Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000029428 (Stx2)
Chromosomal location
Chr 5: 129490442 - 129514376 (-)
Description
syntaxin 2 Gene [Source:MGI (curated);Acc:Stx2-001]
RefSeq_dna
NM_007941 
RefSeq_peptide
NP_031967.2 
UniGene
Mm.260716 
MGI
MGI:108059 
Uniprot/SWISSPROT
Q00262 
Uniprot/SPTREMBL
Q3TJ55 Q3TN38 Q80W45 
Human Ortholog
ENSG00000111450 (STX2)
Omim not available
UniTrap UNI32367
Vector Insertion
Chr 5: 129505384 - 129514377
Public Clones IST12775H5 (tigm) IST12234F5 (tigm) IST12852G8 (tigm) IST12234G5 (tigm)
IST12771G1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000100680
Sequence
GAGGCGGCGACGCGGCCACCGGAGAGTGTGCGGCGGGGCAGCTGAGCGGCGGGTGCCCCGCCCTGCTGGCCGGTGGGGATGCGGGACCGGCTGCCCGACC

TCACGGCG - UNI32367 - TGTAGGACAAACGACGATGGAGACACTGCTGTCGTCATTGTGGAGAAGGATCATTTCATGGACGGTTTCTTCCATCAG

 - UNI32367 - GTAGAGGAGATTCGAAGCAGCATAGCCAGGATTGCTCAGCATGTAGAAGACGTGAAGAAGAACCACAGCATCATCCTGTCTGCTCC

AAACCCAGAAGGAA AAATAAAAGAAGAGCTGGAGGACCTGAACAAAGAGATCAAGAAAACTGCTAACAGGATCCGGGGCAAGCTGAAGT CTATTGAGC

AGAGCTGTGATCAGGACGAGAATGGGAACCGAACTTCAGTGGATCTGCGGATACGAAGGACCCAG CACTCGGTGCTGTCACGGAAGTTTGTGGACGTCA

TGACAGAATACAATGAAGCGCAGATCCTGTTCCGGGAGCGAAGCAAAGGCCGCATCCAGCGCCAGCTGGAGATCA CTGGGAGGACCACCACTGACGACG

AGCTGGAAGAGATGCTGGAGAGCGGGAAGCCGTCCATCTTCATCTCGGAT ATTATATCAGATTCACAAATCACTAGGCAAGCTCTCAATGAGATCGAGT

CCCGCCACAAAGACATCATGAAGCTGGAGACCAGCATCCGAGAGCTGCACGAGATGTTCATGGATATGGCCATGTTTGTCGAGACTCAG GGTGAAATGG

TCAACAACATCGAGAGAAATGTGGTGAACTCTGTAGATTACGTGGAACATGCCAAGGAAGAGACGAAGAAAGCCATCAAATACCAGAGCAAGGCCAGGCG

G AAGGTGATGTTCGTCCTCATTTGTGTAGTCACTTTGCTTGTGATCCTTGGAATTATTCTCGCAACAGCATTGTCATAGCAACCGTACCCCAAGAGCTC

TTTGTCCTCGGTGACTCCGACCATACCTGCAGCTTAGTCAGCATCCTGTCCTTCCACGAGTGAACCTCAGACTCCAGGGCTAGCGCCGAGCACTGAGGTT

TTTATTGGTGATGAAGAAGAAAGCACCGCAGAGGTTTCGTACCATGAAACACCGCGAGCCCAGTGGATGCGACATGCCAGCCCAGAGAGCCTGGGTCTCT

CTCAAGGACACCACAGAGATTTCACAACAGTGGCCTTGCCTTGGTAGCTTTGAAATAGGAATGATTGAAAAAGCCTAATTTTTAAAGACAATGTCAGTGT

TAAAAATGTATGTTGTGTGTAATTAGGGTGTGCTCTGCGCTCAGCTGGCAGTGCTGACGAAGAGACTTCGTGCCAGGCCTGATCTCTGTTCATGTCTTGT

TTGCAGAATCATCACAGAACTGTTTTGTAAGGCATCTGTAAGTTAAGTTCCTTAATCTATTAACATCTAAACTCCCTTTCTAAGCTAGACACTGCCTTGT

GAAGGACAATGGGCCAGCCCCGGGCAAGCATGAACACTGCCTTACAGCCCCTCAGGGCCCTTCTATAGTGCCTTCTGGTGACCCTGACTAGGAAGTGTGA

GGGTCTGAAGAGCCTTGAACGTTAGCTCACGGAGGGGACAAGCAGTCACATGCCGCACTCATGTTACTCTTCCTTGTTCATGTGAGCTGATGGAGTCTCA

AGGCAAGGCGACAGTGACGATGGAGCAAACTTGGTGCTCACTAAACTCAAGAGAATGGTCCCGGGTACATAGCCACTCCTGGATGGCACCTGAAGGACCA

GGTCCTCAGCCCAACACCCACGAGTGCCCAGAGTTCCTAAGAAACCATGAAGTGTGGGATAAAGCTGTGCACTGGTTTACACTTGTGAATAGATGGCCCA

GCGACCAAGTATGTGAAGGATACCATGACTAGTGAACTCTGCCAACTGCTGACTGTGATGAGTGCTCACTCTACCCCAGCCTCACTTGGTGGGATATGAT

GTAGCCATGCCGGGTCAGAACACCAAGTGTGAGCAAGTGCTACTGAACTATCTAAAAACCATGATCCTTTCAGTGGTGAGTGTGCCACACTGTCACCTCC

TCACACCTCCTGGTCTGACACCCCATGTGCCGAGAGCTACTGCAGCAGGCTGGGCTGTGGGTCCTGGTCTAGAGTTAGCCTGTAGTGCAGCCACTCCTGG

CTGATAGCTCACCCTTCCTAACTGGGAGCTCACCCTTCCTGCCTGGAAGCTCACACTTCCTGTCTGGGAGCTCACCCTTCTTGCCTGGGAGCTCACACTT

CCTGTCTGGGAGCTCACACTTCCTTCCTGGGAGCTCACACTTCCTGCCTGGGAGCTCACCCTTCCTGCCTGGGAGCTCACACTTCCTGCCTGGGAGCTCT

GAAGATGAACCTGGGCCTTTGCAGCTCACCCTCTCTGCATCAGTCAGTGCCATCGGATTTAGCTGCAGAGACCATGCGTACCACCCAGGCTCCCACCACC

CACAGCCAGGTGTCCCTCCAGTCCAGCCTGAGCCCTTGGCCTGCAGTGTGCTCGCAGAGCGCTCAGGAGACCTCTCGACCAGGCAGGCAGCTGAATCTGG

ATTTCCAGTGAATCAGGGGTGTGTGGGTGACTGAGTCAGCACTCCAGATACATCTCTCTGCTGACTTCATAGCCTATTTAAAAATATATTTACAGATTCC

CTTGTTACCTTTTCCAAGCATTTCTTCAAATATTTTGTGTTTACATTAAAAAGTTCTCAGAGATGC
Translation
MRDRLPDLTA - UNI32367 - CRTNDDGDTAVVIVEKDHFMDGFFHQ - UNI32367 - VEEIRSSIARIAQHVEDVKKNHSIILSAPNPEGK K

IKEELEDLNKEIKKTANRIRGKLKS SIEQSCDQDENGNRTSVDLRIRRTQ HSVLSRKFVDVMTEYNEAQILFRERSKGRIQRQLEIT TGRTTTDDEL

EEMLESGKPSIFISD IISDSQITRQALNEIESRHKDIMKLETSIRELHEMFMDMAMFVETQ GEMVNNIERNVVNSVDYVEHAKEETKKAIKYQSKARR

 KVMFVLICVVTLLVILGIILATALS
Transcript ENSMUST00000031378
Sequence
GAGGCGGCGACGCGGCCACCGGAGAGTGTGCGGCGGGGCAGCTGAGCGGCGGGTGCCCCGCCCTGCTGGCCGGTGGGGATGCGGGACCGGCTGCCCGACC

TCACGGCG - UNI32367 - TGTAGGACAAACGACGATGGAGACACTGCTGTCGTCATTGTGGAGAAGGATCATTTCATGGACGGTTTCTTCCATCAG

 - UNI32367 - GTAGAGGAGATTCGAAGCAGCATAGCCAGGATTGCTCAGCATGTAGAAGACGTGAAGAAGAACCACAGCATCATCCTGTCTGCTCC

AAACCCAGAAGGAA AAATAAAAGAAGAGCTGGAGGACCTGAACAAAGAGATCAAGAAAACTGCTAACAGGATCCGGGGCAAGCTGAAGT CTATTGAGC

AGAGCTGTGATCAGGACGAGAATGGGAACCGAACTTCAGTGGATCTGCGGATACGAAGGACCCAG CACTCGGTGCTGTCACGGAAGTTTGTGGACGTCA

TGACAGAATACAATGAAGCGCAGATCCTGTTCCGGGAGCGAAGCAAAGGCCGCATCCAGCGCCAGCTGGAGATCA CTGGGAGGACCACCACTGACGACG

AGCTGGAAGAGATGCTGGAGAGCGGGAAGCCGTCCATCTTCATCTCGGAT ATTATATCAGATTCACAAATCACTAGGCAAGCTCTCAATGAGATCGAGT

CCCGCCACAAAGACATCATGAAGCTGGAGACCAGCATCCGAGAGCTGCACGAGATGTTCATGGATATGGCCATGTTTGTCGAGACTCAG GGTGAAATGG

TCAACAACATCGAGAGAAATGTGGTGAACTCTGTAGATTACGTGGAACATGCCAAGGAAGAGACGAAGAAAGCCATCAAATACCAGAGCAAGGCCAGGCG

G AAAAAGTGGATAATTGCTGCTGTGGCGGTGGCTGTCATTGCCGTCCTGGCTCTAATCATTGGCTTGTCGGTTGGCAAATGATTGCGTAGATGGCGCTG

GGTGCTTGCCTCTCCCTCAGGGTGGCA AAGGTGATGTTCGTCCTCATTTGTGTAGTCACTTTGCTTGTGATCCTTGGAATTATTCTCGCAACAGCATTG

TCATAGCAACCGTACCCCAAGAGCTCTTTGTCCTCGGTGACTCCGACCATACCTGCAGCTTAGTCAGCATCCTGTCCTTCCACGAGTGAACCTCAGACTC

CAGGGCTAGCGCCGAGCACTGAGGTTTTTATTGGTGATGAAGAAGAAAGCACCGCAGAGGTTTCGTACCATGAAACACCGCGAGCCCAGTGGATGCGACA

TGCCAGCCCAGAGAGCCTGGGTCTCTCTCAAGGACACCACAGAGATTTCACAACAGTGGCCTTGCCTTGGTAGCTTTGAAATAGGAATGATTGAAAAAGC

CTAATTTTTAAAGACAATGTCAGTGTTAAAAATGTATGTTGTGTGTAATTAGGGTGTGCTCTGCGCTCAGCTGGCAGTGCTGACGAAGAGACTTCGTGCC

AGGCCTGATCTCTGTTCATGTCTTGTTTGCAGAATCATCACAGAACTGTTTTGTAAGGCATCTGTAAGTTAAGTTCCTTAATCTATTAACATCTAAACTC

CCTTTCTAAGCTAGACACTGCCTTGTGAAGGACAATGGGCCAGCCCCGGGCAAGCATGAACACTGCCTTACAGCCCCTCAGGGCCCTTCTATAGTGCCTT

CTGGTGACCCTGACTAGGAAGTGTGAGGGTCTGAAGAGCCTTGAACGTTAGCTCACGGAGGGGACAAGCAGTCACATGCCGCACTCATGTTACTCTTCCT

TGTTCATGTGAGCTGATGGAGTCTCAAGGCAAGGCGACAGTGACGATGGAGCAAACTTGGTGCTCACTAAACTCAAGAGAATGGTCCCGGGTACATAGCC

ACTCCTGGATGGCACCTGAAGGACCAGGTCCTCAGCCCAACACCCACGAGTGCCCAGAGTTCCTAAGAAACCATGAAGTGTGGGATAAAGCTGTGCACTG

GTTTACACTTGTGAATAGATGGCCCAGCGACCAAGTATGTGAAGGATACCATGACTAGTGAACTCTGCCAACTGCTGACTGTGATGAGTGCTCACTCTAC

CCCAGCCTCACTTGGTGGGATATGATGTAGCCATGCCGGGTCAGAACACCAAGTGTGAGCAAGTGCTACTGAACTATCTAAAAACCATGATCCTTTCAGT

GGTGAGTGTGCCACACTGTCACCTCCTCACACCTCCTGGTCTGACACCCCATGTGCCGAGAGCTACTGCAGCAGGCTGGGCTGTGGGTCCTGGTCTAGAG

TTAGCCTGTAGTGCAGCCACTCCTGGCTGATAGCTCACCCTTCCTAACTGGGAGCTCACCCTTCCTGCCTGGAAGCTCACACTTCCTGTCTGGGAGCTCA

CCCTTCTTGCCTGGGAGCTCACACTTCCTGTCTGGGAGCTCACACTTCCTTCCTGGGAGCTCACACTTCCTGCCTGGGAGCTCACCCTTCCTGCCTGGGA

GCTCACACTTCCTGCCTGGGAGCTCTGAAGATGAACCTGGGCCTTTGCAGCTCACCCTCTCTGCATCAGTCAGTGCCATCGGATTTAGCTGCAGAGACCA

TGCGTACCACCCAGGCTCCCACCACCCACAGCCAGGTGTCCCTCCAGTCCAGCCTGAGCCCTTGGCCTGCAGTGTGCTCGCAGAGCGCTCAGGAGACCTC

TCGACCAGGCAGGCAGCTGAATCTGGATTTCCAGTGAATCAGGGGTGTGTGGGTGACTGAGTCAGCACTCCAGATACATCTCTCTGCTGACTTCATAGCC

TATTTAAAAATATATTTACAGATTCCCTTGTTACCTTTTCCAAGCATTTCTTCAAATATTTTGTGTTTACATTAAAAAGTTCTCAGAGATGC
Translation
MRDRLPDLTA - UNI32367 - CRTNDDGDTAVVIVEKDHFMDGFFHQ - UNI32367 - VEEIRSSIARIAQHVEDVKKNHSIILSAPNPEGK K

IKEELEDLNKEIKKTANRIRGKLKS SIEQSCDQDENGNRTSVDLRIRRTQ HSVLSRKFVDVMTEYNEAQILFRERSKGRIQRQLEIT TGRTTTDDEL

EEMLESGKPSIFISD IISDSQITRQALNEIESRHKDIMKLETSIRELHEMFMDMAMFVETQ GEMVNNIERNVVNSVDYVEHAKEETKKAIKYQSKARR

 KKWIIAAVAVAVIAVLALIIGLSVGK 

For any suggestions or comments, please send an email to unitrap@crg.es