Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000029405 (G3bp2)
Chromosomal location
Chr 5: 92483540 - 92512684 (-)
Description
GTPase activating protein (SH3 domain) binding protein 2 Gene [Source:MGI Symbol;Acc:MGI:2442040]
RefSeq_dna
NM_001080795 NM_001080796 
RefSeq_peptide
NP_001074266.1 NP_035946.2 NP_001074263.1 NP_001074264.1 NP_001074265.1 
UniGene
Mm.290530 
MGI
MGI:2442040 
Uniprot/SWISSPROT
P97379 
Uniprot/SPTREMBL
Q3TEL4 Q3U541 Q3U6B1 Q5DU21 Q3U931 Q542W3 
Human Ortholog
ENSG00000138757 (G3BP2)
Omim not available
UniTrap UNI5169
Vector Insertion
Chr 5: 92502305 - 92512554
Public Clones (sanger) YTC087 (baygenomics) YTC145 (baygenomics) D028G04 (ggtc)
P117D02 (ggtc) P137C11 (ggtc) E038G01 (ggtc) D037A09 (ggtc) D008A01 (ggtc)
D022E11 (ggtc) W205F08 (ggtc) P117D03 (ggtc) D068C09 (ggtc) D048G08 (ggtc)
P117E02 (ggtc) P106E01 (ggtc) D044H08 (ggtc) D022D04 (ggtc) D019B12 (ggtc)
P062F05 (ggtc) P136C06 (ggtc) D144F01 (ggtc) W176C03 (ggtc) P116A07 (ggtc)
D027B06 (ggtc) P106B09 (ggtc) P151F03 (ggtc) D038G09 (ggtc) 5SP115G02 (ggtc)
D019H10 (ggtc) P079G07 (ggtc) D099E09 (ggtc) D029B05 (ggtc) P114D06 (ggtc)
P109A06 (ggtc) D023F12 (ggtc) PST11251-NR (escells) PST23807-NR (escells)
PST8654-NR (escells) PST11396-NR (escells) PST10778-NR (escells) PST21755-NR (escells)
PST2212-NR (escells) PST10280-NL (escells) PST1279-2 (escells) PST19040-NR (escells)
PST15601-NR (escells) PST510-1 (escells) Ayu21-T18 (egtc) IST10091C3 (tigm)
IST10073G5 (tigm) IST14758A5 (tigm) IST10456C9 (tigm) IST13044B4 (tigm)
IST14223C10 (tigm)
Private Clones OST450178 (lexicon) OST449103 (lexicon) OST440825 (lexicon) OST411112 (lexicon)
OST374919 (lexicon) OST351852 (lexicon) OST332651 (lexicon) OST320380 (lexicon)
OST311565 (lexicon) OST302992 (lexicon) OST302321 (lexicon) OST301959 (lexicon)
OST298996 (lexicon) OST289156 (lexicon) OST286405 (lexicon) OST282683 (lexicon)
OST281858 (lexicon) OST274270 (lexicon) OST274211 (lexicon) OST267340 (lexicon)
OST266479 (lexicon) OST262174 (lexicon) OST259444 (lexicon) OST251139 (lexicon)
OST250415 (lexicon) OST250411 (lexicon) OST250409 (lexicon) OST250163 (lexicon)
OST246652 (lexicon) OST246087 (lexicon) OST240449 (lexicon) OST240208 (lexicon)
OST239861 (lexicon) OST237776 (lexicon) OST237422 (lexicon) OST224563 (lexicon)
OST223257 (lexicon) OST220707 (lexicon) OST218248 (lexicon) OST217486 (lexicon)
OST214252 (lexicon) OST214080 (lexicon) OST211584 (lexicon) OST210899 (lexicon)
OST208695 (lexicon) OST207807 (lexicon) OST205493 (lexicon) OST204534 (lexicon)
OST197670 (lexicon) OST195851 (lexicon) OST194765 (lexicon) OST192681 (lexicon)
OST191564 (lexicon) OST187004 (lexicon) OST182201 (lexicon) OST179558 (lexicon)
OST170961 (lexicon) OST157539 (lexicon) OST154048 (lexicon) OST148183 (lexicon)
OST130689 (lexicon) OST122236 (lexicon) OST116819 (lexicon) OST104602 (lexicon)
OST87725 (lexicon) OST68905 (lexicon) OST67920 (lexicon) OST67916 (lexicon)
OST41947 (lexicon) OST40387 (lexicon) OST39070 (lexicon) OST36604 (lexicon)
OST7987 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17514
Vector Insertion
Chr 5: 92499465 - 92502185
Public Clones not available
Private Clones OST441271 (lexicon) OST346002 (lexicon) OST308285 (lexicon) OST277606 (lexicon)
OST250413 (lexicon) OST239329 (lexicon) OST232464 (lexicon) OST208885 (lexicon)
OST208074 (lexicon) OST205668 (lexicon) OST185037 (lexicon) OST184541 (lexicon)
OST178901 (lexicon) OST167155 (lexicon) OST106100 (lexicon) OST47427 (lexicon)
OST36462 (lexicon)
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23760
Vector Insertion
Chr 5: 92497525 - 92499382
Public Clones not available
Private Clones OST245756 (lexicon) OST235610 (lexicon) OST71454 (lexicon) OST46425 (lexicon)
Severity of mutation (?) Insertion after 12% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12936
Vector Insertion
Chr 5: 92495609 - 92497350
Public Clones CMHD-GT_355C2-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 24% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19043
Vector Insertion
Chr 5: 92494881 - 92495517
Public Clones not available
Private Clones OST406452 (lexicon) OST289910 (lexicon) OST284320 (lexicon) OST233456 (lexicon)
OST9117 (lexicon)
Severity of mutation (?) Insertion after 31% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23824
Vector Insertion
Chr 5: 92493532 - 92494777
Public Clones not available
Private Clones OST243618 (lexicon)
Severity of mutation (?) Insertion after 38% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3198
Vector Insertion
Chr 5: 92492462 - 92493350
Public Clones XR0064 (sanger) AH0033 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 50% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27609
Vector Insertion
Chr 5: 92487097 - 92492362
Public Clones not available
Private Clones OST55267 (lexicon)
Severity of mutation (?) Insertion after 57% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15246
Vector Insertion
Chr 5: 92485294 - 92487097
Public Clones (sanger) PST10321-NL (escells) PST1173-2 (escells) PST4899-NL (escells)
PST2966-NR (escells)
Private Clones OST463234 (lexicon)
Severity of mutation (?) Insertion after 64% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000031352
Sequence
GGGGCCCCGAGCTCGCGGCTCTCCGGATTCCGAAGCCTCGGGTTGCTTCGAGGGAGGAGAATCTGCTGCGGCCGATCCCGCGACACTACTGACCTCCGCG

CGACGTGCCCGCCGCCGCTGTTGGTTGGAG - UNI5169 - CATTTGACATTGTGCAGCAAAGAAATGGTTATGGAGAAGCCCAGTCCGCTGCTTGTG

GGGCGGGAGTTTGTGAGGCAATATTATACTTTGCTGAATAAAGCTCCCGAGTATTTGCACAG - UNI17514 - GTTCTATGGCAGGAATTCCTCCTA

TGTTCATGGTGGAGTGGATGCCAGTGGAAAGCCCCAGGAAGCAGTTTATGGCCAAAAT - UNI23760 - GATATACACCACAAAGTGTTATCTCTGA

ACTTCAGTGAATGTCATACCAAAATTCGTCATGTGGATGCTCATGCAACCTTGAGTGATGGTGTAGTGGTACAGGTCATGGGCTTGCTGTCTAACAGTGG

ACAGCCTGAGAGGAAGTTTATGCAAACCTTTGTTCTGGCTCCAGAA - UNI12936 - GGATCTGTTCCAAATAAATTTTATGTTCACAATGATATGT

TTCGTTATGAAGATGAAGTGTTTGGTGATTCTGAACCAGAACTTGATGAAG - UNI19043 - AGTCAGAAGATGAAGTGGAAGAGGAGCAAGAAGAC

AGGCAGCCGTCTCCTGAACCTGTGCAAGAGAATGCTAACAGCGCTTACTATGACGCACACCCCGTGAC - UNI23824 - TAATGGCATAGAGGAGCC

TTTAGAAGAATCCTCTCATGAACCTGAGCCTGAGCCAGAATCTGAAACAAAGACTGAAGAGCTGAAACCACAAGTGGAGGAGAAACACTTGGAAGAGCTG

GAGGAGAAGTCGGCCACTCCTCCTCCTGCTGAGCCTGCTTCTCTGCCTCAGGAACCGCCAAAG - UNI3198 - GCTTTCTCCTGGGCTTCAGTGACC

AGTAAAAACCTGCCTCCTAGTGGTACTGTTTCTTCCTCTGGAATTCCACCCCATGTTAAAGCACCAGTCTCACAG - UNI15246 - - UNI27609 

- CCGAGGGTTGATGCTAAGCCAGAAGTTCAGTCTCAGCCACCGCGTGTACGGGAACAGCGACCTCGAGAGCGGCCTGGTTTCCCTCCTCGAGGACCAAG

GCCAG - UNI15246 - GCAGAGGAGATATGGAACAGAATGACTCTGACAACCGGAGAATAATTCGCTATCCGGACAGTCATCAGCTTTTCGTTGGTA

ACTTGCCTCATGATATTGATGAAAATGAACTGAAAGAATTCTTTATGA - UNI15246 - GTTTTGGAAACGTTGTGGAACTTCGCATCAATACCAAG

GGTGTTGGGGGAAAACTTCCAAATTTTGGTTTTGTGGTTTTTGATGACTCTGAACCAGTTCAGAGAATCTTAATTGCAAAA CCAATTATGTTTCGAGGA

GAAGTACGTTTAAATGTGGAAGAGAAAAAAACAAGAGCTGCCAGAGAGCGAGAAACCAGAGGTGGTGGCGATGACCGCAGGGATATCAGGCGCAATGATC

GGGGTCCTGGTGGTCCACGTGGAATTGTGGGTGGTGGAATGATGCGTGATCGTGACGGAAGAGGGCCACCTCCACGAGGTGGCATGACACAGAAACTTGG

TTCTGGAAGAGGAACCGGGCAAATGGAAGGTCGCTTCACAGGACAGCGTCGTTGAAGTCCCACTGTTGGCAGTTTTGGCAGTGGTACCTAACTCATCGTG

TTTGCATTCTTGTTAAGTTTTTTTGGCTTTGGAATGTGACACAGCCTTTTTGATCATTTCTTTGATGTGAAAAGCATCTTTTGGTTATCAGTTAAATTGA

GGTGGACATTATTTCCCCAATTTCACAACAGGATTCATATTGTTAATTTATAAAGCTAGACTTGGAGAATTAAGGACTGAGAAATGACCATATCTTAAAC

TGTCTACAACAAAATGAACTTT
Translation
 - UNI5169 - MVMEKPSPLLVGREFVRQYYTLLNKAPEYLHR - UNI17514 - RFYGRNSSYVHGGVDASGKPQEAVYGQN - UNI23760 -

 DIHHKVLSLNFSECHTKIRHVDAHATLSDGVVVQVMGLLSNSGQPERKFMQTFVLAPE - UNI12936 - GSVPNKFYVHNDMFRYEDEVFGDSEPE

LDEE - UNI19043 - ESEDEVEEEQEDRQPSPEPVQENANSAYYDAHPVT - UNI23824 - TNGIEEPLEESSHEPEPEPESETKTEELKPQVE

EKHLEELEEKSATPPPAEPASLPQEPPK - UNI3198 - AFSWASVTSKNLPPSGTVSSSGIPPHVKAPVSQ - UNI15246 - - UNI27609 -

 PRVDAKPEVQSQPPRVREQRPRERPGFPPRGPRPG - UNI15246 - GRGDMEQNDSDNRRIIRYPDSHQLFVGNLPHDIDENELKEFFMS - UNI

15246 - SFGNVVELRINTKGVGGKLPNFGFVVFDDSEPVQRILIAK PIMFRGEVRLNVEEKKTRAARERETRGGGDDRRDIRRNDRGPGGPRGIVGG

GMMRDRDGRGPPPRGGMTQKLGSGRGTGQMEGRFTGQRR
Transcript ENSMUST00000113127
Sequence
GGGGCCCCGAGCTCGCGGCTCTCCGGATTCCGAAGCCTCGGGTTGCTTCGAGGGAGGAGAATCTGCTGCGGCCGATCCCGCGACACTACTGACCTCCGCG

CGACGTGCCCGCCGCCGCTGTTGGTTGGAG - UNI5169 - CATTTGACATTGTGCAGCAAAGAAATGGTTATGGAGAAGCCCAGTCCGCTGCTTGTG

GGGCGGGAGTTTGTGAGGCAATATTATACTTTGCTGAATAAAGCTCCCGAGTATTTGCACAG - UNI17514 - GTTCTATGGCAGGAATTCCTCCTA

TGTTCATGGTGGAGTGGATGCCAGTGGAAAGCCCCAGGAAGCAGTTTATGGCCAAAAT - UNI23760 - GATATACACCACAAAGTGTTATCTCTGA

ACTTCAGTGAATGTCATACCAAAATTCGTCATGTGGATGCTCATGCAACCTTGAGTGATGGTGTAGTGGTACAGGTCATGGGCTTGCTGTCTAACAGTGG

ACAGCCTGAGAGGAAGTTTATGCAAACCTTTGTTCTGGCTCCAGAA - UNI12936 - GGATCTGTTCCAAATAAATTTTATGTTCACAATGATATGT

TTCGTTATGAAGATGAAGTGTTTGGTGATTCTGAACCAGAACTTGATGAAG - UNI19043 - AGTCAGAAGATGAAGTGGAAGAGGAGCAAGAAGAC

AGGCAGCCGTCTCCTGAACCTGTGCAAGAGAATGCTAACAGCGCTTACTATGACGCACACCCCGTGAC - UNI23824 - TAATGGCATAGAGGAGCC

TTTAGAAGAATCCTCTCATGAACCTGAGCCTGAGCCAGAATCTGAAACAAAGACTGAAGAGCTGAAACCACAAGTGGAGGAGAAACACTTGGAAGAGCTG

GAGGAGAAGTCGGCCACTCCTCCTCCTGCTGAGCCTGCTTCTCTGCCTCAGGAACCGCCAAAG - UNI3198 - - UNI15246 - - UNI27609 

- CCGAGGGTTGATGCTAAGCCAGAAGTTCAGTCTCAGCCACCGCGTGTACGGGAACAGCGACCTCGAGAGCGGCCTGGTTTCCCTCCTCGAGGACCAAG

GCCAG - UNI15246 - GCAGAGGAGATATGGAACAGAATGACTCTGACAACCGGAGAATAATTCGCTATCCGGACAGTCATCAGCTTTTCGTTGGTA

ACTTGCCTCATGATATTGATGAAAATGAACTGAAAGAATTCTTTATGA - UNI15246 - GTTTTGGAAACGTTGTGGAACTTCGCATCAATACCAAG

GGTGTTGGGGGAAAACTTCCAAATTTTGGTTTTGTGGTTTTTGATGACTCTGAACCAGTTCAGAGAATCTTAATTGCAAAA CCAATTATGTTTCGAGGA

GAAGTACGTTTAAATGTGGAAGAGAAAAAAACAAGAGCTGCCAGAGAGCGAGAAACCAGAGGTGGTGGCGATGACCGCAGGGATATCAGGCGCAATGATC

GGGGTCCTGGTGGTCCACGTGGAATTGTGGGTGGTGGAATGATGCGTGATCGTGACGGAAGAGGGCCACCTCCACGAGGTGGCATGACACAGAAACTTGG

TTCTGGAAGAGGAACCGGGCAAATGGAAGGTCGCTTCACAGGACAGCGTCGTTGAAGTCCCACTGTTGGCAGTTTTGGCAGTGGTACCTAACTCATCGTG

TTTGCATTCTTGTTAAGTTTTTTTGGCTTTGGAATGTGACACAGCCTTTTTGATCATTTCTTTGATGTGAAAAGCATCTTTTGGTTATCAGTTAAATTGA

GGTGGACATTATTTCCCCAATTTCACAACAGGATTCATATTGTTAATTTATAAAGCTAGACTTGGAGAATTAAGGACTGAGAAATGACCATATCTTAAAC

TGTCTACAACAAAATGAACTTT
Translation
 - UNI5169 - MVMEKPSPLLVGREFVRQYYTLLNKAPEYLHR - UNI17514 - RFYGRNSSYVHGGVDASGKPQEAVYGQN - UNI23760 -

 DIHHKVLSLNFSECHTKIRHVDAHATLSDGVVVQVMGLLSNSGQPERKFMQTFVLAPE - UNI12936 - GSVPNKFYVHNDMFRYEDEVFGDSEPE

LDEE - UNI19043 - ESEDEVEEEQEDRQPSPEPVQENANSAYYDAHPVT - UNI23824 - TNGIEEPLEESSHEPEPEPESETKTEELKPQVE

EKHLEELEEKSATPPPAEPASLPQEPPK - UNI3198 - - UNI15246 - - UNI27609 - PRVDAKPEVQSQPPRVREQRPRERPGFPPRGPR

PG - UNI15246 - GRGDMEQNDSDNRRIIRYPDSHQLFVGNLPHDIDENELKEFFMS - UNI15246 - SFGNVVELRINTKGVGGKLPNFGFVV

FDDSEPVQRILIAK PIMFRGEVRLNVEEKKTRAARERETRGGGDDRRDIRRNDRGPGGPRGIVGGGMMRDRDGRGPPPRGGMTQKLGSGRGTGQMEGRF

TGQRR

For any suggestions or comments, please send an email to unitrap@crg.es