Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000029467 (Atp2a2)
Chromosomal location
Chr 5: 122903531 - 122952183 (-)
Description
ATPase, Ca++ transporting, cardiac muscle, slow twitch 2 Gene [Source:MGI Symbol;Acc:MGI:88110]
RefSeq_peptide
NP_033852.1 NP_001103610.1 
UniGene
Mm.227583 Mm.412722 
MGI
MGI:88110 
Uniprot/SWISSPROT
O55143 
Uniprot/SPTREMBL
O54994 Q5DTI2 
Human Ortholog
ENSG00000174437 (ATP2A2)
Omim 101900 - ACROKERATOSIS VERRUCIFORMIS  124200 - DARIER-WHITE DISEASE  
UniTrap UNI12156
Vector Insertion
Chr 5: 122950958 - 122951576
Public Clones M073A03 (ggtc) E032F10 (ggtc) D162F10 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26061
Vector Insertion
Chr 5: 122950823 - 122950939
Public Clones not available
Private Clones OST142216 (lexicon)
Severity of mutation (?) Insertion after 5% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23606
Vector Insertion
Chr 5: 122941795 - 122950739
Public Clones CMHD-GT_545G11-3 (cmhd)
Private Clones OST251946 (lexicon) OST84214 (lexicon)
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3831
Vector Insertion
Chr 5: 122939386 - 122941689
Public Clones AX0481 (sanger) F027C03 (ggtc) W087F03 (ggtc) (ggtc) W072E08 (ggtc)
Private Clones OST413744 (lexicon) OST57911 (lexicon)
Severity of mutation (?) Insertion after 11% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1308
Vector Insertion
Chr 5: 122923300 - 122939246
Public Clones DC0140 (sanger) DA0033 (sanger) XE154 (baygenomics) XH001 (baygenomics)
RRD101 (baygenomics) CSH516 (baygenomics) A042E08 (ggtc) F060C06 (ggtc)
PST474-1 (escells) PST8388-NR (escells) PST474-3 (escells) PST10248-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 16% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4240
Vector Insertion
Chr 5: 122919824 - 122921176
Public Clones AK0357 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 21% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21601
Vector Insertion
Chr 5: 122917805 - 122919358
Public Clones not available
Private Clones OST324707 (lexicon)
Severity of mutation (?) Insertion after 37% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2243
Vector Insertion
Chr 5: 122911995 - 122915958
Public Clones AL0473 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 47% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI38306
Vector Insertion
Chr 5: 122909984 - 122910986
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 70% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30327
Vector Insertion
Chr 5: 122909456 - 122910206
Public Clones D005C10 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 77% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18499
Vector Insertion
Chr 5: 122904314 - 122906968
Public Clones (sanger) IST12225A10HMR1 (tigm) IST11449H12 (tigm) IST12397D3 (tigm)
IST14751D7 (tigm)
Private Clones OST422410 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000100740
Sequence
GCCGCAGTTCCCTCCGCCGCCGCTGTCGGGGGTGCAGAGCTGAGGGGCTCGGGCCGGCGCGCCGCGCAGCTCCTCTCCCGTCGCCTGCCTCGCGGTTCCC

GGCGCCGAGGGCTCGGCCCGGCGCCGCTCCTCATCTGCGCCCCGTCTCCTCGGCGCAGCGCCCGGGGCCTGCGCTGCCCGCGGCCGGCTGGCAGCTGCTG

AAGCGACCCACACTCGCGGCGGGGCGGGAGGCTCGCAGTCCCTCGGGCGGGCTCGGCGAGGCCGGGCCGCGTGCGGCGGTTTCTGGGGGAGGGGGCTCGG

GTGATTCAGCGCCCCGGTCAGGCGGAAGCGGCCGCCGCCGCCGCGGAGGAGGAGGAGGAGAAGAAAAAGGAGGGGACAGCTGTCCGCGCCCGGGCGCCCG

CGGTGGCACGAGCCCGCGGCCGGAGTGCGAGGCGGTAGGCGAGGAGGCCGCGGGGACGCGAGGCGAGGCCGGCCGGGGCCCCCGCAGCCATGGAGAACGC

TCACACAAAGACCGTGGAGGAGGTGCTGGGCCACTTCGGGGTCAACGAGAGCACGGGGCTGAGCTTGGAGCAGGTCAAGAAGCTCAAGGAGAGATGGGGC

TCCAACG - UNI12156 - AATTGCCGGCTGAAGAAG - UNI26061 - GAAAAACCTTGCTGGAACTTGTGATTGAGCAGTTTGAAGACTTACTA

GTTAGAATTTTACTGCTGGCAGCATGTATATCTTTC - UNI23606 - GTTTTGGCTTGGTTCGAGGAAGGGGAAGAAACGATTACAGCCTTTGTAGA

GCCGTTTGTAATTCTGCTTATCTTGGTAGCCAATGCAATCGTGGGTGTGTGGCAG - UNI3831 - GAAAGAAATGCTGAAAATGCAATAGAAGCTCT

TAAGGAATATGAGCCTGAAATGGGCAAAGTGTATCGACAGGACAGAAAGAGTGTGCAACGAATTAAAGCTAAAGACATAGTTCCTGGTGATATAGTGGAA

ATTGCTG - UNI1308 - TTGGTGACAAAGTTCCTGCTGATATTAGATTGACATCCATCAAGTCTACAACTCTAAGAGTCGACCAGTCAATTCTTACA

G GTGAATCTGTCTCCGTCATCAAGCATACTGACCCTGTCCCTGACCCCCGAGCTGTTAATCAAGACAAAAAGAACATGCTCTTTTCT - UNI4240 -

 GGTACAAACATTGCTGCTGGGAAAGCTATGGGAGTGGTGGTGGCAACTGGAGTTAATACTGAGATCGGCAAGATCCGGGATGAAATGGTGGCAACAGAA

CAGGAGAGAACACCCCTACAGCAGAAGCTAGACGAGTTTGGGGAGCAGCTTTCCAAAGTTATCTCCCTCATTTGCATTGCAGTCTGGATCATCAACATTG

GGCATTTCAATGACCCAGTTCATGGTGGCTCCTGGATCAGGGGTGCCATCTACTACTTTAAGATTGCCGTGGCCCTGGCTGTTGCCGCAATCCCTGAGGG

TCTGCCTGCTGTCATCACCACCTGCTTAGCTCTTGGAACTCGTAGGATGGCAAAGAAAAATGCTATCGTTCGAAGTCTGCCTTCTGTGGAGACCCTTGGT

TGTACTTCTGTTATCTGCTCAGATAAGACAGGCACACTTACCACAAACCAGATGTCCGTGTGCAGG - UNI21601 - ATGTTCATTCTGGACAAAGT

AGAAGGTGACACTTGTTCCCTTAATGAGTTCAGCATAACTGGATCCACATATGCACCAATTGGAGAAGT GCAAAAGGATGATAAGCCAGTGAAGTGCCA

TCAGTATGACGGGCTTGTAGAGTTAGCCACCATCTGTGCTCTGTGTAATGACTCTGCTTTGGATTATAATGAG GCAAAGGGTGTGTATGAGAAAGTTGG

AGAAGCTACCGAGACTGCTCTCACGTGCCTGGTGGAGAAGATGAATGTATTTGATACTGAGCTGAAGGGGCTTTCTAAAATAGAGCGTGCAAACGCCTGC

AACTCG - UNI2243 - GTCATAAAGCAGCTGATGAAGAAGGAGTTCACTCTGGAGTTTTCACGGGATAGAAAATCAATGTCCGTCTATTGTACCCCA

AACAAGCCAAGCCGGACATCCATGAGCAAGATGTTTGTGAAG GGGGCTCCAGAAGGTGTCATCGATAGGTGCACCCACATCCGAGTTGGAAGTACCAAG

GTCCCCATGACTCCTGGTGTCAAACAGAAGATTATGTCTGTCATTCGGGAGTGGGGCAGTGGCAGCGACACGCTACGGTGCCTGGCTCTGGCCACTCATG

ACAACCCACTGAAGAGAGAGGAGATGCACCTGGAAGACTCTGCTAACTTCATCAAATACGAG ACCAACCTGACTTTCGTCGGCTGTGTGGGCATGCTGG

ATCCTCCCAGGATTGAAGTAGCCTCTTCTGTGAAGCTGTGCCGGCAAGCAGGCATCCGGGTCATCATGATCACTGGAGACAACAAAGGCACCGCTGTGGC

CATCTGTCGCCGCATTGGCATCTTTGGGCAGGATGAGGATGTGACATCAAAGGCTTTTACAGGGCGAGAGTTTGATGAATTAAGCCCTTCAGCCCAGAGA

GATGCCTGCTTAAATGCCCGCTGTTTTGCTCGAGTTGAACCTTCCCACAAGTCTAAGATTGTTGAGTTCCTTCAGTCCTTTGATGAGATCACAGCTATG 

- UNI30327 - ACTGGTGATGGTGTGAATGATGCTCCTGCTCTGAAGAAATCTGAAATCGGGATTGCCATGGGCTCAGGGACTGCAGTGGCTAAGACT

GCTTCTGAGATGGTCCTGGCAGATGACAACTTCTCCACCATTGTGGCTGCTGTTGAGGAGGGGCGAGCCATCTACAACAACATGAAGCAGTTCATCCGCT

ACCTCATCTCATCCAACGTGGGGGAAGTGGTCTG - UNI30327 - TATCTTCCTGACGGCAGCCCTTGGGTTTCCTGAGGCTTTAATTCCTGTCCAG

TTACTCTGGGTCAATCTGGTGACAGATGGTCTGCCTGCCACTGCGCTGGGGTTCAATCCTCCAGACCTGGACATCATGAACAAACCCCCCCGGAACCCAA

AAGAACCACTGATCAGCGGGTGGCTCTTTTTCCGTTACCTGGCTATTGGCT - UNI30327 - GTTATGTTGGCGCTGCCACCGTGGGTGCTGCTGCA

TGGTGGTTCATCGCTGCTGACGGCGGTCCAAGAGTCTCCTTCTACCAGCTG AGTCATTTCCTACAGTGTAAGGAGGACAACCCAGACTTCGATGGAGTG

GATTGTGCAATCTTTGAGTCCCCATATCCAATGACAATGGCACTTTCTGTTCTAGTAACCATAGAGATGTGTAATGCCCTCAACAG CTTGTCTGAAAAC

CAGTCTTTGCTGAGGATGCCCCCCTGGGAGAATATCTGGCTCGTGGGCTCCATCTGCTTGTCCATGTCACTTCACTTCTTGATCCTCTACGTGGAACCTT

TGCCG CTCATTTTCCAGATCACACCGCTGAATCTGACCCAGTGGCTGATGGTGCTGAAAATCTCCTTGCCTGTGATCCTCATGGATGAGACGCTCAAGT

TTGTGGCCCGAAACTACCTGGAACAACCCG ACATAATTAAA
Translation
MENAHTKTVEEVLGHFGVNESTGLSLEQVKKLKERWGSNE - UNI12156 - ELPAEEG - UNI26061 - GKTLLELVIEQFEDLLVRILLLAAC

ISF - UNI23606 - VLAWFEEGEETITAFVEPFVILLILVANAIVGVWQ - UNI3831 - ERNAENAIEALKEYEPEMGKVYRQDRKSVQRIKAK

DIVPGDIVEIAV - UNI1308 - VGDKVPADIRLTSIKSTTLRVDQSILTG GESVSVIKHTDPVPDPRAVNQDKKNMLFS - UNI4240 - GTNI

AAGKAMGVVVATGVNTEIGKIRDEMVATEQERTPLQQKLDEFGEQLSKVISLICIAVWIINIGHFNDPVHGGSWIRGAIYYFKIAVALAVAAIPEGLPAV

ITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCR - UNI21601 - MFILDKVEGDTCSLNEFSITGSTYAPIGEV VQKD

DKPVKCHQYDGLVELATICALCNDSALDYNE AKGVYEKVGEATETALTCLVEKMNVFDTELKGLSKIERANACNS - UNI2243 - VIKQLMKKEFT

LEFSRDRKSMSVYCTPNKPSRTSMSKMFVK GAPEGVIDRCTHIRVGSTKVPMTPGVKQKIMSVIREWGSGSDTLRCLALATHDNPLKREEMHLEDSANF

IKYE TNLTFVGCVGMLDPPRIEVASSVKLCRQAGIRVIMITGDNKGTAVAICRRIGIFGQDEDVTSKAFTGREFDELSPSAQRDACLNARCFARVEPSH

KSKIVEFLQSFDEITAM - UNI30327 - TGDGVNDAPALKKSEIGIAMGSGTAVAKTASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNV

GEVVC - UNI30327 - CIFLTAALGFPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMNKPPRNPKEPLISGWLFFRYLAIGC - UNI30327 

- CYVGAATVGAAAWWFIAADGGPRVSFYQL SHFLQCKEDNPDFDGVDCAIFESPYPMTMALSVLVTIEMCNALNS SLSENQSLLRMPPWENIWLVGS

ICLSMSLHFLILYVEPLP LIFQITPLNLTQWLMVLKISLPVILMDETLKFVARNYLEQPD DIIK
Transcript ENSMUST00000031423
Sequence
GCCGCAGTTCCCTCCGCCGCCGCTGTCGGGGGTGCAGAGCTGAGGGGCTCGGGCCGGCGCGCCGCGCAGCTCCTCTCCCGTCGCCTGCCTCGCGGTTCCC

GGCGCCGAGGGCTCGGCCCGGCGCCGCTCCTCATCTGCGCCCCGTCTCCTCGGCGCAGCGCCCGGGGCCTGCGCTGCCCGCGGCCGGCTGGCAGCTGCTG

AAGCGACCCACACTCGCGGCGGGGCGGGAGGCTCGCAGTCCCTCGGGCGGGCTCGGCGAGGCCGGGCCGCGTGCGGCGGTTTCTGGGGGAGGGGGCTCGG

GTGATTCAGCGCCCCGGTCAGGCGGAAGCGGCCGCCGCCGCCGCGGAGGAGGAGGAGGAGAAGAAAAAGGAGGGGACAGCTGTCCGCGCCCGGGCGCCCG

CGGTGGCACGAGCCCGCGGCCGGAGTGCGAGGCGGTAGGCGAGGAGGCCGCGGGGACGCGAGGCGAGGCCGGCCGGGGCCCCCGCAGCCATGGAGAACGC

TCACACAAAGACCGTGGAGGAGGTGCTGGGCCACTTCGGGGTCAACGAGAGCACGGGGCTGAGCTTGGAGCAGGTCAAGAAGCTCAAGGAGAGATGGGGC

TCCAACG - UNI12156 - AATTGCCGGCTGAAGAAG - UNI26061 - GAAAAACCTTGCTGGAACTTGTGATTGAGCAGTTTGAAGACTTACTA

GTTAGAATTTTACTGCTGGCAGCATGTATATCTTTC - UNI23606 - GTTTTGGCTTGGTTCGAGGAAGGGGAAGAAACGATTACAGCCTTTGTAGA

GCCGTTTGTAATTCTGCTTATCTTGGTAGCCAATGCAATCGTGGGTGTGTGGCAG - UNI3831 - GAAAGAAATGCTGAAAATGCAATAGAAGCTCT

TAAGGAATATGAGCCTGAAATGGGCAAAGTGTATCGACAGGACAGAAAGAGTGTGCAACGAATTAAAGCTAAAGACATAGTTCCTGGTGATATAGTGGAA

ATTGCTG - UNI1308 - TTGGTGACAAAGTTCCTGCTGATATTAGATTGACATCCATCAAGTCTACAACTCTAAGAGTCGACCAGTCAATTCTTACA

G GTGAATCTGTCTCCGTCATCAAGCATACTGACCCTGTCCCTGACCCCCGAGCTGTTAATCAAGACAAAAAGAACATGCTCTTTTCT - UNI4240 -

 GGTACAAACATTGCTGCTGGGAAAGCTATGGGAGTGGTGGTGGCAACTGGAGTTAATACTGAGATCGGCAAGATCCGGGATGAAATGGTGGCAACAGAA

CAGGAGAGAACACCCCTACAGCAGAAGCTAGACGAGTTTGGGGAGCAGCTTTCCAAAGTTATCTCCCTCATTTGCATTGCAGTCTGGATCATCAACATTG

GGCATTTCAATGACCCAGTTCATGGTGGCTCCTGGATCAGGGGTGCCATCTACTACTTTAAGATTGCCGTGGCCCTGGCTGTTGCCGCAATCCCTGAGGG

TCTGCCTGCTGTCATCACCACCTGCTTAGCTCTTGGAACTCGTAGGATGGCAAAGAAAAATGCTATCGTTCGAAGTCTGCCTTCTGTGGAGACCCTTGGT

TGTACTTCTGTTATCTGCTCAGATAAGACAGGCACACTTACCACAAACCAGATGTCCGTGTGCAGG - UNI21601 - ATGTTCATTCTGGACAAAGT

AGAAGGTGACACTTGTTCCCTTAATGAGTTCAGCATAACTGGATCCACATATGCACCAATTGGAGAAGT GCAAAAGGATGATAAGCCAGTGAAGTGCCA

TCAGTATGACGGGCTTGTAGAGTTAGCCACCATCTGTGCTCTGTGTAATGACTCTGCTTTGGATTATAATGAG GCAAAGGGTGTGTATGAGAAAGTTGG

AGAAGCTACCGAGACTGCTCTCACGTGCCTGGTGGAGAAGATGAATGTATTTGATACTGAGCTGAAGGGGCTTTCTAAAATAGAGCGTGCAAACGCCTGC

AACTCG - UNI2243 - GTCATAAAGCAGCTGATGAAGAAGGAGTTCACTCTGGAGTTTTCACGGGATAGAAAATCAATGTCCGTCTATTGTACCCCA

AACAAGCCAAGCCGGACATCCATGAGCAAGATGTTTGTGAAG GGGGCTCCAGAAGGTGTCATCGATAGGTGCACCCACATCCGAGTTGGAAGTACCAAG

GTCCCCATGACTCCTGGTGTCAAACAGAAGATTATGTCTGTCATTCGGGAGTGGGGCAGTGGCAGCGACACGCTACGGTGCCTGGCTCTGGCCACTCATG

ACAACCCACTGAAGAGAGAGGAGATGCACCTGGAAGACTCTGCTAACTTCATCAAATACGAG ACCAACCTGACTTTCGTCGGCTGTGTGGGCATGCTGG

ATCCTCCCAGGATTGAAGTAGCCTCTTCTGTGAAGCTGTGCCGGCAAGCAGGCATCCGGGTCATCATGATCACTGGAGACAACAAAGGCACCGCTGTGGC

CATCTGTCGCCGCATTGGCATCTTTGGGCAGGATGAGGATGTGACATCAAAGGCTTTTACAGGGCGAGAGTTTGATGAATTAAGCCCTTCAGCCCAGAGA

GATGCCTGCTTAAATGCCCGCTGTTTTGCTCGAGTTGAACCTTCCCACAAGTCTAAGATTGTTGAGTTCCTTCAGTCCTTTGATGAGATCACAGCTATG 

- UNI30327 - ACTGGTGATGGTGTGAATGATGCTCCTGCTCTGAAGAAATCTGAAATCGGGATTGCCATGGGCTCAGGGACTGCAGTGGCTAAGACT

GCTTCTGAGATGGTCCTGGCAGATGACAACTTCTCCACCATTGTGGCTGCTGTTGAGGAGGGGCGAGCCATCTACAACAACATGAAGCAGTTCATCCGCT

ACCTCATCTCATCCAACGTGGGGGAAGTGGTCTG - UNI30327 - TATCTTCCTGACGGCAGCCCTTGGGTTTCCTGAGGCTTTAATTCCTGTCCAG

TTACTCTGGGTCAATCTGGTGACAGATGGTCTGCCTGCCACTGCGCTGGGGTTCAATCCTCCAGACCTGGACATCATGAACAAACCCCCCCGGAACCCAA

AAGAACCACTGATCAGCGGGTGGCTCTTTTTCCGTTACCTGGCTATTGGCT - UNI30327 - GTTATGTTGGCGCTGCCACCGTGGGTGCTGCTGCA

TGGTGGTTCATCGCTGCTGACGGCGGTCCAAGAGTCTCCTTCTACCAGCTG AGTCATTTCCTACAGTGTAAGGAGGACAACCCAGACTTCGATGGAGTG

GATTGTGCAATCTTTGAGTCCCCATATCCAATGACAATGGCACTTTCTGTTCTAGTAACCATAGAGATGTGTAATGCCCTCAACAG CTTGTCTGAAAAC

CAGTCTTTGCTGAGGATGCCCCCCTGGGAGAATATCTGGCTCGTGGGCTCCATCTGCTTGTCCATGTCACTTCACTTCTTGATCCTCTACGTGGAACCTT

TGCCG CTCATTTTCCAGATCACACCGCTGAATCTGACCCAGTGGCTGATGGTGCTGAAAATCTCCTTGCCTGTGATCCTCATGGATGAGACGCTCAAGT

TTGTGGCCCGAAACTACCTGGAACAACCCGGTAAAGAGTGTGTGCAGCCTGCCACCAAATCTTCCTGCTCCCTGTCGGCATGCACCGATGGCATTTCCTG

GCCGTTTGTGCTGCTCATTATGCCCCTGGTGGTCTGGGTCTACAGCACAGACACTAACTTTAGCGATATGTTCTGGTCTTGACTGACAGCGCTACATACA

GAAGATGTTTAACTTAATCAATTAATTTTTTATTGTTTAAAGCAACTGTCTATTTCTGCTGAATTTTCACATGAACATATTGGCTGGTGAAGGAGGTTTC

ATATCTAGATTTTGTTTTGCTTTTTCTGACTCCAGTGGGACAAGATTTTCCTTTTTTTATACACATAATTAAAGTGTCCATTGACGTGTACAGAGAACTA

ACACTATTTTATGCAGATATTTTTTTGTAGATGAAAAAGCATGTACAGTGTTCTGTTTAATACTCATACTTGTACAAAGATAGTTGAGCCAGCAGACATT

GTCAGCAAATTAATTGGCAGCAGACTTAGGAAATGAATGTGTGTGGTTTTTAAAAGAAAAAAAACTAAATAGCATGTATTGTGTCTTTTGCATGATTCTC

TGGATTTAATTTGGTATCACAGTCTAATTTTTATTCATAAGCCAATTTTTCTGCACTGAGCAGAGTCCTGCTACCTCAGTCAGTATTTTTGGTTTGCCAC

TTCCTGCACCCTCAGCCTCTGTCACCCCCAGCCCACCCCAGCCTGCTCGGCTTCTTCTGTAGGTCTGATGGTTCTGTTTACATCCGTCTTCACGAGAGGT

TTGCCTGTCTCGCTTGTGCAGAAAACATTGCTCCAGATCCAATCGACTGGGTTTCTGTCCCTTCGCCTAGTTTTTAAGGTTATTTATTTAAATGTCTAAT

GTATTTTATTGTAACAGACATTGTTTTGCCAACATTGCCTATTCAATGGCACTTCACAATCTAGTTTAAAAGAAAAATAAAACATTTTAAATGGACAGAG

AAAAATAACTGTCTTGTTCTTAATGGCCTTGAATTACGTATAATCAGTTCAAATTTCTGAGCTTCTCAGCTTAGAGCCTTAGTTTCCTGTTCTGAGAAGA

GTCCTGTTCTGCCGCATAGTAGGATTTTATTTATAATGTATAGGCACGATCTGTCATGTGATATACATTACTCAAGTTTCTGCTGGCCCGTTGTATGTAG

GTTGGTGTAAGGGCAAGTGTGTGTTTATGTGTGTGTATGTTTTGTAAAATCTGTAAATAGCACATGACCAAATGAACATATTGTATAGAAATATTTTTAT

TTGACTATGGCACTAACCACCACCACCATGACTGATGAACGTTTGCGCATGTTCAAGGTCAGTCTTAACGGCAGTGTGAGTCATTAACAGTCCTAACTGT

GGTGTTTTCCTCCAATGCCTTCCAACATCCATCAACTAAC - UNI18499 - CAATACTGGAGTAACCGCTTCCTAAACCATTTGCAGAAATATAAGG

GTGTTCGGGTGCGTGCATGTGCGTTGTTAGCAACACATCTACCAGCCCTCTGCATGACTGAGGTTGGGGAAAAGAAAAATAGAAACAGTCCCCAACTCAC

TGTGTGATGTGGAGGAAATGTGTATTACCAGTGGGGTTTTAGCTGTTCAATCAAAATAATAACAAATGTACAATTTAGCATAACAAATCAGAGAGCCTCT

CCAGAGAAGTTGGTTTCTTTGCTGCGAGAAGGAGGTTCTGAAACCTTATCCAAGAACAGAAGCCATCAGCCAAGTCTCCACATTTCTCTGCAAAATGTCA

TAGCCTCTCTAACTGTATGATAATTGTAATGCATGCCTTCAGTTGTAAGTGGCCAGATTGCTCTACAGTGACATTGAAACATGCTTTCTAATGGGCCCTG

TACAGTTTGCTTATTTATAAATTCATTTAAAACACTACAGCTGCTGAATGGTTACAACATAGGCCTCCAGTCCTAACTTCAGTTGTTTAGGTGTGCAGCC

AGCTGTTCCACACTGTATTATTGTAACTTATTTAATGAAGTCAGAAGCAGTAGACAGATGTTGGTGCAATACAAGTATTGTGTGCATTTATCGTAATAAA

GTGCTCAGCGTCAGTTCAGTTGCTCACAGCTTCTCACAGCGCATGTTTGACTGTAGTCTGTAAATAGAGGTCAGTTTCTGTGCTGGTAACAGGTATTGCA

CAGACATGATTTCAGGTAAATAAATCTATTCTACGAT
Translation
MENAHTKTVEEVLGHFGVNESTGLSLEQVKKLKERWGSNE - UNI12156 - ELPAEEG - UNI26061 - GKTLLELVIEQFEDLLVRILLLAAC

ISF - UNI23606 - VLAWFEEGEETITAFVEPFVILLILVANAIVGVWQ - UNI3831 - ERNAENAIEALKEYEPEMGKVYRQDRKSVQRIKAK

DIVPGDIVEIAV - UNI1308 - VGDKVPADIRLTSIKSTTLRVDQSILTG GESVSVIKHTDPVPDPRAVNQDKKNMLFS - UNI4240 - GTNI

AAGKAMGVVVATGVNTEIGKIRDEMVATEQERTPLQQKLDEFGEQLSKVISLICIAVWIINIGHFNDPVHGGSWIRGAIYYFKIAVALAVAAIPEGLPAV

ITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCR - UNI21601 - MFILDKVEGDTCSLNEFSITGSTYAPIGEV VQKD

DKPVKCHQYDGLVELATICALCNDSALDYNE AKGVYEKVGEATETALTCLVEKMNVFDTELKGLSKIERANACNS - UNI2243 - VIKQLMKKEFT

LEFSRDRKSMSVYCTPNKPSRTSMSKMFVK GAPEGVIDRCTHIRVGSTKVPMTPGVKQKIMSVIREWGSGSDTLRCLALATHDNPLKREEMHLEDSANF

IKYE TNLTFVGCVGMLDPPRIEVASSVKLCRQAGIRVIMITGDNKGTAVAICRRIGIFGQDEDVTSKAFTGREFDELSPSAQRDACLNARCFARVEPSH

KSKIVEFLQSFDEITAM - UNI30327 - TGDGVNDAPALKKSEIGIAMGSGTAVAKTASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNV

GEVVC - UNI30327 - CIFLTAALGFPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMNKPPRNPKEPLISGWLFFRYLAIGC - UNI30327 

- CYVGAATVGAAAWWFIAADGGPRVSFYQL SHFLQCKEDNPDFDGVDCAIFESPYPMTMALSVLVTIEMCNALNS SLSENQSLLRMPPWENIWLVGS

ICLSMSLHFLILYVEPLP LIFQITPLNLTQWLMVLKISLPVILMDETLKFVARNYLEQPGKECVQPATKSSCSLSACTDGISWPFVLLIMPLVVWVYST

DTNFSDMFWS - UNI18499 - 

For any suggestions or comments, please send an email to unitrap@crg.es