTATGAACAAAGTTTTCTAGAATTTGAATCCAATAAAGCATATTTGGATATTA
Translation
 - UNI26090 - MAYGLPRRNTVQTILKGSCYKV - UNI26090 - VQEPWDLAELTKTWYTNLTNIRLPFLGEIVFGSPMNLLASQTKQECQFPS

MQS SMALEKEYEAKRLTKLKCQENVCKEIQASLREKKVGLRRPLQPK
Transcript ENSMUST00000031261
Sequence
AGGCGCACCAGCAAGCAGGAGCACGAGCAAGCAAGCCGGCGCAAGTCGGCGGCTGGGCCGCTGCGAGTGCGCGGCCATGTGCACCTAGCGCGAGCTGCCC

TGGGTCGGGGGCGCGGCCAGGGTGCGGCTGACCTGTGGGGTACAGGGGTTCCGGGAGCAGCACGGGCTGGAAGGGCGAGGCCGGCACTCGCTACCGCGCC

CTAGCCGGTTCTGTCTGGAACTGAGAGCAGGAAAGGGCCGTGCCCTTAGGTAGCCAGCGCACCCCTGGGGTTCCATGCCG - UNI26090 - GCAAAG

TGCAAACAGCGGTGCAGATGTTACATCAGGCTCCTATGTAAGGAAACCACTGTGATCATTTGTCATGGCGTATGGCTTGCCAAGAAGGAACACAGTACAA

ACCATTTTGAAGGGCAGCTGTTATAAAGT - UNI26090 - ACAGGAGCCATGGGACCTTGCGGAACTCACAAAGACCTGGTACACAAACTTGACGAA

CATCAGGCTGCCATTCTTGGGAGAAATCGTATTTGGTAGTCCTATGAATCTCTTGGCAAGCCAAACCAAACAGGAATGCCAGTTTCCTTCAATGCAAT C

CATGGCACTTGAAAAGGAGTATGAAGCAAAGCGCCTAACAAAACTGAAGTGTCAGGAGAATGTGTGTAAGGAAATCCAGGCTTCACTGAGAGAAAAGAAA

GTCGGCCTGAGAAGACCACTTCAGCCCAAGTGACCCAACATATTGTTGAAGCTGAACCTGTTTCCGGCATCCATGGAGATGAAGCTCTTGGACTCTTTCA

TAGTGTCAAGTCGACACAGCAGTGTGCCTATGGCGATGAGGCCAGTGTTTCCAGACACGGCTCGGTGGATGCTATGACAGAGCCCCCAGGTTCCTGCTAC

ACTCTTGTTCTTTGTGTCCCATACAGCAGCCCTCCCTGTAAGTAGATGAAAACACATCTGG
Translation
 - UNI26090 - MAYGLPRRNTVQTILKGSCYKV - UNI26090 - VQEPWDLAELTKTWYTNLTNIRLPFLGEIVFGSPMNLLASQTKQECQFPS

MQS SMALEKEYEAKRLTKLKCQENVCKEIQASLREKKVGLRRPLQPK

For any suggestions or comments, please send an email to unitrap@crg.es