Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000029463 (1500011H22Rik)
Chromosomal location
Chr 5: 122814595 - 122822330 (-)
Description
RIKEN cDNA 1500011H22 gene Gene [Source:MGI Symbol;Acc:MGI:1916198]
RefSeq_dna
NM_026883 
RefSeq_peptide
NP_081159.1 
UniGene
Mm.474469 
MGI
MGI:1916198 
Uniprot/SWISSPROT
Q9DB54 
Human Ortholog
ENSG00000204856 (C12orf24)
Omim not available
UniTrap UNI34243
Vector Insertion
Chr 5: 122820523 - 122822331
Public Clones IST14296E10 (tigm) IST14601A12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 9% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19371
Vector Insertion
Chr 5: 122819648 - 122820523
Public Clones not available
Private Clones OST393142 (lexicon)
Severity of mutation (?) Insertion after 17% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21223
Vector Insertion
Chr 5: 122814929 - 122816322
Public Clones not available
Private Clones OST337986 (lexicon)
Severity of mutation (?) Insertion after 84% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000031419
Sequence
GAAGGCGGTTGCCTAGGTGATAGCGGATCGCGAATTACGCTCCGCGCCCCCGGGCCGCAGCACCGGTGCTTGGGTTTGACACATAGGGTGACAACCGAAG

GTCTGCAGGTCCTCTGAGGGTCTAGAATACTGAGGTGGATAAGGAATACTTGCTTTAGGGTGCGTGTGGATGGATTTGCCCTGACGCGTCCTTGTCAGCG

AGAGATGCCCAGGCGCAGGAGCCTGGTTACCTGAGGTTCCTCCGCCCTCGGGTCTACAGCTCCAGGAACTCGGGTCTTCCTCCGCACCATCCGGCGGCCA

CTTGAGCAGGGTCGGAGTGGGGAGAGCCGGAGGCCGCCGACTCAGAGCCGGTGTGGTGCACGCGTGTGGACGGGATGCCGAGCCGTTGGCCCGGGGTCGC

GGGGCCGCCCGCCTTGGCCCGGACGGAAGGCGGTGAAGG - UNI34243 - ATCAGCTGGACATTCTTATCCCCAGAATTCCAAGGGCACTGGCGAGC

AGCATAAAGCAG - UNI19371 - - UNI34243 - ACAGAATCAAGGAGGGACACAGAGTGTACGCACACATTGCCAAACTGCAGGAGTTATGGAA

AACTACTCAAATCCAAACAATTCATATCCCTAAATCAATGACAGATGCATCTTTTCTAAAG CATCCAGAGCTCACCTTGGGCCAGAAGCGTTACCTGTG

CAGCGTTGCTAAGATCTGTAACTCCAGCTACCTGAGGACCTTGATGAAGAGGCAGTACATGCACATATTTCATCACGGGTCACAGAAGACAG GTGTGCT

CACTCACCACAGAGGCCATATGAGCTCTCGCTACTCACAGAAACAGCATTCCCCCTGTACTGCATGGAGACACCATCTGGAGAGAGAGGACTCTCTGAGC

ATTGCAGCTGGAGCACCTGAAATGATCATACATTCCCTTTGGCGACCCCTGAGACACAAAGAAGG GTTAAAAATTGGGTATGCATCTAAAACAAGATGC

AAGTCCCTGAAGATTTTTAGAAGACCAGGCAGACTGTTCTTGTTACCAG - UNI21223 - TTCCTTCTAATGATTCTCAGTCATGCCCGAGTGAAGA

AACACAGGAGGAGGATCTGCTGAATAAGTGCATGCAGTCCATGTCCATCCAAGAACAAGGCCCAGCTCACGCCAGCCTGACGGTCTAGTCCTCCACACCA

AGCTCAGCCATCAGCTAACATCCACATGCTGAGTGCACAGGGAAGAGTGGACCATGTATGGGATAGTACTAGTAGTAACGGTATGTTATTTTGGTTGTTG

AGAAATTTATAATAGCCGCCTTCGTCTGATATATTTCTGTGTTAATGTGTAATGTATGCTTGTTTCTAGCTAGAACAATTAAAATTTTACTTGCAAC
Translation
MPSRWPGVAGPPALARTEGGEG - UNI34243 - GSAGHSYPQNSKGTGEQHKAD - UNI19371 - - UNI34243 - DRIKEGHRVYAHIAKL

QELWKTTQIQTIHIPKSMTDASFLK HPELTLGQKRYLCSVAKICNSSYLRTLMKRQYMHIFHHGSQKTG GVLTHHRGHMSSRYSQKQHSPCTAWRHHL

EREDSLSIAAGAPEMIIHSLWRPLRHKEG GLKIGYASKTRCKSLKIFRRPGRLFLLPV - UNI21223 - VPSNDSQSCPSEETQEEDLLNKCMQSM

SIQEQGPAHASLTV

For any suggestions or comments, please send an email to unitrap@crg.es