Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000029403 (Cdkl2)
Chromosomal location
Chr 5: 92435101 - 92472044 (-)
Description
cyclin-dependent kinase-like 2 (CDC2-related kinase) Gene [Source:MGI (curated);Acc:Cdkl2-001]
RefSeq_dna
NM_016912 NM_177270 
RefSeq_peptide
NP_058608.1 NP_796244.2 
UniGene
Mm.44963 Mm.474103 
MGI
MGI:1858227 
Uniprot/SWISSPROT
Q9QUK0 
Uniprot/SPTREMBL
Q149A0 
Human Ortholog
ENSG00000138769 (CDKL2)
Omim not available
UniTrap UNI14218
Vector Insertion
Chr 5: 92468263 - 92468463
Public Clones CMHD-GT_77E9-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36562
Vector Insertion
Chr 5: 92468263 - 92471699
Public Clones IST10923F1 (tigm) IST12291B10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI35813
Vector Insertion
Chr 5: 92466193 - 92468463
Public Clones IST12343D11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 10% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33616
Vector Insertion
Chr 5: 92460008 - 92462263
Public Clones IST13073G5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 38% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000113140
Sequence
AGCTAGGGTGGCCAACGCCTTCGCCTAGGGCTACTTGGCGAGGTGCTGCTTCCCTGAGCTGAGCGACCCGAGGGCTTTCGGCCGGCGGTGCTCTGTTTTC

CTCAGTTCGTTTCTCTGCAGCTGTTGTCCTTGACAGGTGCTTGTGTCTTTGCCTGTCGCAGACGCATTCTGACTCGGGCCCTTTCTCTCTCTCTGGAGAC

TGCCTATGGCTGGGGACCGAGTGAGGTCGTTGCCTTGACGACGGCAGCATGCGGCCCGTAGTCCTCGGAAGTGTGAGCTTGCGGAGGGCAGAAGCCAATC

TGCCTCCCTGCCTGCTTCACCTAGGACCGGTAATTGCGTCCGCAGAGGAAATCCCAATACTGGGATTGCTAGTGTGCTAGCTAGTCAGCATCTTTTTAGA

TCTGCTAGCGAGATGCATATCACCTTAAATTTGTTTCCAAGTTGAAAACCTTTGGCTCTTTCCATGTGAAGGGTTTGGAAGAAATA - UNI14218 - 

- UNI35813 - - UNI36562 - CAAGAAAAATTCCTACTGGTTTTAAAGCAAAATGGAGAAGTACGAGAACCTAGGATTGGTTGGAGAGGGGAGTT

ACGGAATGGTGATGAAGTGTAGGAACAAAGACAGTGGAAGAATTGTGGCCATTAAGAAGTTCCTAGAAAGTGACGATGATAAAATGGTTAAGAAGATCGC

AATGCGAGAGATCAAGTTACTAAAG - UNI14218 - - UNI35813 - - UNI36562 - CAACTGCGGCATGAAAATTTGGTGAATCTGTTGGA

AGTATGTAAGAAAAAAAAACGTTGGTACCTAGTCTTTGAATTTGTTGACCACACGATTCTTGATGACTTGAAACTCTTTCCAAATGGACTAGACTATCAA

GTAGTTCAAAAATATTTGTTTCAGATTATTAATGGAATTGGATTTTGCCACAGTCACAAT - UNI35813 - ATCATACACAGAGATATAAAGCCTGA

GAATATATTAGTCTCCCAGTCTGGCGTTGTAAAATTATGTGACTTTGGATTTGCACGGACCCTGGCGGCTCCAGGGGAGGTTTACACTGACTATGTGGCC

ACCCGGTGGTACAGAGCTCCAGAACTGCTGGTCGGTGACGTCAAGTATGGCAA - UNI33616 - GGCTGTGGATATCTGGGCCATTGGTTGTCTGGT

CATTGAAATGCTTATGGGGCAGCCACTGTTTCCAGGAGAATCTGATATTGATCAGCTACATCATATTATGACATGTTTAG - UNI33616 - GTAATT

TAATTCCAAGACACCAGGAGCTATTTTATAAAAATCCTGTGTTTGCTGGAGTAAGGTTGCCTGAGGTCAAAGATGCAGAAGCAGAGCCTCTTGAGAGCCG

CTATCCTAAGCTCCCTGAAGCTGTGATCAGTTTAGCAAAG - UNI33616 - AAATGCTTGCACATTGACCCAGACAAAAGGCCCTTCTGTGCTGACC

TTCTGCGCCATGACTTCTTTCAAATGGATGGATTTGCTGAGAG GTTTTCTCAAGAATTGCAGTTAAAAATAGAGAAAGATGCCAGGAATAATTCTTTAC

CTAAAAAGTCTCAAAACAGAAAGAAAGAAAAAGACGATGCCTTAGGTGAAGAAAGAAAAACCCTTGTGGTACAG GATACCAATGCTGACCCCAAAATTA

AGGATTCAAAAGTATTTAAAGTAAAGGGGTCAAAAATTGATGTTGAGAAAATGGAAAAAGGAAGTAGAGCTTCAAATGCCAACTGTCTCCATGACAATGG

GACAAACCACAAAGGCTTGGCTTCCACCAGCCTCAGAGATTGCAGCAATGTCAACATTGATCACTCAAGGAACCCAGGCACAGCGATTCCTCCCCTCACA

CACAATCTTTCTGCAGTTGCTCCTGGCATTAATGCTGGAATGGGGACTATTCCTGGCGTTCAGAATTACAG AGTGGATGAGAAAACAAAGAAATACTGT

AATCCATTTGTTAAACCAAATCAGCCTCCTCCAGCAGGGATTTATAATATGAATGTGAGCACATCC GTCTCAGGTGAAAAGTACCTCCTTCAGGCAAAC

AAGAAAAGGAAGGAATATCCCAAAGCAGACGTGCGGTTGCCTGAACTAAACTATAACCATCTTCCTGAACTGAGAGCTTTAGAAGGCATAG CTCGAAAT

TCTAGGCTAATAAAGAAAGAGAACAAATGCCTTTCAGAATCTCGAATTCCCTCTCTGGCTGCCATTGATCTGCACGTGTCCAGTGTTGCATCACACCAG 

GGAGCAGGATCACCCCTGTCAGATGATTCTGAGGCTGATTTGCCTCGGATGGAACACCAACACTGAGACTCATTTTAATCCTGAACAGG ATGCTGCCAG

CCCTGGAGATGACGTCCTCTTGCACGAGAGCACTGATACCCTAGAGGAGATCTGCAGTTTGACTGTTTCCTTCTGGAAACCTATGCTTTCTAAGAAAGGC

TTTGTAGAAGAAGGGAAGACAGACTTCCAAAGACTTCAAAGGAAGATTGAACAAGTGCCCCTTCACCTTTCCAACCTATGATGCTATTTCAAGATATATC

CATGGAACAACAGTGACATGGTTATTGTTACATGAATGTGTATTTGATATTAGTAGATTGTGTATTTAAAGTTATATGAGATTAAAAGTCAGTAAAAAAA

GG
Translation
 - UNI14218 - - UNI35813 - - UNI36562 - MEKYENLGLVGEGSYGMVMKCRNKDSGRIVAIKKFLESDDDKMVKKIAMREIKLLK - U

NI14218 - - UNI35813 - - UNI36562 - QLRHENLVNLLEVCKKKKRWYLVFEFVDHTILDDLKLFPNGLDYQVVQKYLFQIINGIGFCHSH

N - UNI35813 - IIHRDIKPENILVSQSGVVKLCDFGFARTLAAPGEVYTDYVATRWYRAPELLVGDVKYGK - UNI33616 - KAVDIWAIGCL

VIEMLMGQPLFPGESDIDQLHHIMTCLG - UNI33616 - GNLIPRHQELFYKNPVFAGVRLPEVKDAEAEPLESRYPKLPEAVISLAK - UNI336

16 - KCLHIDPDKRPFCADLLRHDFFQMDGFAER RFSQELQLKIEKDARNNSLPKKSQNRKKEKDDALGEERKTLVVQ DTNADPKIKDSKVFKVKGS

KIDVEKMEKGSRASNANCLHDNGTNHKGLASTSLRDCSNVNIDHSRNPGTAIPPLTHNLSAVAPGINAGMGTIPGVQNYR RVDEKTKKYCNPFVKPNQP

PPAGIYNMNVSTS VSGEKYLLQANKKRKEYPKADVRLPELNYNHLPELRALEGIA ARNSRLIKKENKCLSESRIPSLAAIDLHVSSVASHQ GAGSPL

SDDSEADLPRMEHQH 
Transcript ENSMUST00000086978
Sequence
GCCCCGCAGCGCCCCGCCGCGCCGCGGGCGGGCAAGCTGGGAAATCTCATGGTCTCCTCAGTCCCAGCGAACCGTCACCTTGGCTCTCCTCGTGGCCACT

GGGGCAACCTGCGGTCCCCTGAGAGCAGAGGTCTCCTGGCGCCGGCAGAAAGGTCCCTACAAACTTAAGACCGTAGGTGTGGGGACGAGGCCGTCAGCTG

AGCGAACCTGCGAGCTCCAG - UNI14218 - - UNI35813 - - UNI36562 - CAAGAAAAATTCCTACTGGTTTTAAAGCAAAATGGAGAAG

TACGAGAACCTAGGATTGGTTGGAGAGGGGAGTTACGGAATGGTGATGAAGTGTAGGAACAAAGACAGTGGAAGAATTGTGGCCATTAAGAAGTTCCTAG

AAAGTGACGATGATAAAATGGTTAAGAAGATCGCAATGCGAGAGATCAAGTTACTAAAG - UNI14218 - - UNI35813 - - UNI36562 - C

AACTGCGGCATGAAAATTTGGTGAATCTGTTGGAAGTATGTAAGAAAAAAAAACGTTGGTACCTAGTCTTTGAATTTGTTGACCACACGATTCTTGATGA

CTTGAAACTCTTTCCAAATGGACTAGACTATCAAGTAGTTCAAAAATATTTGTTTCAGATTATTAATGGAATTGGATTTTGCCACAGTCACAAT - UNI

35813 - ATCATACACAGAGATATAAAGCCTGAGAATATATTAGTCTCCCAGTCTGGCGTTGTAAAATTATGTGACTTTGGATTTGCACGGACCCTGGC

GGCTCCAGGGGAGGTTTACACTGACTATGTGGCCACCCGGTGGTACAGAGCTCCAGAACTGCTGGTCGGTGACGTCAAGTATGGCAA - UNI33616 -

 GGCTGTGGATATCTGGGCCATTGGTTGTCTGGTCATTGAAATGCTTATGGGGCAGCCACTGTTTCCAGGAGAATCTGATATTGATCAGCTACATCATAT

TATGACATGTTTAG - UNI33616 - GTAATTTAATTCCAAGACACCAGGAGCTATTTTATAAAAATCCTGTGTTTGCTGGAGTAAGGTTGCCTGAGG

TCAAAGATGCAGAAGCAGAGCCTCTTGAGAGCCGCTATCCTAAGCTCCCTGAAGCTGTGATCAGTTTAGCAAAG - UNI33616 - AAATGCTTGCAC

ATTGACCCAGACAAAAGGCCCTTCTGTGCTGACCTTCTGCGCCATGACTTCTTTCAAATGGATGGATTTGCTGAGAG GTTTTCTCAAGAATTGCAGTTA

AAAATAGAGAAAGATGCCAGGAATAATTCTTTACCTAAAAAGTCTCAAAACAGAAAGAAAGAAAAAGACGATGCCTTAGGTGAAGAAAGAAAAACCCTTG

TGGTACAG GATACCAATGCTGACCCCAAAATTAAGGATTCAAAAGTATTTAAAGTAAAGGGGTCAAAAATTGATGTTGAGAAAATGGAAAAAGGAAGTA

GAGCTTCAAATGCCAACTGTCTCCATGACAATGGGACAAACCACAAAGGCTTGGCTTCCACCAGCCTCAGAGATTGCAGCAATGTCAACATTGATCACTC

AAGGAACCCAGGCACAGCGATTCCTCCCCTCACACACAATCTTTCTGCAGTTGCTCCTGGCATTAATGCTGGAATGGGGACTATTCCTGGCGTTCAGAAT

TACAG AGTGGATGAGAAAACAAAGAAATACTGTAATCCATTTGTTAAACCAAATCAGCCTCCTCCAGCAGGGATTTATAATATGAATGTGAGCACATCC

 GTCTCAGGTGAAAAGTACCTCCTTCAGGCAAACAAGAAAAGGAAGGAATATCCCAAAGCAGACGTGCGGTTGCCTGAACTAAACTATAACCATCTTCCT

GAACTGAGAGCTTTAGAAGGCATAG CTCGAAATTCTAGGCTAATAAAGAAAGAGAACAAATGCCTTTCAGAATCTCGAATTCCCTCTCTGGCTGCCATT

GATCTGCACGTGTCCAGTGTTGCATCACACCAG GGAGCAGGATCACCCCTGTCAGATGATTCTGAGGCTGATTTGCCTCGGATGGAACACCAACACTGA

GACTCATTTTAATCCTGAACAGG ATGCTGCCAGCCCTGGAGATGACGTCCTCTTGCACGAGAGCACTGATACCCTAGAGGAGATCTGCAGTTTGACTGT

TTCCTTCTGGAAACCTATGCTTTCTAAGAAAGGCTTTGTAGAAGAAGGGAAGACAGACTTCCAAAGACTTCAAAGGAAGATTGAACAAGTGCCCCTTCAC

CTTTCCAACCTATGATGCTATTTCAAGATATATCCATGGAACAACAGTGACATGGTTATTGTTACATGAATGTGTATTTGATATTAGTAGATTGTGTATT

TAAAGTTATATGAGATTAAAAGTCAGTAAAAAAAGGAGAGAATCATTATAAAAGGTCATGATTTTATGCATTGAACTTTGTGTATTATCTATATAAATGT

TTACAGATGAAAATGAAAAAAAGCTAGGATCTGTAAGAGAAAAGTTTCCTTTACCTTAACTATAAGAACACATTTTAAAAGTTTGCTTATGGGCATGAGA

GTAGTGTAAGACTGTGGTCGGGCGGGTTAGACGTGCGTCTTTGTTTCCTGTCATTGTCGACTGACTTGTCTCTACAGATCTAAGATCTGTGCTATTGCAA

ATCTGCCAGAGAACCCTTGTTTCTAATGACTGTGCTGTTGGCTAGTCTTCTGTACTGAGAGATTCTGGTGCTAATGTTCTGCATGAAAGGACAAGGTGGG

GGTGGTGTGGGGAGAGTTTTGTGGGTACACCGTTGAGTGAAGAACTTTTTCTCCTTGAGGAAAAACGTATAAAATATAAAAATAAGAGATGGGTGCAGAG

CTGCCTGGCAGTCTGTCTGGTTCTCCTGGCTAGGCCAGTTGCCACTGAGTCACTCAACCAAAGAGGCTTTTGGAGGCTTTGATGGAGTCCACTCTTGTCT

CTGATAGTTTGAGGTTGATAGTGGACAAACCACAGAAGTTCCTATTGCCCTGTTACCTCAGATACTTAGCCTTACCCCAAAGCCTTTTACCAAGGTGGGA

AGTCATCATGTGTGCTCCACATATGCTTTCTGATGTATAGGTTTAAAACCTTTCAGGCAGGAGGATTAGGCCATTTTGATTCCAGGGTCTCAGTGTCTGT

GTTTCCAGCCATGCTCCTCATTGATCATTTGGGAAAATAGCTGTTCAGGGGCCCATATTTGTGTAGTGTTTTTGCATTAGCCAACTAATGGGATCTTTTT

TCTTTTTTAAGCTGTTGACTAGAACTTAGCCTAAGAATTGAACAAGAATTCTTCATTCTGCTGAGGGAAGTAAAAATAAAATCGTAAACTTGGACACTTG

GAGTAGACATTCAGGATGAGGCAAAATAAAGGGTTCTAACATAAAACAAATCTGTTGGTAATAGTTGAATAAATGTTGATTTTTATTCAAAAGCTGTATT

TTAAACCTGTGACCAAGGGTTTGCCTAGATTAGTAAGACTAATATGCTGATAAAACTCACTGTGTCAGTAGTAATAGGCTTTCTACTAAAATACCACTAT

TTATTGTTATTTTGAAAATATTGCCAGCAGCTAGCAGCGTGGGGAGGAGACAGTACTCGAAGCTGATTGGCACCCAGCTAGTTTCAGGGCTGTTCTCATG

TAAAGGCCGACGTGAGAATATCAGCCTGACAACGGAGGGACTGCGTCAGCTACCTTATAATGTGCAGTCTTGAGTTTGCTATCTTTGGCCTATTAAGATA

CTTTATGAACTTTACAGTTAAAAGATTAAAAATCATTTCTTAAGTCCTTATTGATATCTGAAGATCATATTTTGTTAGACCTTGGTGAGGAACTAAAGAA

GTCAATGCTGTTCAGATGAAGTCTCTAGGTACCAAACCAACATGTTCTCTTTTATCAATGCTCGGGTGTTTAGTCTCTTCTCACAGGGATGTGCTTTATG

TAAACATGCTAATGTGAAATCAGTTCATGTACTTTTGGAGACCGTGGGCTTGCTGTGCCCACCTGTGTTTTAAAATTAATAAATATTGTCTAACTAAGCA

CG
Translation
 - UNI14218 - - UNI35813 - - UNI36562 - MEKYENLGLVGEGSYGMVMKCRNKDSGRIVAIKKFLESDDDKMVKKIAMREIKLLK - U

NI14218 - - UNI35813 - - UNI36562 - QLRHENLVNLLEVCKKKKRWYLVFEFVDHTILDDLKLFPNGLDYQVVQKYLFQIINGIGFCHSH

N - UNI35813 - IIHRDIKPENILVSQSGVVKLCDFGFARTLAAPGEVYTDYVATRWYRAPELLVGDVKYGK - UNI33616 - KAVDIWAIGCL

VIEMLMGQPLFPGESDIDQLHHIMTCLG - UNI33616 - GNLIPRHQELFYKNPVFAGVRLPEVKDAEAEPLESRYPKLPEAVISLAK - UNI336

16 - KCLHIDPDKRPFCADLLRHDFFQMDGFAER RFSQELQLKIEKDARNNSLPKKSQNRKKEKDDALGEERKTLVVQ DTNADPKIKDSKVFKVKGS

KIDVEKMEKGSRASNANCLHDNGTNHKGLASTSLRDCSNVNIDHSRNPGTAIPPLTHNLSAVAPGINAGMGTIPGVQNYR RVDEKTKKYCNPFVKPNQP

PPAGIYNMNVSTS VSGEKYLLQANKKRKEYPKADVRLPELNYNHLPELRALEGIA ARNSRLIKKENKCLSESRIPSLAAIDLHVSSVASHQ GAGSPL

SDDSEADLPRMEHQH 
Transcript ENSMUST00000113143
Sequence
AGGCGGGTGAGAGCCGCCCCTTGCAGCTAGGGTGGCCAACGCCTTCGCCTAGGGCTACTTGGCGAGGTGCTGCTTCCCTGAGCTGAGCGACCCGAGGGCT

TTCGGCCGGCGGTGCTCTGTTTTCCTCAGTTCGTTTCTCTGCAGCTGTTGTCCTTGACAGGTGCTTGTGTCTTTGCCTGTCGCAGACGCATTCTGACTCG

GGCCCTTTCTCTCTCTCTGGAGACTGCCTATGGCTGGGGACCGAGTGAGGTCGTTGCCTTGACGACGGCAGCATGCGGCCCGTAGTCCTCGGAAGTGTGA

GCTTGCGGAGGGCAGAAGCCAATCTGCCTCCCTGCCTGCTTCACCTAGGACCGGTAATTGCGTCCGCAGAGGAAATCCCAATACTGGGATTGCTAGTGTG

CTAGCTAGTCAGCATCTTTTTAGATCTGCTAGCGAGATGCATATCACCTTAAATTTGTTTCCAAGTTGAAAACCTTTGGCTCTTTCCATGTGAAGGGTTT

GGAAGAAATA - UNI14218 - - UNI35813 - - UNI36562 - CAAGAAAAATTCCTACTGGTTTTAAAGCAAAATGGAGAAGTACGAGAACC

TAGGATTGGTTGGAGAGGGGAGTTACGGAATGGTGATGAAGTGTAGGAACAAAGACAGTGGAAGAATTGTGGCCATTAAGAAGTTCCTAGAAAGTGACGA

TGATAAAATGGTTAAGAAGATCGCAATGCGAGAGATCAAGTTACTAAAG - UNI14218 - - UNI35813 - - UNI36562 - CAACTGCGGCA

TGAAAATTTGGTGAATCTGTTGGAAGTATGTAAGAAAAAAAAACGTTGGTACCTAGTCTTTGAATTTGTTGACCACACGATTCTTGATGACTTGAAACTC

TTTCCAAATGGACTAGACTATCAAGTAGTTCAAAAATATTTGTTTCAGATTATTAATGGAATTGGATTTTGCCACAGTCACAAT - UNI35813 - AT

CATACACAGAGATATAAAGCCTGAGAATATATTAGTCTCCCAGTCTGGCGTTGTAAAATTATGTGACTTTGGATTTGCACGGACCCTGGCGGCTCCAGGG

GAGGTTTACACTGACTATGTGGCCACCCGGTGGTACAGAGCTCCAGAACTGCTGGTCGGTGACGTCAAGTATGGCAA - UNI33616 - GGCTGTGGA

TATCTGGGCCATTGGTTGTCTGGTCATTGAAATGCTTATGGGGCAGCCACTGTTTCCAGGAGAATCTGATATTGATCAGCTACATCATATTATGACATGT

TTAG - UNI33616 - GTAATTTAATTCCAAGACACCAGGAGCTATTTTATAAAAATCCTGTGTTTGCTGGAGTAAGGTTGCCTGAGGTCAAAGATGC

AGAAGCAGAGCCTCTTGAGAGCCGCTATCCTAAGCTCCCTGAAGCTGTGATCAGTTTAGCAAAG - UNI33616 - AAATGCTTGCACATTGACCCAG

ACAAAAGGCCCTTCTGTGCTGACCTTCTGCGCCATGACTTCTTTCAAATGGATGGATTTGCTGAGAG GTTTTCTCAAGAATTGCAGTTAAAAATAGAGA

AAGATGCCAGGAATAATTCTTTACCTAAAAAGTCTCAAAACAGAAAGAAAGAAAAAGACGATGCCTTAGGTGAAGAAAGAAAAACCCTTGTGGTACAG G

ATACCAATGCTGACCCCAAAATTAAGGATTCAAAAGTATTTAAAGTAAAGGGGTCAAAAATTGATGTTGAGAAAATGGAAAAAGGAAGTAGAGCTTCAAA

TGCCAACTGTCTCCATGACAATGGGACAAACCACAAAGGCTTGGCTTCCACCAGCCTCAGAGATTGCAGCAATGTCAACATTGATCACTCAAGGAACCCA

GGCACAGCGATTCCTCCCCTCACACACAATCTTTCTGCAGTTGCTCCTGGCATTAATGCTGGAATGGGGACTATTCCTGGCGTTCAGAATTACAG AGTG

GATGAGAAAACAAAGAAATACTGTAATCCATTTGTTAAACCAAATCAGCCTCCTCCAGCAGGGATTTATAATATGAATGTGAGCACATCC GTCTCAGGT

GAAAAGTACCTCCTTCAGGCAAACAAGAAAAGGAAGGAATATCCCAAAGCAGACGTGCGGTTGCCTGAACTAAACTATAACCATCTTCCTGAACTGAGAG

CTTTAGAAGGCATAG CTCGAAATTCTAGGCTAATAAAGAAAGAGAACAAATGCCTTTCAGAATCTCGAATTCCCTCTCTGGCTGCCATTGATCTGCACG

TGTCCAGTGTTGCATCACACCAG ATGCTGCCAGCCCTGGAGATGACGTCCTCTTGCACGAGAGCACTGATACCCTAGAGGAGATCTGCAGTTTGACTGT

TTCCTTCTGGAAACCTATGCTTTCTAAGAAAGGCTTTGTAGAAGAAGGGAAGACAGACTTCCAAAGACTTCAAAGGAAGATTGAACAAGTGCCCCTTCAC

CTTTCCAACCTATGATGCTATTTCAAGATATATCCATGGAACAACAGTGACATGGTTATTGTTACATGAATGTGTATTTGATATTAGTAGATTGTGTATT

TAAAGTTATATGAGATTAAAAGTCAGTAAAAAAAGGAGAGAATCATTATAAAAGG
Translation
 - UNI14218 - - UNI35813 - - UNI36562 - MEKYENLGLVGEGSYGMVMKCRNKDSGRIVAIKKFLESDDDKMVKKIAMREIKLLK - U

NI14218 - - UNI35813 - - UNI36562 - QLRHENLVNLLEVCKKKKRWYLVFEFVDHTILDDLKLFPNGLDYQVVQKYLFQIINGIGFCHSH

N - UNI35813 - IIHRDIKPENILVSQSGVVKLCDFGFARTLAAPGEVYTDYVATRWYRAPELLVGDVKYGK - UNI33616 - KAVDIWAIGCL

VIEMLMGQPLFPGESDIDQLHHIMTCLG - UNI33616 - GNLIPRHQELFYKNPVFAGVRLPEVKDAEAEPLESRYPKLPEAVISLAK - UNI336

16 - KCLHIDPDKRPFCADLLRHDFFQMDGFAER RFSQELQLKIEKDARNNSLPKKSQNRKKEKDDALGEERKTLVVQ DTNADPKIKDSKVFKVKGS

KIDVEKMEKGSRASNANCLHDNGTNHKGLASTSLRDCSNVNIDHSRNPGTAIPPLTHNLSAVAPGINAGMGTIPGVQNYR RVDEKTKKYCNPFVKPNQP

PPAGIYNMNVSTS VSGEKYLLQANKKRKEYPKADVRLPELNYNHLPELRALEGIA ARNSRLIKKENKCLSESRIPSLAAIDLHVSSVASHQ MLPALE

MTSSCTRALIP
Transcript ENSMUST00000069937
Sequence
CCCGCCGCGCCGCGGGCGGGCAAGCTGGGAAATCTCATGGTCTCCTCAGTCCCAGCGAACCGTCACCTTGGCTCTCCTCGTGGCCACTGGGGCAACCTGC

GGTCCCCTGAGAGCAGAGGTCTCCTGGCGCCGGCAGAAAGGTCCCTACAAACTTAAGACCGTAGGTGTGGGGACGAGGCCGTCAGCTGAGCGAACCTGCG

AGCTCCAG - UNI14218 - - UNI35813 - - UNI36562 - CAAGAAAAATTCCTACTGGTTTTAAAGCAAAATGGAGAAGTACGAGAACCTA

GGATTGGTTGGAGAGGGGAGTTACGGAATGGTGATGAAGTGTAGGAACAAAGACAGTGGAAGAATTGTGGCCATTAAGAAGTTCCTAGAAAGTGACGATG

ATAAAATGGTTAAGAAGATCGCAATGCGAGAGATCAAGTTACTAAAG - UNI14218 - - UNI35813 - - UNI36562 - CAACTGCGGCATG

AAAATTTGGTGAATCTGTTGGAAGTATGTAAGAAAAAAAAACGTTGGTACCTAGTCTTTGAATTTGTTGACCACACGATTCTTGATGACTTGAAACTCTT

TCCAAATGGACTAGACTATCAAGTAGTTCAAAAATATTTGTTTCAGATTATTAATGGAATTGGATTTTGCCACAGTCACAAT - UNI35813 - ATCA

TACACAGAGATATAAAGCCTGAGAATATATTAGTCTCCCAGTCTGGCGTTGTAAAATTATGTGACTTTGGATTTGCACGGACCCTGGCGGCTCCAGGGGA

GGTTTACACTGACTATGTGGCCACCCGGTGGTACAGAGCTCCAGAACTGCTGGTCGGTGACGTCAAGTATGGCAA - UNI33616 - GGCTGTGGATA

TCTGGGCCATTGGTTGTCTGGTCATTGAAATGCTTATGGGGCAGCCACTGTTTCCAGGAGAATCTGATATTGATCAGCTACATCATATTATGACATGTTT

AG - UNI33616 - GTAATTTAATTCCAAGACACCAGGAGCTATTTTATAAAAATCCTGTGTTTGCTGGAGTAAGGTTGCCTGAGGTCAAAGATGCAG

AAGCAGAGCCTCTTGAGAGCCGCTATCCTAAGCTCCCTGAAGCTGTGATCAGTTTAGCAAAG - UNI33616 - AAATGCTTGCACATTGACCCAGAC

AAAAGGCCCTTCTGTGCTGACCTTCTGCGCCATGACTTCTTTCAAATGGATGGATTTGCTGAGAG GTTTTCTCAAGAATTGCAGTTAAAAATAGAGAAA

GATGCCAGGAATAATTCTTTACCTAAAAAGTCTCAAAACAGAAAGAAAGAAAAAGACGATGCCTTAGGTGAAGAAAGAAAAACCCTTGTGGTACAG GAT

ACCAATGCTGACCCCAAAATTAAGGATTCAAAAGTATTTAAAGTAAAGGGGTCAAAAATTGATGTTGAGAAAATGGAAAAAGGAAGTAGAGCTTCAAATG

CCAACTGTCTCCATGACAATGGGACAAACCACAAAGGCTTGGCTTCCACCAGCCTCAGAGATTGCAGCAATGTCAACATTGATCACTCAAGGAACCCAGG

CACAGCGATTCCTCCCCTCACACACAATCTTTCTGCAGTTGCTCCTGGCATTAATGCTGGAATGGGGACTATTCCTGGCGTTCAGAATTACAG AGTGGA

TGAGAAAACAAAGAAATACTGTAATCCATTTGTTAAACCAAATCAGCCTCCTCCAGCAGGGATTTATAATATGAATGTGAGCACATCC GTCTCAGGTGA

AAAGTACCTCCTTCAGGCAAACAAGAAAAGGAAGGAATATCCCAAAGCAGACGTGCGGTTGCCTGAACTAAACTATAACCATCTTCCTGAACTGAGAGCT

TTAGAAGGCATAG CTCGAAATTCTAGGCTAATAAAGAAAGAGAACAAATGCCTTTCAGAATCTCGAATTCCCTCTCTGGCTGCCATTGATCTGCACGTG

TCCAGTGTTGCATCACACCAG ATGCTGCCAGCCCTGGAGATGACGTCCTCTTGCACGAGAGCACTGATACCCTAGAGGAGATCTGCAGTTTGACTGTTT

CCTTCTGGAAACCTATGCTTTCTAAGAAAGGCTTTGTAGAAGAAGGGAAGACAGACTTCCAAAGACTTCAAAGGAAGATTGAACAAGTGCCCCTTCACCT

TTCCAACCTATGATGCTATTTCAAGATATATCCATGGAACAACAGTGACATGGTTATTGTTACATGAATGTGTATTTGATATTAGTAGATTGTGTATTTA

AAGTTATATGAGATTAAAAGTCAGTAAAAAAAGGAGAGAATCATTATAAAAGGTCATGATTTTATGCATTGAACTTTGTGTATTATCTATATAAATGTTT

ACAGATGAAAATGAAAAAAAGCTAGGATCTGTAAGAGAAAAGTTTCCTTTACCTTAACTATAAGAACACATTTTAAAAGTTTGCTTATGGGCATGAGAGT

AGTGTAAGACTGTGGTCGGGCGGGTTAGACGTGCGTCTTTGTTTCCTGTCATTGTCGACTGACTTGTCTCTACAGATCTAAGATCTGTGCTATTGCAAAT

CTGCCAGAGAACCCTTGTTTCTAATGACTGTGCTGTTGGCTAGTCTTCTGTACTGAGAGATTCTGGTGCTAATGTTCTGCATGAAAGGACAAGGTGGGGG

TGGTGTGGGGAGAGTTTTGTGGGTACACCGTTGAGTGAAGAACTTTTTCTCCTTGAGGAAAAACGTATAAAATATAAAAATAAGAGATGGGTGCAGAGCT

GCCTGGCAGTCTGTCTGGTTCTCCTGGCTAGGCCAGTTGCCACTGAGTCACTCAACCAAAGAGGCTTTTGGAGGCTTTGATGGAGTCCACTCTTGTCTCT

GATAGTTTGAGGTTGATAGTGGACAAACCACAGAAGTTCCTATTGCCCTGTTACCTCAGATACTTAGCCTTACCCCAAAGCCTTTTACCAAGGTGGGAAG

TCATCATGTGTGCTCCACATATGCTTTCTGATGTATAGGTTTAAAACCTTTCAGGCAGGAGGATTAGGCCATTTTGATTCCAGGGTCTCAGTGTCTGTGT

TTCCAGCCATGCTCCTCATTGATCATTTGGGAAAATAGCTGTTCAGGGGCCCATATTTGTGTAGTGTTTTTGCATTAGCCAACTAATGGGATCTTTTTTC

TTTTTTAAGCTGTTGACTAGAACTTAGCCTAAGAATTGAACAAGAATTCTTCATTCTGCTGAGGGAAGTAAAAATAAAATCGTAAACTTGGACACTTGGA

GTAGACATTCAGGATGAGGCAAAATAAAGGGTTCTAACATAAAACAAATCTGTTGGTAATAGTTGAATAAATGTTGATTTTTATTCAAAAGCTGTATTTT

AAACCTGTGACCAAGGGTTTGCCTAGATTAGTAAGACTAATATGCTGATAAAACTCACTGTGTCAGTAGTAATAGGCTTTCTACTAAAATACCACTATTT

ATTGTTATTTTGAAAATATTGCCAGCAGCTAGCAGCGTGGGGAGGAGACAGTACTCGAAGCTGATTGGCACCCAGCTAGTTTCAGGGCTGTTCTCATGTA

AAGGCCGACGTGAGAATATCAGCCTGACAACGGAGGGACTGCGTCAGCTACCTTATAATGTGCAGTCTTGAGTTTGCTATCTTTGGCCTATTAAGATACT

TTATGAACTTTACAGTTAAAAGATTAAAAATCATTTCTTAAGTCCTTATTGATATCTGAAGATCATATTTTGTTAGACCTTGGTGAGGAACTAAAGAAGT

CAATGCTGTTCAGATGAAGTCTCTAGGTACCAAACCAACATGTTCTCTTTTATCAATGCTCGGGTGTTTAGTCTCTTCTCACAGGGATGTGCTTTATGTA

AACATGCTAATGTGAAATCAGTTCATGTACTTTTGGAGACCGTGGGCTTGCTGTGCCCACCTGTGTTTTAAAATTAATAAATATTGTCTAACTAAGCACG

ATATATGGCTTTAATTCATATTAAGAGATTATAAGTAATATACATACCAGTGTATGGTACTAATAAATAAAATTGAAATAGT
Translation
 - UNI14218 - - UNI35813 - - UNI36562 - MEKYENLGLVGEGSYGMVMKCRNKDSGRIVAIKKFLESDDDKMVKKIAMREIKLLK - U

NI14218 - - UNI35813 - - UNI36562 - QLRHENLVNLLEVCKKKKRWYLVFEFVDHTILDDLKLFPNGLDYQVVQKYLFQIINGIGFCHSH

N - UNI35813 - IIHRDIKPENILVSQSGVVKLCDFGFARTLAAPGEVYTDYVATRWYRAPELLVGDVKYGK - UNI33616 - KAVDIWAIGCL

VIEMLMGQPLFPGESDIDQLHHIMTCLG - UNI33616 - GNLIPRHQELFYKNPVFAGVRLPEVKDAEAEPLESRYPKLPEAVISLAK - UNI336

16 - KCLHIDPDKRPFCADLLRHDFFQMDGFAER RFSQELQLKIEKDARNNSLPKKSQNRKKEKDDALGEERKTLVVQ DTNADPKIKDSKVFKVKGS

KIDVEKMEKGSRASNANCLHDNGTNHKGLASTSLRDCSNVNIDHSRNPGTAIPPLTHNLSAVAPGINAGMGTIPGVQNYR RVDEKTKKYCNPFVKPNQP

PPAGIYNMNVSTS VSGEKYLLQANKKRKEYPKADVRLPELNYNHLPELRALEGIA ARNSRLIKKENKCLSESRIPSLAAIDLHVSSVASHQ MLPALE

MTSSCTRALIP

For any suggestions or comments, please send an email to unitrap@crg.es