Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000029381 (Shroom3)
Chromosomal location
Chr 5: 93112461 - 93394785 (+)
Description
shroom family member 3 Gene [Source:MGI Symbol;Acc:MGI:1351655]
RefSeq_dna
NM_001077595 NM_001077596 NM_015756 
RefSeq_peptide
NP_001071063.1 NP_001071064.1 NP_056571.2 
UniGene
Mm.412825 Mm.46014 
MGI
MGI:1351655 
Uniprot/SWISSPROT
Q9QXN0 
Human Ortholog
ENSG00000138771 (SHROOM3)
Omim not available
UniTrap UNI19577
Vector Insertion
Chr 5: 93112858 - 93209778
Public Clones IST12726D10 (tigm) IST12810G1 (tigm) IST14623C2 (tigm) IST14317E7 (tigm)
IST14313E7 (tigm) IST11825B1 (tigm) IST14206G6 (tigm) IST12485H6 (tigm)
IST11825B2 (tigm) IST12588E3 (tigm) IST10885F3 (tigm) IST12646C2 (tigm)
IST12427H12 (tigm) IST12421F12 (tigm) IST13960F6 (tigm)
Private Clones OST388613 (lexicon) OST300595 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI35893
Vector Insertion
Chr 5: 93209934 - 93238413
Public Clones CMHD-GT_542F6-3S (cmhd) CMHD-GT_542F6-5S (cmhd) IST12840A3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29812
Vector Insertion
Chr 5: 93238588 - 93327023
Public Clones (sanger) E060G11 (ggtc) D099A12 (ggtc) D098E08 (ggtc) CMHD-GT_525E3-5S (cmhd)
IST15072C6 (tigm) IST14690D3 (tigm) IST14670E2 (tigm) IST14736C8 (tigm)
IST10874D10 (tigm) IST15069G4 (tigm) IST12842H8 (tigm) IST12646G10 (tigm)
IST15003D2 (tigm) IST14495H11 (tigm) IST14953H6 (tigm) IST15078H2 (tigm)
IST13411H2 (tigm) IST14739D4 (tigm) IST10065E7 (tigm) IST14621E1 (tigm)
IST12349F8 (tigm) IST14364G4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29739
Vector Insertion
Chr 5: 93327247 - 93348670
Public Clones (sanger) E088F10 (ggtc) IST14891G3 (tigm) IST12008D9 (tigm) IST10077G11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14702
Vector Insertion
Chr 5: 93348670 - 93348803
Public Clones FHCRC-GT-ROSA53 (fhcrc)
Private Clones OST64793 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8145
Vector Insertion
Chr 5: 93348803 - 93362779
Public Clones RRG407 (baygenomics) (ggtc) D108E10 (ggtc) IST14190D6 (tigm)
Private Clones OST126726 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6486
Vector Insertion
Chr 5: 93372166 - 93377429
Public Clones CSC032 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 59% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6987
Vector Insertion
Chr 5: 93377504 - 93379509
Public Clones RRZ154 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 61% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4768
Vector Insertion
Chr 5: 93384438 - 93391116
Public Clones AW0632 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 88% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000113051
Sequence
GGTGCTGCACCAGCGGGACGGAGCCGCGCGCCGGGGACTCGCGGCGGCCGCAGCGGCCACCGCATTCCGAGCGGGAGTCGCAGCCCGAGCCGCGCGCCCA

GACGCAGTGCGCGCCCACTGCCCGTTGCTGAGCGCGCGCAGCCGCCGGCGATGCTCCGCGCGCCGTGGCCGCGAGGTTTGAACTTGGCGGCAGCTCGGGA

TTCCGCCGGGCCGGGAGGCGATG - UNI14702 - - UNI29739 - AGACGTGTGTGCGGCCCCGGGCCATGCTGATCCTGGTACCTCTAAGTCCC

TCAGCTCAGAGCTGCTCACCTGCAGTCCCCAGCACCGGAAAGCAACATGGTCAGGAGGGGTGAAGCTTCGGCTAAAGCAGAG - UNI8145 - - UNI

14702 - GTGCAGTGAGCCTGCCACTCGCCCTCACTCGTGGCATACCACCAAATTTGGGGAGACACAGCCTGATGTCAGCATGATGCAGATATCTCAGG

GCACAATGGGCCCTCCTTGGCACCAGAGCTACCATTCCAG CTCTTCGACCAGTGACCTCTCCAACTACGACCATGCTTATCTGAGGCGGAGCCCTGACC

AGTGCAGCTCCCAGGGGAGCATGGAAAGCCTGGAGCCCAGTGGCGGATACCCACCCTGCCATCTCCTTTCTCCTGCCAAGTCCACGAGCAGCATCGACCA

GCTAGGCCACCTTCATAACAAAAGGGACTCCGCATATAGCTCCTTCTCCACCAGTTCGAGCATCTTCGAGTACCCACCCCCTGGTGGCTCTGCCCGAGAA

CGTTCGGGTTCCATGGACGTGATTTCTGCCCGGGGTGGCCTCCTAGAAGGGATGAGGCAGGCAGACATCCGCTACGTCAAGACGGTCTATGATACCCGGA

GAGGAGTATCTTCAGAGTATGAGGTGAACCCTTCAGCCTTGCTCCTTCAAGGTAGGGATGCCCATGCCTCAGCCGACAGTCAGGGCTGTGCTAAATGGCA

CAGCATTCCTCGGGGCAAGGGAACGCCTTCCCCGTCTTGGAGCCAGCAGTGTTCTGGTTCCCTGGAGACTGCTACTGACAACCTGCCCCAGAAGGCAGGC

GCACCCCTGCCCCCCACCCGCAGTGATAGCTATGCAGCCTTCCGCCATCGCGAGCGTCCCAGCTCCTGGTCCAGCCTTGATCAGAAAAGGTTCTGCCGGC

CTCAGACAAACTCTTCAGGCTCCCAGAAAACCCCATTCGCTGAGGACCAGCTGCATACAGTCCCAGAGAGGAGTCCAGAGAACAGCCCCCCAGTGAAATC

TAAGCATAATTATACCCAGAAGGCGCAGCCTGGCCAACCTCTGCTGCCCACTGGCATCTATCCGGTACCTTCTCCGGAGCCTCACTTTGCCCAGGTGCCC

CAGCCCTCTGTGAGTAGTAATGGCACCGTCTACCCTGCGCTAGTCAAAGAGAGTGGATACACAGCTGCTCAGGGAACCTGTAACAAGATGGCTACCTTAG

ATGAGAACGGGAATCAAAATGAAGCTAGCAGGCCTGGGTTTGCCTTCTGTCAGCCCCTAGAACACAACTCGGTGACTCCGGTGGAGAAAAGGCCAGAACC

CACGGCCAAATACATCTACAAAGTCCATTTTTCTTCAGTGCCTGAAAATGAAGACTCCTCCCTAAAGAGGCACATCACACCTCCCCACGGCCATAGTCCA

TATCCCAGCGAGAGAAAGAACATCCACGGTGGCAGCAGAGCGTGTTCCAATCACCACAGTCTCTCGTCCCCCCAGGCCCAGGCCCTGCACGTGGGTGATG

ACAGGAGGCCTTCCAGGCTCTCTCAGCCCTGGGAGGGTGACTTTCAGGAAGATCACAATGCCAACCTCAGGCAGAAAGTGGAGAGGGAGGGCCAAGGCCA

GGGCCTGTCGGGCAACTCTGGCAGGACCAGATCGGCCTTCTCATCTCTGCAGAATATTCCAGAGAGTCTGAGAAGACAAAGCAACGTGGAGCTTGGAGAA

GCCCAGGAGGTTCACCCCGGGGGCAGGTCCAAGGTGGAGGACCCTGGAAGGAAAGCAGGGGCTTCAGACATCAGGGGCTACCTGGACAGATCTGTTTCCT

ATCCGAGGCCCGAGGGGAAAATGAACGCCGTAGACTCCGTCCACAGTGCAGACTCCAGGTATGAGGAGTCCCCGGCCCCAGCGCTGCCACAGACATCCGG

TGCGAGCCAGCGGCGGCTCAGCTCCAGCAGCTCCGCCGCCCCGCAGTACAGGAAGCCCCATTGCTCCGTGCTGGAGAAGGTTTCTAGAATAGAGGAACGA

GAGCAGGGGCGCCACAGACCCCTGAGCGTGGGCAGCTCTGCATACGGCCCCGGCTACAGGCCTGGGAGGACCGGCCCGACCCCCAGTACTTCCAGCAGTG

ACCTCGACGATCCAAAAGCCGGCAGCGTCCATTTCTCGGAGTCCACTGAACACCTGCGCAATGGGGAGCAGAACCCCCCAAACGGGGAGGCTAAGCAGGA

AGAGGCTTCCCGGCCCCAGTGCAGCCATTTGATCCGGAGGGCCCCTGCGGACGGCCGTGGACCTCCTGCCCGAGGCGGCGAGCCCTCAAGGCCGGAGGCC

CGCCTGCTCCGCAGCCAGAGCACCTTTCAGCTCTACAGTGAGGCGGAGAGGGAAGCCTCGTGGTCAGAGGACAGGCCCGGTACCCCTGAGTCGCCCCTGC

TCGATGCGCCTTTCAGCCGCGCCTACAGAAACAGCATCAAGGATGCCCAGTCCCGCGTCCTGGGGGCCACGTCGTTTCGTCGCCGAGACCTGGAACCGGG

CACCCCCGCCACCTCGAGGCCCTGGCGCCCGCGACCCGCCTCCGCCCACGTGGGGATGCGGAGCCCCGAGGCCGCGGTGCCCTCGTCCTCCCCGCACACC

CCTCGGGAGCGACACAGCGTGACCCCGGCCGCGCCCCAGGCTGCCCGCCGAGGCCCACGCCGGCGCCTCACTGTCGAGCAGAAGAAGCGCTCCTACTCGG

AGCCCGAGAAGATGAACGAGGTAGGGGTCTCGGAGGAGGCCGAGCCCACGCCCTGCGGCCCGCCGAGGCCCGCGCAGCCGCGCTTCTCGGAGAGCACCGT

GGCCGACCGGCGCCGCATCTTCGAGCGCGACGGCAAGGCCTGCTCCACGCTCAGCCTGTCGGGCCCCGAGCTCAAGCAGTTCCAGCAGAGCGCCCTGGCC

GACTACATCCAGCGTAAGACGGGCAAGCGGCCCACAGGAGCCGCCTGCACACCGGAGGCCGGGCTGCGCGAGCGCGCACAGAGCGCCTACCTCCAGGCCG

GCCCCGCGGCGCCCGATGGCCCCGGCCTGGCCTCTGCCTGTAGCCTGAGCTCCCTGCGAGAGCCCGAGGCGCTGCCCCGCAAGGAGCACACTCATCCGTC

GGCCGCGGACGGCCCGCAGGCGCCCCGTGATCGCAGCAGCTCCTTCGCCAGCGGACGCCTAGTCGGGGAGCGACGTCGCTGGGACCCTCAGGTCCCCAGG

CAGCTGCTCAGCGGAGCGAACTGCGAACCGAGGGGCGTCCAGAGGATGGACGGGGCCCCGGGCGGGCCGCCTTCCTGGGGCATGGTGGCCGGGAAGGCCG

GGAAGTCCAAGTCAGCCGAGGATCTGCTGGAGCGCTCCGACACACTGGCGGTCCCTGTGCATGTGAGGTCCAGGTCGTCTCCCACCTCCGACAAGAAAGG

TCAG - UNI6486 - GATGTGCTCCTGAGGGAAGGCAGCAACTTTGGTTTTGTAAAGGATCCATGCTGTTTGGCTGGCCCTGGACCTAG - UNI698

7 - GTCTCTCAGCTGCTCAGACAAAGGCCAGAATGAGCTGGCATTGCCCCTGCACCACCCTACGCCCTGCTGGAACGGCTCAGGCTGCAAAGCCACTGT

GGCTTCCTCAGCTCCTCCCGAATCTTCTGGAGCCGCGGATCATCTGAAGCAACGTAGAGCGCCTGGTCCTAGGCCACTCTCAGCAGGAATGCACGGCCAC

TTCCCAGACGCCAGAGCTGCCTCACTCAGCTCCCCTCTGCCATCACCTGTCCCCTCCAGTTACCGGTCACAGCTTGCCATGGATCAGCAGACTGGGCAAC

AGCCTCCCTCATCCCCTGCCTCTGCAGTGACCCAGCCTACCAGTCCAAGAAGCCCTGAGCTCAGCAGCCCAGCATATGGGCTAGGGGAGGGGATGTGGAA

GAGGACATCCCTGCCTCAGCGACCCCCTCCCCCTTGGGTGAAATGGGCCCACGCGGTCAGAGAGGACGGCCTTGCTGAGGACACCTTGGCGCCTGAGTTT

GCGAACCTGAAGCACTATAGAAACCAGCCGAGTCGTCCGAGTTCCTGCAGCACTTCTGACCCAGACACTCCAGGAAGGATCTCGCTCCGAATATCGGAGT

CAGCCCTTCAACCTTCCCCACCGCCCCGGGGGGACTATGATGACGAAGTGTTCATGAAGGACTTGCACCCCAAGGTTACTTCAAGCCCCACATTTGAAGC

TCTTCCCCCACCCCCGCCACCTTCGCCACCGAGCGAGGAACCTCTAGTGAATGGCACAGATGACTTTCCTCCGCCTCCTCCTCCCCAAGCCCTGTGTGAG

GTACTGCTGGATGGTGAGGCATCCACGGAAGCTGGCAGCGG CCCCTGCAGAATTCCCAGGGTGATGGTCACAAGGGAAGGGCACGTGCCTGGGGCAGCC

CATTCCGAAGGTAGTCAGATAATGACTGCCACACCACCCCAAACCTCGGCCAAAGGTTCAGAAGCCGAGTCCAACACGCCTTCCAGCGCGAGCGCCCAGC

CTCAGCTCAACGGTTCTCCTGGCAAGCAGCTCTGTCCCAGCCAGACCCGAAACCTCACTTATGAACCTGTCGAGAGAACTCAGGATCTAGGAAAGAAAAC

TCACGCCGAGCCTCAGAAGACCTCAGAAGATATCCGGACAGAGGCTCTAGCCAAGGAAATTGTCCACCAAGACAAGTCTCTGGCAGACATTTTAGATCCT

GACTCCAGGATGAAGACAACGATGGACCTGATGGAGGGTTTATTCCCTGGAGACGCCAGTGTGCTGATGGATAGTGGCGCAAAGAGGAAAGCCTTAGACA

TCACCGCCAGGCGTGCGGGATGTGAAGCCAAGGC GAGCGACCACAAGGAGGCAGTGAGTGTGCTGGTCAACTGTCCTGCCTACTACAGTGTCTCTGCTG

CCAAGGCGGAGCTGCTCAACAAAATCAAAGACATGCCGGAGGAGCTGCAGGAGGAGGAGGGGCAGGAGGATGTCAATGAGAAAAAG - UNI4768 - G

CTGAGCTTATCGGAAGCCTTACCCACAAGCTGGAGAGCCTCCAGGAAGCCAAGGGGAGCCTGCTCACGGACATCAAGCTGAACAATGCCCTGGGAGAGGA

GGTGGAGGCTCTGATCAGTGAGCTCTGCAAACCCAACGAGTTTGACAAGTACAAGATGTTCATAGGGGACCTGGACAAGGTGGTCAACCTGCTGCTGTCC

CTGTCTGGACGCCTGGCCCGCGTGGAGAACGTCCTCAGAGGCCTTGGTGAAGACGCCAGCAAAGAGGAAAGG AGTTCTCTGAACGAGAAAAGGAAGGTT

CTGGCTGGCCAGCATGAGGATGCACGGGAGCTCAAGGAGAACCTGGACCGGAGGGAGCGCGTGGTGCTGGATATCCTGGCCAACTACCTGTCCGCCGAGC

AGCTGCAGGACTACCAGCACTTCGTGAAGATGAAGTCCACACTCCTCATTGAGCAGCGGAAGCTGGATGACAAGATAAAGCTGGGCCAGGAGCAGGTCAG

GTGCCTGCTGGAGTCGCTTCCCTCGGACTTCAGGCCCAAGGCAGGGGCCATCTCCCTCCCTCCAGCCCTCACCGGCCATGGGACTCCTGGGGGGACATCT

GTATTCGGTGGTGTTTTCCCAACGTTGACCTCTCCTCTTTAATCGCTCCTGTAAGCCCTGGGCAAAAGCTGCCACTCTCACCACTGTTCAATCTGAAAGC

GATTTCACTACAAACTGCGGTTTGAGTTGTGGGTTACTGGGGGCTTCCTGAGTAACAGGAAGAGGCTTTCCAGGAATCTCTCTTGCCTTTCACGGTTGGT

CTTCTGCGAGCTTGCACGCTCTGTGGAAGAGAGTCGGTGACCTGCGGCCTGATGGAGGGTGTCTGGCACGGGTTTCCCCAGGCTGAGGCGGCGGAGATGG

GTGTGTGGCACCCTCAGGAATGTATCCACAGCGGCCTTCCTTGCTGGTGGGCAGTGCACCCTGATACCAGGGCACAAGTACCAGTCTGCAACACAAAGCC

TTAAAAAGACACACACACACACACACACACACACACACACACACACACACACACACGTTAAGAAAACTGTAAAACCCCTGAACGTTTTTGTTATTTATAT

TTTTAAAAATGAAAAAGATCGTTATGTTTGTGTGCTAACCACTTACTTGATTCTATTTTGTGGTGGATGTAGGCAATTATGTTTGAGCTTTGTATTTCGT

GAAAACCTTAATGAAGAATTCCAAAGATAGTCAAATTGAATATGGAGATTTTTGCGGGTTTTTCTTCTGCTCGTTTTGTGTGTATCTGCTGTTGGGTGGC

TGTGTGCGCCACAGTAGGTGTGTAGAGTTGTACAGCTTTGTGTGGGTTCCGAGGCCTGACCCTGGGTCATCAGGTTCTCCCATCGCAAGTCTCTTCACCC

ACTGAGCCCTCTCTCCAGCCCCAGTCAGACGTTAATAAAGATGGGTGGCCATTCTGCACTTGTGCTATGCTGTGAGAGGTCCCAGTTTCCATGGTGATCG

GGCCTTGCCACGTTTCTCCAGGAGGACGGCTCAGTGGTGACATCTCGGGGTGTGTTCCTCCTTGACCAGTTTATTCACAAAGACAATAGTTCCCAAGCCT

GTGAGAGATGAGTCTAAGCCAGTTCAAAACCGAGTCCGTGCTGCCATCGTAGAGGAAATACACTTACTAAGCGACAC
Translation
 - UNI14702 - - UNI29739 -  - UNI8145 - - UNI14702 - MMQISQGTMGPPWHQSYHSS SSSTSDLSNYDHAYLRRSPDQCSSQG

SMESLEPSGGYPPCHLLSPAKSTSSIDQLGHLHNKRDSAYSSFSTSSSIFEYPPPGGSARERSGSMDVISARGGLLEGMRQADIRYVKTVYDTRRGVSSE

YEVNPSALLLQGRDAHASADSQGCAKWHSIPRGKGTPSPSWSQQCSGSLETATDNLPQKAGAPLPPTRSDSYAAFRHRERPSSWSSLDQKRFCRPQTNSS

GSQKTPFAEDQLHTVPERSPENSPPVKSKHNYTQKAQPGQPLLPTGIYPVPSPEPHFAQVPQPSVSSNGTVYPALVKESGYTAAQGTCNKMATLDENGNQ

NEASRPGFAFCQPLEHNSVTPVEKRPEPTAKYIYKVHFSSVPENEDSSLKRHITPPHGHSPYPSERKNIHGGSRACSNHHSLSSPQAQALHVGDDRRPSR

LSQPWEGDFQEDHNANLRQKVEREGQGQGLSGNSGRTRSAFSSLQNIPESLRRQSNVELGEAQEVHPGGRSKVEDPGRKAGASDIRGYLDRSVSYPRPEG

KMNAVDSVHSADSRYEESPAPALPQTSGASQRRLSSSSSAAPQYRKPHCSVLEKVSRIEEREQGRHRPLSVGSSAYGPGYRPGRTGPTPSTSSSDLDDPK

AGSVHFSESTEHLRNGEQNPPNGEAKQEEASRPQCSHLIRRAPADGRGPPARGGEPSRPEARLLRSQSTFQLYSEAEREASWSEDRPGTPESPLLDAPFS

RAYRNSIKDAQSRVLGATSFRRRDLEPGTPATSRPWRPRPASAHVGMRSPEAAVPSSSPHTPRERHSVTPAAPQAARRGPRRRLTVEQKKRSYSEPEKMN

EVGVSEEAEPTPCGPPRPAQPRFSESTVADRRRIFERDGKACSTLSLSGPELKQFQQSALADYIQRKTGKRPTGAACTPEAGLRERAQSAYLQAGPAAPD

GPGLASACSLSSLREPEALPRKEHTHPSAADGPQAPRDRSSSFASGRLVGERRRWDPQVPRQLLSGANCEPRGVQRMDGAPGGPPSWGMVAGKAGKSKSA

EDLLERSDTLAVPVHVRSRSSPTSDKKGQ - UNI6486 - DVLLREGSNFGFVKDPCCLAGPGPR - UNI6987 - RSLSCSDKGQNELALPLHHP

TPCWNGSGCKATVASSAPPESSGAADHLKQRRAPGPRPLSAGMHGHFPDARAASLSSPLPSPVPSSYRSQLAMDQQTGQQPPSSPASAVTQPTSPRSPEL

SSPAYGLGEGMWKRTSLPQRPPPPWVKWAHAVREDGLAEDTLAPEFANLKHYRNQPSRPSSCSTSDPDTPGRISLRISESALQPSPPPRGDYDDEVFMKD

LHPKVTSSPTFEALPPPPPPSPPSEEPLVNGTDDFPPPPPPQALCEVLLDGEASTEAGSG GPCRIPRVMVTREGHVPGAAHSEGSQIMTATPPQTSAKG

SEAESNTPSSASAQPQLNGSPGKQLCPSQTRNLTYEPVERTQDLGKKTHAEPQKTSEDIRTEALAKEIVHQDKSLADILDPDSRMKTTMDLMEGLFPGDA

SVLMDSGAKRKALDITARRAGCEAKA ASDHKEAVSVLVNCPAYYSVSAAKAELLNKIKDMPEELQEEEGQEDVNEKK - UNI4768 - AELIGSLTH

KLESLQEAKGSLLTDIKLNNALGEEVEALISELCKPNEFDKYKMFIGDLDKVVNLLLSLSGRLARVENVLRGLGEDASKEER SSLNEKRKVLAGQHEDA

RELKENLDRRERVVLDILANYLSAEQLQDYQHFVKMKSTLLIEQRKLDDKIKLGQEQVRCLLESLPSDFRPKAGAISLPPALTGHGTPGGTSVFGGVFPT

LTSPL
Transcript ENSMUST00000113054
Sequence
TGTGTCTTAGCTCTGCCTCCCTAGAGCTGGCTCTCCAGCCTGCAGTCGGCCTCTGTGCCACCTGCCCAAGGCCCCAAGGCCGGGTGGACCAGCTCGACTG

TGTGTCACGCCGGACAGACGCATCCAGCAGATCACTGAGGACAATGGAGATACCTGAGTTTCCACTTCTGTGAG - UNI14702 - - UNI29739 -

 - UNI29812 - AGACGTGTGTGCGGCCCCGGGCCATGCTGATCCTGGTACCTCTAAGTCCCTCAGCTCAGAGCTGCTCACCTGCAGTCCCCAGCACC

GGAAAGCAACATGGTCAGGAGGGGTGAAGCTTCGGCTAAAGCAGAG - UNI8145 - - UNI14702 - GTGCAGTGAGCCTGCCACTCGCCCTCAC

TCGTGGCATACCACCAAATTTGGGGAGACACAGCCTGATGTCAGCATGATGCAGATATCTCAGGGCACAATGGGCCCTCCTTGGCACCAGAGCTACCATT

CCAG CTCTTCGACCAGTGACCTCTCCAACTACGACCATGCTTATCTGAGGCGGAGCCCTGACCAGTGCAGCTCCCAGGGGAGCATGGAAAGCCTGGAGC

CCAGTGGCGGATACCCACCCTGCCATCTCCTTTCTCCTGCCAAGTCCACGAGCAGCATCGACCAGCTAGGCCACCTTCATAACAAAAGGGACTCCGCATA

TAGCTCCTTCTCCACCAGTTCGAGCATCTTCGAGTACCCACCCCCTGGTGGCTCTGCCCGAGAACGTTCGGGTTCCATGGACGTGATTTCTGCCCGGGGT

GGCCTCCTAGAAGGGATGAGGCAGGCAGACATCCGCTACGTCAAGACGGTCTATGATACCCGGAGAGGAGTATCTTCAGAGTATGAGGTGAACCCTTCAG

CCTTGCTCCTTCAAGGTAGGGATGCCCATGCCTCAGCCGACAGTCAGGGCTGTGCTAAATGGCACAGCATTCCTCGGGGCAAGGGAACGCCTTCCCCGTC

TTGGAGCCAGCAGTGTTCTGGTTCCCTGGAGACTGCTACTGACAACCTGCCCCAGAAGGCAGGCGCACCCCTGCCCCCCACCCGCAGTGATAGCTATGCA

GCCTTCCGCCATCGCGAGCGTCCCAGCTCCTGGTCCAGCCTTGATCAGAAAAGGTTCTGCCGGCCTCAGACAAACTCTTCAGGCTCCCAGAAAACCCCAT

TCGCTGAGGACCAGCTGCATACAGTCCCAGAGAGGAGTCCAGAGAACAGCCCCCCAGTGAAATCTAAGCATAATTATACCCAGAAGGCGCAGCCTGGCCA

ACCTCTGCTGCCCACTGGCATCTATCCGGTACCTTCTCCGGAGCCTCACTTTGCCCAGGTGCCCCAGCCCTCTGTGAGTAGTAATGGCACCGTCTACCCT

GCGCTAGTCAAAGAGAGTGGATACACAGCTGCTCAGGGAACCTGTAACAAGATGGCTACCTTAGATGAGAACGGGAATCAAAATGAAGCTAGCAGGCCTG

GGTTTGCCTTCTGTCAGCCCCTAGAACACAACTCGGTGACTCCGGTGGAGAAAAGGCCAGAACCCACGGCCAAATACATCTACAAAGTCCATTTTTCTTC

AGTGCCTGAAAATGAAGACTCCTCCCTAAAGAGGCACATCACACCTCCCCACGGCCATAGTCCATATCCCAGCGAGAGAAAGAACATCCACGGTGGCAGC

AGAGCGTGTTCCAATCACCACAGTCTCTCGTCCCCCCAGGCCCAGGCCCTGCACGTGGGTGATGACAGGAGGCCTTCCAGGCTCTCTCAGCCCTGGGAGG

GTGACTTTCAGGAAGATCACAATGCCAACCTCAGGCAGAAAGTGGAGAGGGAGGGCCAAGGCCAGGGCCTGTCGGGCAACTCTGGCAGGACCAGATCGGC

CTTCTCATCTCTGCAGAATATTCCAGAGAGTCTGAGAAGACAAAGCAACGTGGAGCTTGGAGAAGCCCAGGAGGTTCACCCCGGGGGCAGGTCCAAGGTG

GAGGACCCTGGAAGGAAAGCAGGGGCTTCAGACATCAGGGGCTACCTGGACAGATCTGTTTCCTATCCGAGGCCCGAGGGGAAAATGAACGCCGTAGACT

CCGTCCACAGTGCAGACTCCAGGTATGAGGAGTCCCCGGCCCCAGCGCTGCCACAGACATCCGGTGCGAGCCAGCGGCGGCTCAGCTCCAGCAGCTCCGC

CGCCCCGCAGTACAGGAAGCCCCATTGCTCCGTGCTGGAGAAGGTTTCTAGAATAGAGGAACGAGAGCAGGGGCGCCACAGACCCCTGAGCGTGGGCAGC

TCTGCATACGGCCCCGGCTACAGGCCTGGGAGGACCGGCCCGACCCCCAGTACTTCCAGCAGTGACCTCGACGATCCAAAAGCCGGCAGCGTCCATTTCT

CGGAGTCCACTGAACACCTGCGCAATGGGGAGCAGAACCCCCCAAACGGGGAGGCTAAGCAGGAAGAGGCTTCCCGGCCCCAGTGCAGCCATTTGATCCG

GAGGGCCCCTGCGGACGGCCGTGGACCTCCTGCCCGAGGCGGCGAGCCCTCAAGGCCGGAGGCCCGCCTGCTCCGCAGCCAGAGCACCTTTCAGCTCTAC

AGTGAGGCGGAGAGGGAAGCCTCGTGGTCAGAGGACAGGCCCGGTACCCCTGAGTCGCCCCTGCTCGATGCGCCTTTCAGCCGCGCCTACAGAAACAGCA

TCAAGGATGCCCAGTCCCGCGTCCTGGGGGCCACGTCGTTTCGTCGCCGAGACCTGGAACCGGGCACCCCCGCCACCTCGAGGCCCTGGCGCCCGCGACC

CGCCTCCGCCCACGTGGGGATGCGGAGCCCCGAGGCCGCGGTGCCCTCGTCCTCCCCGCACACCCCTCGGGAGCGACACAGCGTGACCCCGGCCGCGCCC

CAGGCTGCCCGCCGAGGCCCACGCCGGCGCCTCACTGTCGAGCAGAAGAAGCGCTCCTACTCGGAGCCCGAGAAGATGAACGAGGTAGGGGTCTCGGAGG

AGGCCGAGCCCACGCCCTGCGGCCCGCCGAGGCCCGCGCAGCCGCGCTTCTCGGAGAGCACCGTGGCCGACCGGCGCCGCATCTTCGAGCGCGACGGCAA

GGCCTGCTCCACGCTCAGCCTGTCGGGCCCCGAGCTCAAGCAGTTCCAGCAGAGCGCCCTGGCCGACTACATCCAGCGTAAGACGGGCAAGCGGCCCACA

GGAGCCGCCTGCACACCGGAGGCCGGGCTGCGCGAGCGCGCACAGAGCGCCTACCTCCAGGCCGGCCCCGCGGCGCCCGATGGCCCCGGCCTGGCCTCTG

CCTGTAGCCTGAGCTCCCTGCGAGAGCCCGAGGCGCTGCCCCGCAAGGAGCACACTCATCCGTCGGCCGCGGACGGCCCGCAGGCGCCCCGTGATCGCAG

CAGCTCCTTCGCCAGCGGACGCCTAGTCGGGGAGCGACGTCGCTGGGACCCTCAGGTCCCCAGGCAGCTGCTCAGCGGAGCGAACTGCGAACCGAGGGGC

GTCCAGAGGATGGACGGGGCCCCGGGCGGGCCGCCTTCCTGGGGCATGGTGGCCGGGAAGGCCGGGAAGTCCAAGTCAGCCGAGGATCTGCTGGAGCGCT

CCGACACACTGGCGGTCCCTGTGCATGTGAGGTCCAGGTCGTCTCCCACCTCCGACAAGAAAGGTCAG - UNI6486 - GATGTGCTCCTGAGGGAAG

GCAGCAACTTTGGTTTTGTAAAGGATCCATGCTGTTTGGCTGGCCCTGGACCTAG - UNI6987 - GTCTCTCAGCTGCTCAGACAAAGGCCAGAATG

AGCTGGCATTGCCCCTGCACCACCCTACGCCCTGCTGGAACGGCTCAGGCTGCAAAGCCACTGTGGCTTCCTCAGCTCCTCCCGAATCTTCTGGAGCCGC

GGATCATCTGAAGCAACGTAGAGCGCCTGGTCCTAGGCCACTCTCAGCAGGAATGCACGGCCACTTCCCAGACGCCAGAGCTGCCTCACTCAGCTCCCCT

CTGCCATCACCTGTCCCCTCCAGTTACCGGTCACAGCTTGCCATGGATCAGCAGACTGGGCAACAGCCTCCCTCATCCCCTGCCTCTGCAGTGACCCAGC

CTACCAGTCCAAGAAGCCCTGAGCTCAGCAGCCCAGCATATGGGCTAGGGGAGGGGATGTGGAAGAGGACATCCCTGCCTCAGCGACCCCCTCCCCCTTG

GGTGAAATGGGCCCACGCGGTCAGAGAGGACGGCCTTGCTGAGGACACCTTGGCGCCTGAGTTTGCGAACCTGAAGCACTATAGAAACCAGCCGAGTCGT

CCGAGTTCCTGCAGCACTTCTGACCCAGACACTCCAGGAAGGATCTCGCTCCGAATATCGGAGTCAGCCCTTCAACCTTCCCCACCGCCCCGGGGGGACT

ATGATGACGAAGTGTTCATGAAGGACTTGCACCCCAAGGTTACTTCAAGCCCCACATTTGAAGCTCTTCCCCCACCCCCGCCACCTTCGCCACCGAGCGA

GGAACCTCTAGTGAATGGCACAGATGACTTTCCTCCGCCTCCTCCTCCCCAAGCCCTGTGTGAGGTACTGCTGGATGGTGAGGCATCCACGGAAGCTGGC

AGCGG CCCCTGCAGAATTCCCAGGGTGATGGTCACAAGGGAAGGGCACGTGCCTGGGGCAGCCCATTCCGAAGGTAGTCAGATAATGACTGCCACACCA

CCCCAAACCTCGGCCAAAGGTTCAGAAGCCGAGTCCAACACGCCTTCCAGCGCGAGCGCCCAGCCTCAGCTCAACGGTTCTCCTGGCAAGCAGCTCTGTC

CCAGCCAGACCCGAAACCTCACTTATGAACCTGTCGAGAGAACTCAGGATCTAGGAAAGAAAACTCACGCCGAGCCTCAGAAGACCTCAGAAGATATCCG

GACAGAGGCTCTAGCCAAGGAAATTGTCCACCAAGACAAGTCTCTGGCAGACATTTTAGATCCTGACTCCAGGATGAAGACAACGATGGACCTGATGGAG

GGTTTATTCCCTGGAGACGCCAGTGTGCTGATGGATAGTGGCGCAAAGAGGAAAGCCTTAGACATCACCGCCAGGCGTGCGGGATGTGAAGCCAAGGC G

AGCGACCACAAGGAGGCAGTGAGTGTGCTGGTCAACTGTCCTGCCTACTACAGTGTCTCTGCTGCCAAGGCGGAGCTGCTCAACAAAATCAAAGACATGC

CGGAGGAGCTGCAGGAGGAGGAGGGGCAGGAGGATGTCAATGAGAAAAAG - UNI4768 - GCTGAGCTTATCGGAAGCCTTACCCACAAGCTGGAGA

GCCTCCAGGAAGCCAAGGGGAGCCTGCTCACGGACATCAAGCTGAACAATGCCCTGGGAGAGGAGGTGGAGGCTCTGATCAGTGAGCTCTGCAAACCCAA

CGAGTTTGACAAGTACAAGATGTTCATAGGGGACCTGGACAAGGTGGTCAACCTGCTGCTGTCCCTGTCTGGACGCCTGGCCCGCGTGGAGAACGTCCTC

AGAGGCCTTGGTGAAGACGCCAGCAAAGAGGAAAGG AGTTCTCTGAACGAGAAAAGGAAGGTTCTGGCTGGCCAGCATGAGGATGCACGGGAGCTCAAG

GAGAACCTGGACCGGAGGGAGCGCGTGGTGCTGGATATCCTGGCCAACTACCTGTCCGCCGAGCAGCTGCAGGACTACCAGCACTTCGTGAAGATGAAGT

CCACACTCCTCATTGAGCAGCGGAAGCTGGATGACAAGATAAAGCTGGGCCAGGAGCAGGTCAGGTGCCTGCTGGAGTCGCTTCCCTCGGACTTCAGGCC

CAAGGCAGGGGCCATCTCCCTCCCTCCAGCCCTCACCGGCCATGGGACTCCTGGGGGGACATCTGTATTCGGTGGTGTTTTCCCAACGTTGACCTCTCCT

CTTTAATCGCTCCTGTAAGCCCTGGGCAAAAGCTGCCACTCTCACCACTGTTCAATCTGAAAGCGATTTCACTACAAACTGCGGTTTGAGTTGTGGGTTA

CTGGGGGCTTCCTGAGTAACAGGAAGAGGCTTTCCAGGAATCTCTCTTGCCTTTCACGGTTGGTCTTCTGCGAGCTTGCACGCTCTGTGGAAGAGAGTCG

GTGACCTGCGGCCTGATGGAGGGTGTCTGGCACGGGTTTCCCCAGGCTGAGGCGGCGGAGATGGGTGTGTGGCACCCTCAGGAATGTATCCACAGCGGCC

TTCCTTGCTGGTGGGCAGTGCACCCTGATACCAGGGCACAAGTACCAGTCTGCAACACAAAGCCTTAAAAAGACACACACACACACACACACACACACAC

ACACACACACACACACACACGTTAAGAAAACTGTAAAACCCCTGAACGTTTTTGTTATTTATATTTTTAAAAATGAAAAAGATCGTTATGTTTGTGTGCT

AACCACTTACTTGATTCTATTTTGTGGTGGATGTAGGCAATTATGTTTGAGCTTTGTATTTCGTGAAAACCTTAATGAAGAATTCCAAAGATAGTCAAAT

TGAATATGGAGATTTTTGCGGGTTTTTCTTCTGCTCGTTTTGTGTGTATCTGCTGTTGGGTGGCTGTGTGCGCCACAGTAGGTGTGTAGAGTTGTACAGC

TTTGTGTGGGTTCCGAGGCCTGACCCTGGGTCATCAGGTTCTCCCATCGCAAGTCTCTTCACCCACTGAGCCCTCTCTCCAGCCCCAGTCAGACGTTAAT

AAAGATGGGTGGCCATTCTGCACTTGTGCTATGCTGTGAGAGGTCCCAGTTTCCATGGTGATCGGGCCTTGCCACGTTTCTCCAGGAGGACGGCTCAGTG

GTGACATCTCGGGGTGTGTTCCTCCTTGACCAGTTTATTCACAAAGACAATAGTTCCCAAGCCTGTGAGAGATGAGTCTAAGCCAGTTCAAAACCGAGTC

CGTGCTGCCATCGTAGAGGAAATACACTTACTAAGCGACAC
Translation
 - UNI14702 - - UNI29739 - - UNI29812 -  - UNI8145 - - UNI14702 - MMQISQGTMGPPWHQSYHSS SSSTSDLSNYDHA

YLRRSPDQCSSQGSMESLEPSGGYPPCHLLSPAKSTSSIDQLGHLHNKRDSAYSSFSTSSSIFEYPPPGGSARERSGSMDVISARGGLLEGMRQADIRYV

KTVYDTRRGVSSEYEVNPSALLLQGRDAHASADSQGCAKWHSIPRGKGTPSPSWSQQCSGSLETATDNLPQKAGAPLPPTRSDSYAAFRHRERPSSWSSL

DQKRFCRPQTNSSGSQKTPFAEDQLHTVPERSPENSPPVKSKHNYTQKAQPGQPLLPTGIYPVPSPEPHFAQVPQPSVSSNGTVYPALVKESGYTAAQGT

CNKMATLDENGNQNEASRPGFAFCQPLEHNSVTPVEKRPEPTAKYIYKVHFSSVPENEDSSLKRHITPPHGHSPYPSERKNIHGGSRACSNHHSLSSPQA

QALHVGDDRRPSRLSQPWEGDFQEDHNANLRQKVEREGQGQGLSGNSGRTRSAFSSLQNIPESLRRQSNVELGEAQEVHPGGRSKVEDPGRKAGASDIRG

YLDRSVSYPRPEGKMNAVDSVHSADSRYEESPAPALPQTSGASQRRLSSSSSAAPQYRKPHCSVLEKVSRIEEREQGRHRPLSVGSSAYGPGYRPGRTGP

TPSTSSSDLDDPKAGSVHFSESTEHLRNGEQNPPNGEAKQEEASRPQCSHLIRRAPADGRGPPARGGEPSRPEARLLRSQSTFQLYSEAEREASWSEDRP

GTPESPLLDAPFSRAYRNSIKDAQSRVLGATSFRRRDLEPGTPATSRPWRPRPASAHVGMRSPEAAVPSSSPHTPRERHSVTPAAPQAARRGPRRRLTVE

QKKRSYSEPEKMNEVGVSEEAEPTPCGPPRPAQPRFSESTVADRRRIFERDGKACSTLSLSGPELKQFQQSALADYIQRKTGKRPTGAACTPEAGLRERA

QSAYLQAGPAAPDGPGLASACSLSSLREPEALPRKEHTHPSAADGPQAPRDRSSSFASGRLVGERRRWDPQVPRQLLSGANCEPRGVQRMDGAPGGPPSW

GMVAGKAGKSKSAEDLLERSDTLAVPVHVRSRSSPTSDKKGQ - UNI6486 - DVLLREGSNFGFVKDPCCLAGPGPR - UNI6987 - RSLSCSD

KGQNELALPLHHPTPCWNGSGCKATVASSAPPESSGAADHLKQRRAPGPRPLSAGMHGHFPDARAASLSSPLPSPVPSSYRSQLAMDQQTGQQPPSSPAS

AVTQPTSPRSPELSSPAYGLGEGMWKRTSLPQRPPPPWVKWAHAVREDGLAEDTLAPEFANLKHYRNQPSRPSSCSTSDPDTPGRISLRISESALQPSPP

PRGDYDDEVFMKDLHPKVTSSPTFEALPPPPPPSPPSEEPLVNGTDDFPPPPPPQALCEVLLDGEASTEAGSG GPCRIPRVMVTREGHVPGAAHSEGSQ

IMTATPPQTSAKGSEAESNTPSSASAQPQLNGSPGKQLCPSQTRNLTYEPVERTQDLGKKTHAEPQKTSEDIRTEALAKEIVHQDKSLADILDPDSRMKT

TMDLMEGLFPGDASVLMDSGAKRKALDITARRAGCEAKA ASDHKEAVSVLVNCPAYYSVSAAKAELLNKIKDMPEELQEEEGQEDVNEKK - UNI476

8 - AELIGSLTHKLESLQEAKGSLLTDIKLNNALGEEVEALISELCKPNEFDKYKMFIGDLDKVVNLLLSLSGRLARVENVLRGLGEDASKEER SSLN

EKRKVLAGQHEDARELKENLDRRERVVLDILANYLSAEQLQDYQHFVKMKSTLLIEQRKLDDKIKLGQEQVRCLLESLPSDFRPKAGAISLPPALTGHGT

PGGTSVFGGVFPTLTSPL
Transcript ENSMUST00000113055
Sequence
GGGACGTCAGTGTGAACGCAGTGGGTAGACCCCACTCAGGACTTCCGCTGAATTCCAGCGGGTGTAGTGGGAGAAGCATCCCCGGGGAGCCGCAGGCTTC

GCTGTCCCGACTGAGTTTATCTTGGCCTGAGGGCAGCGTGCTGAGCGATCTAACCCAGCAGGGAAGCTCCTCTTGCCTCCATCTGGGTCAGGCACTTTAA

ACCGAAGCCGACTTGACCATGCCTCTGGCGCGATGAAGACTCCGGAGAACTTGGAGGAGCCTAGCGCCACGCCAAACCCCAGTAGGACCCCCACGGAGAG

ATTCGTTTATCTGGAAGCGCTCCTAGAGGGAGGGGCTCCCTGGGGCTTCACCCTGAAAGGTGGCCTGGAGCGTGGAGAACCGTTAATCATTTCCAAG - 

UNI19577 - ATTGAAGAAGGGGGCAAAGCCGACTCAGTGAGCTCCGGACTGCAAGCTGGGGACGAAGTCATACACATCAATGAGGTGGCGCTGAGCAG

TTCCAGGAGAGAGGCTGTCTCCCTAGTGAAAGGGTCCTACAAGACCCTGCGGCTGGTGGTGCGCAG - UNI14702 - - UNI29739 - - UNI29

812 - - UNI35893 - AGACGTGTGTGCGGCCCCGGGCCATGCTGATCCTGGTACCTCTAAGTCCCTCAGCTCAGAGCTGCTCACCTGCAGTCCCCA

GCACCGGAAAGCAACATGGTCAGGAGGGGTGAAGCTTCGGCTAAAGCAGAG - UNI8145 - - UNI14702 - GTGCAGTGAGCCTGCCACTCGCC

CTCACTCGTGGCATACCACCAAATTTGGGGAGACACAGCCTGATGTCAGCATGATGCAGATATCTCAGGGCACAATGGGCCCTCCTTGGCACCAGAGCTA

CCATTCCAG CTCTTCGACCAGTGACCTCTCCAACTACGACCATGCTTATCTGAGGCGGAGCCCTGACCAGTGCAGCTCCCAGGGGAGCATGGAAAGCCT

GGAGCCCAGTGGCGGATACCCACCCTGCCATCTCCTTTCTCCTGCCAAGTCCACGAGCAGCATCGACCAGCTAGGCCACCTTCATAACAAAAGGGACTCC

GCATATAGCTCCTTCTCCACCAGTTCGAGCATCTTCGAGTACCCACCCCCTGGTGGCTCTGCCCGAGAACGTTCGGGTTCCATGGACGTGATTTCTGCCC

GGGGTGGCCTCCTAGAAGGGATGAGGCAGGCAGACATCCGCTACGTCAAGACGGTCTATGATACCCGGAGAGGAGTATCTTCAGAGTATGAGGTGAACCC

TTCAGCCTTGCTCCTTCAAGGTAGGGATGCCCATGCCTCAGCCGACAGTCAGGGCTGTGCTAAATGGCACAGCATTCCTCGGGGCAAGGGAACGCCTTCC

CCGTCTTGGAGCCAGCAGTGTTCTGGTTCCCTGGAGACTGCTACTGACAACCTGCCCCAGAAGGCAGGCGCACCCCTGCCCCCCACCCGCAGTGATAGCT

ATGCAGCCTTCCGCCATCGCGAGCGTCCCAGCTCCTGGTCCAGCCTTGATCAGAAAAGGTTCTGCCGGCCTCAGACAAACTCTTCAGGCTCCCAGAAAAC

CCCATTCGCTGAGGACCAGCTGCATACAGTCCCAGAGAGGAGTCCAGAGAACAGCCCCCCAGTGAAATCTAAGCATAATTATACCCAGAAGGCGCAGCCT

GGCCAACCTCTGCTGCCCACTGGCATCTATCCGGTACCTTCTCCGGAGCCTCACTTTGCCCAGGTGCCCCAGCCCTCTGTGAGTAGTAATGGCACCGTCT

ACCCTGCGCTAGTCAAAGAGAGTGGATACACAGCTGCTCAGGGAACCTGTAACAAGATGGCTACCTTAGATGAGAACGGGAATCAAAATGAAGCTAGCAG

GCCTGGGTTTGCCTTCTGTCAGCCCCTAGAACACAACTCGGTGACTCCGGTGGAGAAAAGGCCAGAACCCACGGCCAAATACATCTACAAAGTCCATTTT

TCTTCAGTGCCTGAAAATGAAGACTCCTCCCTAAAGAGGCACATCACACCTCCCCACGGCCATAGTCCATATCCCAGCGAGAGAAAGAACATCCACGGTG

GCAGCAGAGCGTGTTCCAATCACCACAGTCTCTCGTCCCCCCAGGCCCAGGCCCTGCACGTGGGTGATGACAGGAGGCCTTCCAGGCTCTCTCAGCCCTG

GGAGGGTGACTTTCAGGAAGATCACAATGCCAACCTCAGGCAGAAAGTGGAGAGGGAGGGCCAAGGCCAGGGCCTGTCGGGCAACTCTGGCAGGACCAGA

TCGGCCTTCTCATCTCTGCAGAATATTCCAGAGAGTCTGAGAAGACAAAGCAACGTGGAGCTTGGAGAAGCCCAGGAGGTTCACCCCGGGGGCAGGTCCA

AGGTGGAGGACCCTGGAAGGAAAGCAGGGGCTTCAGACATCAGGGGCTACCTGGACAGATCTGTTTCCTATCCGAGGCCCGAGGGGAAAATGAACGCCGT

AGACTCCGTCCACAGTGCAGACTCCAGGTATGAGGAGTCCCCGGCCCCAGCGCTGCCACAGACATCCGGTGCGAGCCAGCGGCGGCTCAGCTCCAGCAGC

TCCGCCGCCCCGCAGTACAGGAAGCCCCATTGCTCCGTGCTGGAGAAGGTTTCTAGAATAGAGGAACGAGAGCAGGGGCGCCACAGACCCCTGAGCGTGG

GCAGCTCTGCATACGGCCCCGGCTACAGGCCTGGGAGGACCGGCCCGACCCCCAGTACTTCCAGCAGTGACCTCGACGATCCAAAAGCCGGCAGCGTCCA

TTTCTCGGAGTCCACTGAACACCTGCGCAATGGGGAGCAGAACCCCCCAAACGGGGAGGCTAAGCAGGAAGAGGCTTCCCGGCCCCAGTGCAGCCATTTG

ATCCGGAGGGCCCCTGCGGACGGCCGTGGACCTCCTGCCCGAGGCGGCGAGCCCTCAAGGCCGGAGGCCCGCCTGCTCCGCAGCCAGAGCACCTTTCAGC

TCTACAGTGAGGCGGAGAGGGAAGCCTCGTGGTCAGAGGACAGGCCCGGTACCCCTGAGTCGCCCCTGCTCGATGCGCCTTTCAGCCGCGCCTACAGAAA

CAGCATCAAGGATGCCCAGTCCCGCGTCCTGGGGGCCACGTCGTTTCGTCGCCGAGACCTGGAACCGGGCACCCCCGCCACCTCGAGGCCCTGGCGCCCG

CGACCCGCCTCCGCCCACGTGGGGATGCGGAGCCCCGAGGCCGCGGTGCCCTCGTCCTCCCCGCACACCCCTCGGGAGCGACACAGCGTGACCCCGGCCG

CGCCCCAGGCTGCCCGCCGAGGCCCACGCCGGCGCCTCACTGTCGAGCAGAAGAAGCGCTCCTACTCGGAGCCCGAGAAGATGAACGAGGTAGGGGTCTC

GGAGGAGGCCGAGCCCACGCCCTGCGGCCCGCCGAGGCCCGCGCAGCCGCGCTTCTCGGAGAGCACCGTGGCCGACCGGCGCCGCATCTTCGAGCGCGAC

GGCAAGGCCTGCTCCACGCTCAGCCTGTCGGGCCCCGAGCTCAAGCAGTTCCAGCAGAGCGCCCTGGCCGACTACATCCAGCGTAAGACGGGCAAGCGGC

CCACAGGAGCCGCCTGCACACCGGAGGCCGGGCTGCGCGAGCGCGCACAGAGCGCCTACCTCCAGGCCGGCCCCGCGGCGCCCGATGGCCCCGGCCTGGC

CTCTGCCTGTAGCCTGAGCTCCCTGCGAGAGCCCGAGGCGCTGCCCCGCAAGGAGCACACTCATCCGTCGGCCGCGGACGGCCCGCAGGCGCCCCGTGAT

CGCAGCAGCTCCTTCGCCAGCGGACGCCTAGTCGGGGAGCGACGTCGCTGGGACCCTCAGGTCCCCAGGCAGCTGCTCAGCGGAGCGAACTGCGAACCGA

GGGGCGTCCAGAGGATGGACGGGGCCCCGGGCGGGCCGCCTTCCTGGGGCATGGTGGCCGGGAAGGCCGGGAAGTCCAAGTCAGCCGAGGATCTGCTGGA

GCGCTCCGACACACTGGCGGTCCCTGTGCATGTGAGGTCCAGGTCGTCTCCCACCTCCGACAAGAAAGGTCAG - UNI6486 - GATGTGCTCCTGAG

GGAAGGCAGCAACTTTGGTTTTGTAAAGGATCCATGCTGTTTGGCTGGCCCTGGACCTAG - UNI6987 - GTCTCTCAGCTGCTCAGACAAAGGCCA

GAATGAGCTGGCATTGCCCCTGCACCACCCTACGCCCTGCTGGAACGGCTCAGGCTGCAAAGCCACTGTGGCTTCCTCAGCTCCTCCCGAATCTTCTGGA

GCCGCGGATCATCTGAAGCAACGTAGAGCGCCTGGTCCTAGGCCACTCTCAGCAGGAATGCACGGCCACTTCCCAGACGCCAGAGCTGCCTCACTCAGCT

CCCCTCTGCCATCACCTGTCCCCTCCAGTTACCGGTCACAGCTTGCCATGGATCAGCAGACTGGGCAACAGCCTCCCTCATCCCCTGCCTCTGCAGTGAC

CCAGCCTACCAGTCCAAGAAGCCCTGAGCTCAGCAGCCCAGCATATGGGCTAGGGGAGGGGATGTGGAAGAGGACATCCCTGCCTCAGCGACCCCCTCCC

CCTTGGGTGAAATGGGCCCACGCGGTCAGAGAGGACGGCCTTGCTGAGGACACCTTGGCGCCTGAGTTTGCGAACCTGAAGCACTATAGAAACCAGCCGA

GTCGTCCGAGTTCCTGCAGCACTTCTGACCCAGACACTCCAGGAAGGATCTCGCTCCGAATATCGGAGTCAGCCCTTCAACCTTCCCCACCGCCCCGGGG

GGACTATGATGACGAAGTGTTCATGAAGGACTTGCACCCCAAGGTTACTTCAAGCCCCACATTTGAAGCTCTTCCCCCACCCCCGCCACCTTCGCCACCG

AGCGAGGAACCTCTAGTGAATGGCACAGATGACTTTCCTCCGCCTCCTCCTCCCCAAGCCCTGTGTGAGGTACTGCTGGATGGTGAGGCATCCACGGAAG

CTGGCAGCGG CCCCTGCAGAATTCCCAGGGTGATGGTCACAAGGGAAGGGCACGTGCCTGGGGCAGCCCATTCCGAAGGTAGTCAGATAATGACTGCCA

CACCACCCCAAACCTCGGCCAAAGGTTCAGAAGCCGAGTCCAACACGCCTTCCAGCGCGAGCGCCCAGCCTCAGCTCAACGGTTCTCCTGGCAAGCAGCT

CTGTCCCAGCCAGACCCGAAACCTCACTTATGAACCTGTCGAGAGAACTCAGGATCTAGGAAAGAAAACTCACGCCGAGCCTCAGAAGACCTCAGAAGAT

ATCCGGACAGAGGCTCTAGCCAAGGAAATTGTCCACCAAGACAAGTCTCTGGCAGACATTTTAGATCCTGACTCCAGGATGAAGACAACGATGGACCTGA

TGGAGGGTTTATTCCCTGGAGACGCCAGTGTGCTGATGGATAGTGGCGCAAAGAGGAAAGCCTTAGACATCACCGCCAGGCGTGCGGGATGTGAAGCCAA

GGC GAGCGACCACAAGGAGGCAGTGAGTGTGCTGGTCAACTGTCCTGCCTACTACAGTGTCTCTGCTGCCAAGGCGGAGCTGCTCAACAAAATCAAAGA

CATGCCGGAGGAGCTGCAGGAGGAGGAGGGGCAGGAGGATGTCAATGAGAAAAAG - UNI4768 - GCTGAGCTTATCGGAAGCCTTACCCACAAGCT

GGAGAGCCTCCAGGAAGCCAAGGGGAGCCTGCTCACGGACATCAAGCTGAACAATGCCCTGGGAGAGGAGGTGGAGGCTCTGATCAGTGAGCTCTGCAAA

CCCAACGAGTTTGACAAGTACAAGATGTTCATAGGGGACCTGGACAAGGTGGTCAACCTGCTGCTGTCCCTGTCTGGACGCCTGGCCCGCGTGGAGAACG

TCCTCAGAGGCCTTGGTGAAGACGCCAGCAAAGAGGAAAGG AGTTCTCTGAACGAGAAAAGGAAGGTTCTGGCTGGCCAGCATGAGGATGCACGGGAGC

TCAAGGAGAACCTGGACCGGAGGGAGCGCGTGGTGCTGGATATCCTGGCCAACTACCTGTCCGCCGAGCAGCTGCAGGACTACCAGCACTTCGTGAAGAT

GAAGTCCACACTCCTCATTGAGCAGCGGAAGCTGGATGACAAGATAAAGCTGGGCCAGGAGCAGGTCAGGTGCCTGCTGGAGTCGCTTCCCTCGGACTTC

AGGCCCAAGGCAGGGGCCATCTCCCTCCCTCCAGCCCTCACCGGCCATGGGACTCCTGGGGGGACATCTGTATTCGGTGGTGTTTTCCCAACGTTGACCT

CTCCTCTTTAATCGCTCCTGTAAGCCCTGGGCAAAAGCTGCCACTCTCACCACTGTTCAATCTGAAAGCGATTTCACTACAAACTGCGGTTTGAGTTGTG

GGTTACTGGGGGCTTCCTGAGTAACAGGAAGAGGCTTTCCAGGAATCTCTCTTGCCTTTCACGGTTGGTCTTCTGCGAGCTTGCACGCTCTGTGGAAGAG

AGTCGGTGACCTGCGGCCTGATGGAGGGTGTCTGGCACGGGTTTCCCCAGGCTGAGGCGGCGGAGATGGGTGTGTGGCACCCTCAGGAATGTATCCACAG

CGGCCTTCCTTGCTGGTGGGCAGTGCACCCTGATACCAGGGCACAAGTACCAGTCTGCAACACAAAGCCTTAAAAAGACACACACACACACACACACACA

CACACACACACACACACACACACACGTTAAGAAAACTGTAAAACCCCTGAACGTTTTTGTTATTTATATTTTTAAAAATGAAAAAGATCGTTATGTTTGT

GTGCTAACCACTTACTTGATTCTATTTTGTGGTGGATGTAGGCAATTATGTTTGAGCTTTGTATTTCGTGAAAACCTTAATGAAGAATTCCAAAGATAGT

CAAATTGAATATGGAGATTTTTGCGGGTTTTTCTTCTGCTCGTTTTGTGTGTATCTGCTGTTGGGTGGCTGTGTGCGCCACAGTAGGTGTGTAGAGTTGT

ACAGCTTTGTGTGGGTTCCGAGGCCTGACCCTGGGTCATCAGGTTCTCCCATCGCAAGTCTCTTCACCCACTGAGCCCTCTCTCCAGCCCCAGTCAGACG

TTAATAAAGATGGGTGGCCATTCTGCACTTGTGCTATGCTGTGAGAGGTCCCAGTTTCCATGGTGATCGGGCCTTGCCACGTTTCTCCAGGAGGACGGCT

CAGTGGTGACATCTCGGGGTGTGTTCCTCCTTGACCAGTTTATTCACAAAGACAATAGTTCCCAAGCCTGTGAGAGATGAGTCTAAGCCAGTTCAAAACC

GAGTCCGTGCTGCCATCGTAGAGGAAATACACTTACTAAGCGACAC
Translation
MKTPENLEEPSATPNPSRTPTERFVYLEALLEGGAPWGFTLKGGLERGEPLIISK - UNI19577 - IEEGGKADSVSSGLQAGDEVIHINEVALSSS

RREAVSLVKGSYKTLRLVVRR - UNI14702 - - UNI29739 - - UNI29812 - - UNI35893 - RDVCAAPGHADPGTSKSLSSELLTCS

PQHRKATWSGGVKLRLKQR - UNI8145 - - UNI14702 - RCSEPATRPHSWHTTKFGETQPDVSMMQISQGTMGPPWHQSYHSS SSSTSDLSN

YDHAYLRRSPDQCSSQGSMESLEPSGGYPPCHLLSPAKSTSSIDQLGHLHNKRDSAYSSFSTSSSIFEYPPPGGSARERSGSMDVISARGGLLEGMRQAD

IRYVKTVYDTRRGVSSEYEVNPSALLLQGRDAHASADSQGCAKWHSIPRGKGTPSPSWSQQCSGSLETATDNLPQKAGAPLPPTRSDSYAAFRHRERPSS

WSSLDQKRFCRPQTNSSGSQKTPFAEDQLHTVPERSPENSPPVKSKHNYTQKAQPGQPLLPTGIYPVPSPEPHFAQVPQPSVSSNGTVYPALVKESGYTA

AQGTCNKMATLDENGNQNEASRPGFAFCQPLEHNSVTPVEKRPEPTAKYIYKVHFSSVPENEDSSLKRHITPPHGHSPYPSERKNIHGGSRACSNHHSLS

SPQAQALHVGDDRRPSRLSQPWEGDFQEDHNANLRQKVEREGQGQGLSGNSGRTRSAFSSLQNIPESLRRQSNVELGEAQEVHPGGRSKVEDPGRKAGAS

DIRGYLDRSVSYPRPEGKMNAVDSVHSADSRYEESPAPALPQTSGASQRRLSSSSSAAPQYRKPHCSVLEKVSRIEEREQGRHRPLSVGSSAYGPGYRPG

RTGPTPSTSSSDLDDPKAGSVHFSESTEHLRNGEQNPPNGEAKQEEASRPQCSHLIRRAPADGRGPPARGGEPSRPEARLLRSQSTFQLYSEAEREASWS

EDRPGTPESPLLDAPFSRAYRNSIKDAQSRVLGATSFRRRDLEPGTPATSRPWRPRPASAHVGMRSPEAAVPSSSPHTPRERHSVTPAAPQAARRGPRRR

LTVEQKKRSYSEPEKMNEVGVSEEAEPTPCGPPRPAQPRFSESTVADRRRIFERDGKACSTLSLSGPELKQFQQSALADYIQRKTGKRPTGAACTPEAGL

RERAQSAYLQAGPAAPDGPGLASACSLSSLREPEALPRKEHTHPSAADGPQAPRDRSSSFASGRLVGERRRWDPQVPRQLLSGANCEPRGVQRMDGAPGG

PPSWGMVAGKAGKSKSAEDLLERSDTLAVPVHVRSRSSPTSDKKGQ - UNI6486 - DVLLREGSNFGFVKDPCCLAGPGPR - UNI6987 - RSL

SCSDKGQNELALPLHHPTPCWNGSGCKATVASSAPPESSGAADHLKQRRAPGPRPLSAGMHGHFPDARAASLSSPLPSPVPSSYRSQLAMDQQTGQQPPS

SPASAVTQPTSPRSPELSSPAYGLGEGMWKRTSLPQRPPPPWVKWAHAVREDGLAEDTLAPEFANLKHYRNQPSRPSSCSTSDPDTPGRISLRISESALQ

PSPPPRGDYDDEVFMKDLHPKVTSSPTFEALPPPPPPSPPSEEPLVNGTDDFPPPPPPQALCEVLLDGEASTEAGSG GPCRIPRVMVTREGHVPGAAHS

EGSQIMTATPPQTSAKGSEAESNTPSSASAQPQLNGSPGKQLCPSQTRNLTYEPVERTQDLGKKTHAEPQKTSEDIRTEALAKEIVHQDKSLADILDPDS

RMKTTMDLMEGLFPGDASVLMDSGAKRKALDITARRAGCEAKA ASDHKEAVSVLVNCPAYYSVSAAKAELLNKIKDMPEELQEEEGQEDVNEKK - UN

I4768 - AELIGSLTHKLESLQEAKGSLLTDIKLNNALGEEVEALISELCKPNEFDKYKMFIGDLDKVVNLLLSLSGRLARVENVLRGLGEDASKEER 

SSLNEKRKVLAGQHEDARELKENLDRRERVVLDILANYLSAEQLQDYQHFVKMKSTLLIEQRKLDDKIKLGQEQVRCLLESLPSDFRPKAGAISLPPALT

GHGTPGGTSVFGGVFPTLTSPL

For any suggestions or comments, please send an email to unitrap@crg.es