Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000029415 (Sdad1)
Chromosomal location
Chr 5: 92713036 - 92739050 (-)
Description
SDA1 domain containing 1 Gene [Source:MGI Symbol;Acc:MGI:2140779]
RefSeq_dna
NM_172713 
RefSeq_peptide
NP_766301.1 
UniGene
Mm.86564 Mm.400806 
MGI
MGI:2140779 
Uniprot/SWISSPROT
Q80UZ2 
Human Ortholog
ENSG00000198301 (SDAD1)
Omim not available
UniTrap UNI21770
Vector Insertion
Chr 5: 92734864 - 92738817
Public Clones IST12292H11 (tigm) IST12292G11 (tigm)
Private Clones OST318519 (lexicon)
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8199
Vector Insertion
Chr 5: 92732982 - 92733998
Public Clones RRH336 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 19% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3105
Vector Insertion
Chr 5: 92729190 - 92730837
Public Clones CH0741 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 34% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12734
Vector Insertion
Chr 5: 92725095 - 92726145
Public Clones W015G08 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 48% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9385
Vector Insertion
Chr 5: 92723048 - 92725036
Public Clones XH155 (baygenomics) W015C08 (ggtc) CMHD-GT_314D12-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 51% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000031364
Sequence
GGTCGGGCAAGCGGCGTGTCCCACGTGCCGTTTCCGGTTACACTGGGACCCACGAGTCTAAGCTGCCGCGGGGCCCGGGCTGCGACTGACAGAGGCGGAC

GTTTTCCAAGCACTGCTCGCCAGGGAGCCCACCCACAGCCACCATGTCCGGCAGGAACAACAACAAGCTGCCCAGCAACCTGCCGCAGTTACAGAACCTG

ATCAAGCGGGACCCGCCGGCCTACGTGGAGGAG - UNI21770 - TTCCTTCAGCAATATAACCACTATAAATCCAATATGGAGATTTTCAAGTTACA

ACCAAATAAGCCCAGCAAAGAGCTGGCAGAGCTGGTGATGTTCATGGCGCAG ATTGGCCAGTGCTACCCGGAGCATCTCAGTAACTTCCCGCAGGAGCT

GAAGGACCTGCTCTCCTACAACCACACTGTCTTAGACCCAGATCTCCGCATG ACGTTTTGCAAAGCCTTGATCTTACTGAGAAACAAGAATCTCATCAA

TCCATCAAGTTTGCTAGAGCTCTTCTTTGAGCTGCTGCGCTGCCACGACAAGCTCCTGCGGAAG - UNI8199 - ACTCTGTACACACACATTGTGAC

TGACATCAAGAACATCAACGCCAAACACAAGAACAACAAAGTGAACGTG GTGCTGCAGAACTTCATGTACACCATGTTGAGAGACAGCAATGCAACCGC

AGCCAAGATGTCCTTGGATGTGATGATCGAACTCTACAGAAGGAACATCTG GAATGATGCCAAAACTGTCAATGTTATCACAACTGCGTGTTTCTCCAA

GATCACCAAG ATATTGGTTGCTGCTTTGACGTTCTTCCTTGGGAAAGATGAGGAAGAGAAGCAGGACAGTGACTCAGAATCCGAG - UNI3105 - G

AGGATGGGCCCACAGCGAGAGACCTGCTGGTGCAGTATGCCACGGGAAAGAAAGGCTCCAAAAACAAGAAGAAGCTGGAAAAGGCGATGAAAGTGCTGAA

G AAGCAAAAGAAGAAGAAGAAACCAGAAGTGTTTAACTTTTCAGCTATTCACTTGATTCATGATCCCCAAG ACTTCGCAGAGAAGCTTCTGAAGCAGC

TGGAGAGCTGTAAGGAGCGGTTTGAGGTGAAGATGATGCTCATGAACCTCATCTCCAGATTGGTGGGCATTCACGAG - UNI12734 - CTTTTCCTC

TTCAACTTCTACCCTTTTGTGCAAAGGTTTCTGCAGCCCCACCAGAGAG - UNI9385 - AAGTCACGAAGATCCTTCTGTTTGCTGCACAAGCCTCT

CATCACCTGGTGCCCCCAGAG ATTATTCAGTCGTTGCTTGTGACGGTGGCCAACAATTTTGTTACTGACAAGAACTCTGGGGAAGTCATGACCGTAGG 

GATCAATGCTATAAAAGAGATCACAGCTCGATGTCCTCTGGCCATGACTGAAGAGCTTCTCCAGGACCTGGCTCAGTATAAGACACACAAAGATAAGA A

TGTGATGATGTCTGCCAGGACTTTGATCCATCTCTTCCGGACATTGAACCCTCAGATGCTGCAGAAGAAGTTCCGG GGTAAACCCACTGAAGCCTCCAT

CGAAGCAAGAATACAAGAATATGGAGAATTAGATGCTAAAGATTACATCCCAGGAGCAGAGGTTCTAGAGCTTGAGAAGGGAGATAATACAGAAGATGAT

GAAG ATGGATGGGAAAGCGCCAGCCTCAGTGAGGAGGAGGAAGAGGATGGTGAGTGGGTTGACGTGCACCACTCTTCTGATGAGGAGCAGCAAGCAATT

 GCCACGAAGCTGGACAGCATGCCCATGGAGGAGCGGAAAGCCAAGGCTGCAGCCATCAGCACCAGTCGAGTTTTAACGCAGGATGACTTCCAGAAAATC

CGCATGGCCCAGATGAAGAAGGAAATGGATGCTGCTCCGGGGAAAGCCCAGAAAAGGAAATACTTAGAAATTGACAGTGACGAGGAGTCCAG GGGTGAA

TTGCTGTCTCTTCGGGACATTGAACGCCTTCATAAAAAGCCCAAGTCTGACAAGGAAACGAGACTAGCAACTGCAATG GCTGGAAGGACAGACCGAAAG

GAGTTTGTGAGGAAGAAAACCAAAATAAACCCATTTTCCAGTTCCACAAACAAAGAGAAGAAAAAGCAGAAGAACTTTATGATGATGCGGTATAGCCAGA

ATGTCCGGTCAAAAACAGCACGGTCCTTCCGGGAGAAGCAG CTAGCACTACGAGATGCACTTCTGAAAAAGAGGAAAAGAATGAAGTAACTTATCAGCA

AATTATCCATTTCCTGCCCCATGCTGTGTGTATCAGCATGCCAAAAATTAGTAAACATTTGTTTACATTAAAGAGTCAAGGAACACTATAATTTGTAAAC

CACAGTAACATTTGTAGCAATTTGGTATTCTTAATTGGGAGGTGGGGCTGGTGGGAATGTGAAATGTAAATAGTAGCAATGTTAAGAAGTGCTGAGTACC

TACTGATTGCTGCTGCCTATGTAGCTGAATGAGCCAGAGCCCTTGACTGAGGGCAGATGTACATACGGTGTTTATAGTAAGCTGTACATAGTTCCCTGGT

GGCAGCTAGTCCGTCTTCCTGGGGTCACTGGGCTCCTGGACTAACTGTGCGGGGATGGGAGTTATTCATGCTCTGCAATCAGGACAGTGTTACAAGAGTA

AGAGGTTCTTACTTGTAAATAGGCTTGCCTGCTCAAACAGGCTCCTGCTGTACAGATTCAGGTAGACAGTTGAGCTCCACTCTTTTATTTTTTTAGTATA

AAGAGTTTTTGCTAAGCTCTCATTTTTTTTAATTGCCTTAAGTCTAAATAGTGATTTTGAAATGCCTAGCAGGGTGTGGTGGCACACACCCATAATCCCA

GCACTTGGGAAGTCAAGGCAGGAGGCTCGTGAGTTTAGAACCAACTTGACATCCTGAGTTAGTTCAGGGCAGCCTGAGCTACGTAATTGAGAAGCAAAGC

TATCTTTGAGCTATCGTTGGGTGGCTGGTTCTCTGCTGCCTGTTGCTGTTGGGGTTTGTTTTCCTTTCTTTCCTGTGCGGGAGGCGAGCCCTGGGCCCTC

TTGCTCACCCTGAGCAGGTTCTCCCTGGGCTTCACCCCACCCCTGAGTGCCTACTCTTCACATGGTTTGATCAGTTCCCGTGCCTTGTTCTCAACCAAAG

CTACAGGTGGTTAGTAGTCAGATGGGTGTGTACCGCGGTGTGTGCTGCTGTTGCCACACGTGAATGCATTGCAGGACCCAGTCTGCATGCAGGCTGCTGG

CTTTAGAAGCAGTTTGATGCCTTTTGCCTCAGACTTCCTAGGTGCTATTGTCATGAGAACAGGTTTGATGTTCACGTTAGAGGAAGGGCAGTCTCTGCCC

CTGGGCTGGAGAGCAACTGCTGCTGGTTGCCTTCCTCTCCATCGATGGCTCTGTTCAGCTTCTGAGGTCGACTTGGGTTTATTTGTCCCTTGCTTTCCCC

AACGGTGCCCAGGTCACTGTAGGGGACTGCCCGTCAGCCTCACCCAGCACTGCTGTGGAGGAAGTTTCTGGTGCCTATCTGTGTGTGTGAGACCTGAAGC

CGTCCCTTGGCCTTCTTCCTGTGTTCCTCACGGGTGTGTGCTCAGGAACCAGCTCTGAGCAGCCGGAGCTCTGAAAGCAGCTGGAGCTCCCAGCCCCTGG

GACTTCAGGCACACAGTACCAAGGCCAGTTCTAGGCTGCTGGGTCATACCCAGGGATTGGCATAGAAATCCAGAATGCCAGCATGCCACATGCATGGCAT

TAGCAAAGTTCACAGGACGCTCTCGCCTGTTCCCTGCAGCATCTCTGGTGCTAGCTAAGGGTCTCCTATGATGTAGAGGGCACAGCAGCTGTTTGAACAT

GAGGATTAACCCCAGCCTGCCACGGTTTCCATCTGTAAATGTTAGACCACCTACCTCTCTTTTAGTAAATTGTGTTTTGGGAGGGTTTTTGTTGTTGTTG

TTTTCCTTATAGTTGCTATGTTTATTTTAACCATCCAACCCAATGTTTAGGCAGCTAGTGTAAAGCCCATATTGAATATCCATTGTGTATAAAGCACTGC

TAGATGTTTGTGTCATGTTGAAACTTATTCCCAATGCGTGTGGTAGGCAGGACCGCACTGTAGAAAACAGTTCCTAAGTCCGGTGGCTACTGGAATAGTT

TTTAAATGTTACAGTTAATGCAAATTTTGTTTTTTGAAAATGTATAATGTATATAGAGTATTACATTGAAATTTCAGTTTAAAATGTATAATGTTTGTAG

AGTATTACGTTGAAATTTCAGTTTAAAACGTTTAATTGTTCTGAGTGTCCTGTTTAAGCTCTTCTAGGTGACATATTTTTAAACTCTCTCTAGATGATGT

TTTCTCCCAAATAGTACCCTCTCGTTCCTTACATGGTTTGGAGTGTATTTCTCGAGATTTAGGGAGGCTTTACCAGGTATGGGGACACACACCTGTAACC

CCAGCACTTGGGAGAATGAGGCAGGCAGTGGGGTGCTCTGGGTTGAGACCACATAGCAAGAGAGCAAAACCCTGTCTGGGGGCTTGGGGGTGGGGTGAGG

ATATGAAATGGGGGAAGAGTAGAGAGAGCTTGACCAAAAGAAGAAAGCTTGCAGCAGCTGGAACTCTGGGTCAGGTCAGAGCTCCGGGATTAAGCCTTTC

CTGTCGTCTCTGCTTCTCACCCATGTGAAGATACAAAGGAAAGCGGAGAGCACAGCAGCTTCAGCCACAGTCAACAGCACAACTCCTCTTCCTATAAGGC

TGTCTGTGTCATTTTCTCCTGCAGATTCTGCTTGTGTGTTTTGACCATCTCATCTCAGTGTATAAGTAGCTAAAGTTTGAAAAGGATTTGTAGCATAATT

CAGTGTACATGTAGGTAATTATAAAAAAATCCAGAAAATGTGCCAAATATTAGGGGGTGGGAGTTGGTGCTGGGATCATGTGTAAGGTGTATTTTCTTTC

TACTTTCTGAGTCTTTCACGGTGTATATGTTTTTACTTAATGTCATTGTGTAAGAAACCAAAAAGTAAAAGTGAGGTGAGAAATAAAGGTCTGTGGCAAA

TCG
Translation
MSGRNNNKLPSNLPQLQNLIKRDPPAYVEE - UNI21770 - FLQQYNHYKSNMEIFKLQPNKPSKELAELVMFMAQ IGQCYPEHLSNFPQELKDLL

SYNHTVLDPDLRM TFCKALILLRNKNLINPSSLLELFFELLRCHDKLLRK - UNI8199 - TLYTHIVTDIKNINAKHKNNKVNV VLQNFMYTMLR

DSNATAAKMSLDVMIELYRRNIW WNDAKTVNVITTACFSKITK ILVAALTFFLGKDEEEKQDSDSESE - UNI3105 - EDGPTARDLLVQYATGK

KGSKNKKKLEKAMKVLK KQKKKKKPEVFNFSAIHLIHDPQD DFAEKLLKQLESCKERFEVKMMLMNLISRLVGIHE - UNI12734 - LFLFNFYP

FVQRFLQPHQRE - UNI9385 - EVTKILLFAAQASHHLVPPE IIQSLLVTVANNFVTDKNSGEVMTVG GINAIKEITARCPLAMTEELLQDLAQY

KTHKDKN NVMMSARTLIHLFRTLNPQMLQKKFR GKPTEASIEARIQEYGELDAKDYIPGAEVLELEKGDNTEDDED DGWESASLSEEEEEDGEWVDV

HHSSDEEQQAI ATKLDSMPMEERKAKAAAISTSRVLTQDDFQKIRMAQMKKEMDAAPGKAQKRKYLEIDSDEESR RGELLSLRDIERLHKKPKSDKET

RLATAM AGRTDRKEFVRKKTKINPFSSSTNKEKKKQKNFMMMRYSQNVRSKTARSFREKQ LALRDALLKKRKRMK

For any suggestions or comments, please send an email to unitrap@crg.es