Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000029392 (Rilpl1)
Chromosomal location
Chr 5: 124943091 - 124981400 (-)
Description
Rab interacting lysosomal protein-like 1 Gene [Source:MGI Symbol;Acc:MGI:1922945]
RefSeq_dna
NM_021430 
RefSeq_peptide
NP_067405.1 
UniGene
Mm.41180 Mm.475643 
MGI
MGI:1922945 
Uniprot/SWISSPROT
Q9JJC6 
Human Ortholog
ENSG00000188026 (RILPL1)
Omim not available
UniTrap UNI23564
Vector Insertion
Chr 5: 124971259 - 124971411
Public Clones not available
Private Clones OST253079 (lexicon) OST157451 (lexicon)
Severity of mutation (?) Insertion after 25% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17672
Vector Insertion
Chr 5: 124964753 - 124965526
Public Clones IST12279B10 (tigm)
Private Clones OST438359 (lexicon) OST398204 (lexicon) OST299555 (lexicon) OST224761 (lexicon)
OST223241 (lexicon) OST185223 (lexicon) OST168491 (lexicon)
Severity of mutation (?) Insertion after 47% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7803
Vector Insertion
Chr 5: 124964527 - 124964753
Public Clones RRN303 (baygenomics) RRK495 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 47% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14430
Vector Insertion
Chr 5: 124953563 - 124964753
Public Clones FHCRC-GT-S13-1H1 (fhcrc)
Private Clones OST400045 (lexicon)
Severity of mutation (?) Insertion after 66% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16983
Vector Insertion
Chr 5: 124951942 - 124953559
Public Clones not available
Private Clones OST451349 (lexicon) OST338953 (lexicon) OST46959 (lexicon) OST32711 (lexicon)
Severity of mutation (?) Insertion after 80% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13894
Vector Insertion
Chr 5: 124943854 - 124951848
Public Clones CMHD-GT_209A4-3 (cmhd) CMHD-GT_488E10-3 (cmhd) CMHD-GT_515D9-3 (cmhd) IST14488E2 (tigm)
Private Clones OST345566 (lexicon) OST312134 (lexicon) OST248366 (lexicon) OST28251 (lexicon)
OST22523 (lexicon) OST14226 (lexicon) OST14182 (lexicon) OST7403 (lexicon)
OST2310 (lexicon) OST1133 (lexicon) OST730 (lexicon)
Severity of mutation (?) Insertion after 88% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000062153
Sequence
GGGACCGGAGCCGGGGGCGGAGCTTCGGCTTCGCGGGGCTGCGCACCGAGACCCCCGGGGACAGAGACTCGCTCCCCCTCCTCTCCAAACCCACGTCGCC

TCGCAGCGTTCCCACGGGGAGGAGCCGGCCAACCGGAGTCACTCGGCGTCACCAAAGTTTGATTCTCCTCTCCGGGAGGAGTCTCCGGGCCGCGGTCCCT

CCGGGCACCGGGCGCCACCGCCTCCCAGGCCGGGACCCGCGTCTCCATCGCACCCAGTTGGAGCATCAAGTCCGGAGACGCTGCGGGCCTGCGCACGCGC

CGCCGCCCTCGCCCTCCTCCCCGCGGTGCTCCAGGCCCCCCGCACTCCCCCCCCCCCAAGTTCACGAGTTACTGGAGTGGACGGACGGCTGGGAGCCCGC

GCAGGGCCATGGAGGAGCCGCTAGGGTCACCGCCCGCCGCCCTGTCGGCTCTGGAGAAGAACGTGGCGGAGCTGACCGTCATGGATGTGTACGATATCGC

GTCGCTCGTGGGCCACGAGTTCGAGAGGGTCATCGACCAACACGGCTGCGAGTCCATCGCACGCCTCATGCCCAAGGTCGTGAGGGTCCTGGAGATCCTC

GAGGTGCTGGTTAGCCGGCACCACGTCGCTCCCGAGCTAGACGAGCTGCGCCTGGAACTGGACCGGTTGCGCGTAGAGAGGATGGACCGCATTGAAAAGG

AGCGCAAGCATCAAAAG - UNI23564 - GAGCTGGAGCTGGTGGAGGACGTGTGGCGGGGTGAAGCACAGGACCTCCTGTCCCAGATTGCCCAGCTG

CAGGAGGAGAATAAGCAGCTGATGACCAACCTCAACCACAAGGACGTGGGCTTCTCCGAGGAGGAGTTCCAGAAGCAGGAAG - UNI23564 - GCAT

GTCAGAGCGTGAGCGGCAGGTGATGAAGAGGCTGAAGGAGGTGGTGGACAAGCAGAGGGATGAGCTCCGAGCCAAAGACAGGGAGCTGGGCCTGAAGAAT

GAGGACGTCGAGGCT - UNI7803 - - UNI14430 - - UNI17672 - TTGCAGCAGCAGCAGACGAGGCTAATGAAGATCAACCATGACCTTC

GGCACCGGGTCACCGTGGTTGAGGCCCAGGGGAAAGCCCTGATTGAGCAGAAGGTGGAGCTCGAAGCAGACCTGCAGACCAAGGAGCAGGAGATGGGCAG

CCTGCGGGCTGAACTCGGAAAGCTTCGCGAGAGGCTGCAGGGCGAGCACAGCCAGAATGGGGAGGAGGAGGAGGCTGAG - UNI7803 - - UNI144

30 - ATCCAGCCGCAGCCAGATGGAGAGGAATCGATTTCAGATGCAGAGAAGGCCGCCCTGGACCTCAAGGACCCCAACCGCCCGAGGTTCACGCTCCA

GGAGCTGCGGGACGTCCTGCACGAGAGGAACGAGCTCAAGTCCAAGGTGTTTCTGCTGCAAGAGGAACTGGCCTACTATAAGAG - UNI14430 - - 

UNI16983 - TGAAGAAATAGAAGAAGAGAATCGAATACCCCAGCCTCCGCCCATTACACACCCGAGGACGTCCCCCCAGCCTGAATCGGGGATCAAGC

GACT - UNI13894 - GTTTAGCTTTTTCTCCCGGGACAAGAAGCGCCTGGCCAACACGCAGAGACCCACACACATCCACGAGTCCTTTGGCCAGTGG

GCAATTACCCAGCGAGATGACGGGTACACAGAGCAAGGACAGGAAGCCCTGCAGCACCTGTGACTGTACCTCTGCCTGGACTGCCTGCCACCAGCTCTAG

GTGGCGGCCGCCTCAACATCAGTTCCTCAAACGAACTGTCTGCTTTGAGGACTGATGACGAAAAACTGATGCCAAATTTGAAAGAAGTGTTTTATTTATC

TGCAGGGCTACCCAGTTTATACTCAATGCCTCGAAACCCTTAGGACCTCTATTTAATAAGATGAGGATATGAAACCAGACCACATTAATTTCAGTTAACA

GGCTTTCTAAGCTGAACACTTCGCCACTATCATAGCTGTTTGACTCCTAGGTTTTGTTTGTTTTCTTACGGCCTTTGTCGGTGAGGAGCAGAGGAAGGGA

GTTTTATATCATGAAGTTGCCCTGGAGGTAGCAGGCTATACATAACAGGAAGCGTGAATCGGACAGGTGGAGCCTCGGATCATAGGATGGACTACCCAGT

TTGGCTGGGACACAACAGAAAATCATGCAGTTCTAGCCACTCGCTAGAAACAACCACAGGACTGTCACACTTTGTTCTGATAAAGCTAGAGGCCCAAGAA

GCCTGTCCGAGATGGTGTGCCTTGGAATCTGCTGTGAGCTACGCAGTACTAACCAAACAATGTTGTTTAGGATGAGACATC
Translation
MEEPLGSPPAALSALEKNVAELTVMDVYDIASLVGHEFERVIDQHGCESIARLMPKVVRVLEILEVLVSRHHVAPELDELRLELDRLRVERMDRIEKERK

HQK - UNI23564 - ELELVEDVWRGEAQDLLSQIAQLQEENKQLMTNLNHKDVGFSEEEFQKQEG - UNI23564 - GMSERERQVMKRLKEVVD

KQRDELRAKDRELGLKNEDVEA - UNI7803 - - UNI14430 - - UNI17672 - LQQQQTRLMKINHDLRHRVTVVEAQGKALIEQKVELEAD

LQTKEQEMGSLRAELGKLRERLQGEHSQNGEEEEAE - UNI7803 - - UNI14430 - IQPQPDGEESISDAEKAALDLKDPNRPRFTLQELRDVL

HERNELKSKVFLLQEELAYYKS - UNI14430 - - UNI16983 - SEEIEEENRIPQPPPITHPRTSPQPESGIKRL - UNI13894 - LFSFF

SRDKKRLANTQRPTHIHESFGQWAITQRDDGYTEQGQEALQHL
Transcript ENSMUST00000111447
Sequence
GGGACCGGAGCCGGGGGCGGAGCTTCGGCTTCGCGGGGCTGCGCACCGAGACCCCCGGGGACAGAGACTCGCTCCCCCTCCTCTCCAAACCCACGTCGCC

TCGCAGCGTTCCCACGGGGAGGAGCCGGCCAACCGGAGTCACTCGGCGTCACCAAAGTTTGATTCTCCTCTCCGGGAGGAGTCTCCGGGCCGCGGTCCCT

CCGGGCACCGGGCGCCACCGCCTCCCAGGCCGGGACCCGCGTCTCCATCGCACCCAGTTGGAGCATCAAGTCCGGAGACGCTGCGGGCCTGCGCACGCGC

CGCCGCCCTCGCCCTCCTCCCCGCGGTGCTCCAGGCCCCCCGCACTCCCCCCCCCCCAAGTTCACGAGTTACTGGAGTGGACGGACGGCTGGGAGCCCGC

GCAGGGCCATGGAGGAGCCGCTAGGGTCACCGCCCGCCGCCCTGTCGGCTCTGGAGAAGAACGTGGCGGAGCTGACCGTCATGGATGTGTACGATATCGC

GTCGCTCGTGGGCCACGAGTTCGAGAGGGTCATCGACCAACACGGCTGCGAGTCCATCGCACGCCTCATGCCCAAGGTCGTGAGGGTCCTGGAGATCCTC

GAGGTGCTGGTTAGCCGGCACCACGTCGCTCCCGAGCTAGACGAGCTGCGCCTGGAACTGGACCGGTTGCGCGTAGAGAGGATGGACCGCATTGAAAAGG

AGCGCAAGCATCAAAAG - UNI23564 - GAGCTGGAGCTGGTGGAGGACGTGTGGCGGGGTGAAGCACAGGACCTCCTGTCCCAGATTGCCCAGCTG

CAGGAGGAGAATAAGCAGCTGATGACCAACCTCAACCACAAGGACGTGGGCTTCTCCGAGGAGGAGTTCCAGAAGCAGGAAG - UNI23564 - GCAT

GTCAGAGCGTGAGCGGCAGGTGATGAAGAGGCTGAAGGAGGTGGTGGACAAGCAGAGGGATGAGCTCCGAGCCAAAGACAGGGAGCTGGGCCTGAAGAAT

GAGGACGTCGAGGCT - UNI7803 - - UNI14430 - - UNI17672 - TTGCAGCAGCAGCAGACGAGGCTAATGAAGATCAACCATGACCTTC

GGCACCGGGTCACCGTGGTTGAGGCCCAGGGGAAAGCCCTGATTGAGCAGAAGGTGGAGCTCGAAGCAGACCTGCAGACCAAGGAGCAGGAGATGGGCAG

CCTGCGGGCTGAACTCGGAAAGCTTCGCGAGAGGCTGCAGGGCGAGCACAGCCAGAATGGGGAGGAGGAGGAGGCTGAG - UNI7803 - - UNI144

30 - ATCCAGCCGCAGCCAGATGGAGAGGAATCGATTTCAGATGCAGAGAAGGCCGCCCTG - UNI14430 - CCTCAAGGACCC - UNI14430 

- ACCGCCCGAGGTTCACGCTCCAGGAGCTGCGGGACGTCCTGCACGAGAGGAACG - UNI14430 - CTCAAGTCCAAGGTGTTTCTGCTGCAAGAG

GAACTGGCCTACTATAAGAGGTGA
Translation
 - UNI23564 -  - UNI23564 -  - UNI7803 - - UNI14430 - - UNI17672 - MKINHDLRHRVTVVEAQGKALIEQKVELEADLQ

TKEQEMGSLRAELGKLRERLQGEHSQNGEEEEAE - UNI7803 - - UNI14430 - IQPQPDGEESISDAEKAAL - UNI14430 - PQGP - 

UNI14430 - TARGSRSRSCGTSCTRGT - UNI14430 - LKSKVFLLQEELAYYKR

For any suggestions or comments, please send an email to unitrap@crg.es