Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000029468 (P2rx7)
Chromosomal location
Chr 5: 123093920 - 123141441 (+)
Description
purinergic receptor P2X, ligand-gated ion channel, 7 Gene [Source:MGI (curated);Acc:P2rx7-003]
RefSeq_dna
NM_001038845 NM_011027 NM_001038887 
RefSeq_peptide
NP_001033934.1 NP_001033928.1 NP_035157.2 NP_001033976.1 
UniGene
Mm.403602 Mm.42026 Mm.401412 
MGI
MGI:1339957 
Uniprot/SWISSPROT
Q9Z1M0 
Uniprot/SPTREMBL
Q3TBP1 Q3UN00 A2VCP3 Q3ULZ7 Q3UM93 Q8CHP3 Q8CHP4 Q6P5P0 
Human Ortholog
ENSG00000089041 (P2RX7)
Omim not available
UniTrap UNI26868
Vector Insertion
Chr 5: 123104239 - 123104987
Public Clones not available
Private Clones OST90373 (lexicon)
Severity of mutation (?) Insertion after 27% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33242
Vector Insertion
Chr 5: 123123825 - 123126670
Public Clones IST12598B10 (tigm) IST12510C11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 90% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI35958
Vector Insertion
Chr 5: 123126773 - 123130815
Public Clones IST12141F9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 97% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34118
Vector Insertion
Chr 5: 123134307 - 123141261
Public Clones IST11163E2 (tigm) IST10814B9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 97% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000031425
Sequence
AGGACCCGCCCCCGCTGCAGTCACTGGAGGAACTGGAAGTTAACCGTTCCTGCTGAGAAATCGGTGTGTTTCCTTTGGCTGCTCCTAGGTGAGGGTTTGC

TGTGGTCTAGCCTGGGAAGTAGGTCTAGCCCAAGTCCAGCCTGAACAGAGCGAGCCTGTCGCCATGCCGGCTTGCTGCAGCTGGAACGATGTCTTGCAGT

ATGAGACAAACAAAGTCACCCGGATCCAGAGCACGAATTATGGCACCGTCAAGTGGGTCTTGCACATGATCGTCTTTTCCTACATTAG CTTTGCTTTGG

TGAGCGATAAGCTGTACCAGCGGAAAGAGCCTGTTATCAGCTCCGTGCACACCAAGGTCAAAGGCATAGCAGAGGTGACGGAGAATGTCACAGAGGGTGG

GGTGACGAAGTTAGGACACAGCATCTTTGACACTGCAGACTACACCTTCCCTTTGCAG GGGAACTCATTCTTTGTCATGACAAACTATGTCAAGTCAGA

AGGCCAAGTGCAGACGCTGTGTCCTGAG - UNI26868 - TATCCCAGGCGCGGTGCACAGTGCTCTTCTGACCGGCGTTGTAAAAAGGGGTGGATGG

ACCCACAGAGCAAAG GAATCCAGACTGGCAGGTGTGTTCCATATGACAAGACAAGGAAGACCTGTGAAGTCTCTGCCTGGTGTCCTACTGAGGAGGAGA

AAGAAGCTCCCCG ACCTGCACTCTTGAGGAGCGCCGAAAACTTCACCGTACTCATCAAGAATAATATCCACTTCCCCGGCCACAACTATACCAC GAGA

AACATCTTGCCAACTATGAACGGCTCTTGTACCTTTCACAAGACTTGGGACCCTCAGTGTTCCATCTTCCGACTAGGGGACATCTTCCAGGAAGCAGGAG

AGAACTTTACAGAGGTGGCAGTTCAG GGAGGAATCATGGGTATCGAGATCTACTGGGATTGCAACCTAGACAGCTGGTCCCATCACTGCCGACCCAGGT

ACAGCTTCCGCCGCCTGGATGACAAGAACACGGATGAGTCCTTCGTCCCCGGCTACAACTTCAG ATATGCCAAGTACTATAAGGAGAACAATGTGGAAA

AGCGGACGTTGATCAAAGCCTTCGGCATCCGTTTTGACATCCTGGTTTTCGGCACT GGAGGAAAATTTGACATCATCCAGCTGGTTGTATACATTGGAT

CCACCCTGTCCTACTTTGGCTTG GCCACTGTGTGCATTGACTTGCTCATCAACACATACTCCAGTGCTTTCTGCAGGTCGGGGGTTTACCCCTACTGTA

AGTGCTGTGAGCCCTGCACAGTGAACGAGTATTACTACAGAAAGAAGTGTGAGTCCATCATGGAACCCAAGCCG - UNI33242 - ACGTTGAAGTAT

GTGTCCTTTGTCGACGAGCCGCACATTCGCATGGTGGACCAGCAGCTGCTTGGGAAAAGTCTGCAAGTTGTCAAAGGCCAAGAAGTTCCA - UNI3411

8 - - UNI35958 - GTACGGGTGCTTTGCCTGCATGTATGTATGCGCACCTGATGCCATCAGATGTCAGAAGGAAGGGGTCGGATCTACTGGATCTG

GAGTTACAGATGATTGTAAACCACGATGTTGGTGCTGGGAACCAAACCCAGGTCCTCTCAAAAACAGCAAGTGGTCGTAACCATTCAGCCATCTCTC
Translation
MPACCSWNDVLQYETNKVTRIQSTNYGTVKWVLHMIVFSYIS SFALVSDKLYQRKEPVISSVHTKVKGIAEVTENVTEGGVTKLGHSIFDTADYTFPLQ

 GNSFFVMTNYVKSEGQVQTLCPE - UNI26868 - YPRRGAQCSSDRRCKKGWMDPQSKG GIQTGRCVPYDKTRKTCEVSAWCPTEEEKEAPR RP

ALLRSAENFTVLIKNNIHFPGHNYTT TRNILPTMNGSCTFHKTWDPQCSIFRLGDIFQEAGENFTEVAVQ GGIMGIEIYWDCNLDSWSHHCRPRYSFR

RLDDKNTDESFVPGYNFR RYAKYYKENNVEKRTLIKAFGIRFDILVFGT GGKFDIIQLVVYIGSTLSYFGL ATVCIDLLINTYSSAFCRSGVYPYCK

CCEPCTVNEYYYRKKCESIMEPKP - UNI33242 - TLKYVSFVDEPHIRMVDQQLLGKSLQVVKGQEVP - UNI34118 - - UNI35958 - V

RVLCLHVCMRT
Transcript ENSMUST00000121489
Sequence
AGGACCCGCCCCCGCTGCAGTCACTGGAGGAACTGGAAGTTAACCGTTCCTGCTGAGAAATCGGTGTGTTTCCTTTGGCTGCTCCTAGGTGAGGGTTTGC

TGTGGTCTAGCCTGGGAAGTAGGTCTAGCCCAAGTCCAGCCTGAACAGAGCGAGCCTGTCGCCATGCCGGCTTGCTGCAGCTGGAACGATGTCTTGCAGT

ATGAGACAAACAAAGTCACCCGGATCCAGAGCACGAATTATGGCACCGTCAAGTGGGTCTTGCACATGATCGTCTTTTCCTACATTAG CTTTGCTTTGG

TGAGCGATAAGCTGTACCAGCGGAAAGAGCCTGTTATCAGCTCCGTGCACACCAAGGTCAAAGGCATAGCAGAGGTGACGGAGAATGTCACAGAGGGTGG

GGTGACGAAGTTAGGACACAGCATCTTTGACACTGCAGACTACACCTTCCCTTTGCAG GGGAACTCATTCTTTGTCATGACAAACTATGTCAAGTCAGA

AGGCCAAGTGCAGACGCTGTGTCCTGAG - UNI26868 - TATCCCAGGCGCGGTGCACAGTGCTCTTCTGACCGGCGTTGTAAAAAGGGGTGGATGG

ACCCACAGAGCAAAG GAATCCAGACTGGCAGGTGTGTTCCATATGACAAGACAAGGAAGACCTGTGAAGTCTCTGCCTGGTGTCCTACTGAGGAGGAGA

AAGAAGCTCCCCG ACCTGCACTCTTGAGGAGCGCCGAAAACTTCACCGTACTCATCAAGAATAATATCCACTTCCCCGGCCACAACTATACCAC GAGA

AACATCTTGCCAACTATGAACGGCTCTTGTACCTTTCACAAGACTTGGGACCCTCAGTGTTCCATCTTCCGACTAGGGGACATCTTCCAGGAAGCAGGAG

AGAACTTTACAGAGGTGGCAGTTCAG GGAGGAATCATGGGTATCGAGATCTACTGGGATTGCAACCTAGACAGCTGGTCCCATCACTGCCGACCCAGGT

ACAGCTTCCGCCGCCTGGATGACAAGAACACGGATGAGTCCTTCGTCCCCGGCTACAACTTCAG ATATGCCAAGTACTATAAGGAGAACAATGTGGAAA

AGCGGACGTTGATCAAAGCCTTCGGCATCCGTTTTGACATCCTGGTTTTCGGCACT GGAGGAAAATTTGACATCATCCAGCTGGTTGTATACATTGGAT

CCACCCTGTCCTACTTTGGCTTG GCCACTGTGTGCATTGACTTGCTCATCAACACATACTCCAGTGCTTTCTGCAGGTCGGGGGTTTACCCCTACTGTA

AGTGCTGTGAGCCCTGCACAGTGAACGAGTATTACTACAGAAAGAAGTGTGAGTCCATCATGGAACCCAAGCCG - UNI33242 - ACGTTGAAGTAT

GTGTCCTTTGTCGACGAGCCGCACATTCGCATGGTGGACCAGCAGCTGCTTGGGAAAAGTCTGCAAGTTGTCAAAGGCCAAGAAGTTCCA - UNI3595

8 - ACCTAGATACTTGTTTCTCACAGAACAGAGACTTTGAGTATTATGAGATGCTTTGACTGACTCTAAGACTTGCCATTTTAAGGCGTCTAAGATCAA

GAAGCCATGCTCTCAATGGAGAGGGTGGGGCTGAGGCACCTTCATGAAGGAGGCCCATGCTCACAAGCCTGACGGATGACCTCAGACGGATGACCTCAGA

CGGATGACCTCAGACGGATGACCTCAGACGGATGACCTCAGACGGATGACCTCAGTTCCATCCTCGGGACCCACACAGTGGAGAGAGCACTGACTTCCAC

ATGCAAGCATGGCATGTGTCCACCCCCAGTCTCCCAGTAAATGAATTTAAGTCCATTTTCACTGTATTTTTGTTTGTTTTTGGTTTTGTTATTCTTTTTC

AAGACTGGAAAGCCCTGGCTGTCCTGGAATTCACGTGTAGACCAGGCTGGCCTTGAACTCAGAGATTCCACCTGCCTCTGCCTCCCGAGTGCTGGGATTA

AAGGGTGTAGCACCACCACCAGGCTCGGAGATATTTTTTTAAAGTAGACTGTATTTGACTTCAGAGTTGAGCTTTTTACTCCAAGCATTCTATGGAAGAG

CTACAGGCTTCCCTCCCTGTAGCCTCCCAGTCTCTACACCTTTATCTTTGATGCCTACTTCCAAGTGTACTTATATCGCCTTGCTAAGGCTTCAGACAGT

GACTGACCACTGGACTCTTCTAGTGTTTCCTTGTGCCTTTGGCCACTGGTGCTCTCCTGAGGGTGACATGCCACTCTGTGGATAAAAATGACGCTTTCTT

CAGCAGCAATGATATTTGCATCTTTATTTTTGGTCTACTGCGTGGGCAATGCCGTGGTCTGAGGCCGTGAGCAGTTCATTTCTCAGGGTAAAGTTCTTGT

TGTTAGATGCATTCTGTTCTGTCAGTTGCCCGGTAGCCATGCCTTCCTTGGTCAGAACTGAGAGCAGCTTCCTGACGCAGCCCGGCTGACTTCCTGGACG

ACTGGGGGTGGGTTTTCACTTCTCTCTTTAAAGGGAACCATCTTCTAAACTCTTCCTAATTTCGTGTAAGGGTTTTTTTTAAAACTATTTCATAATAAAA

CTTGATTTCAATTCATTTATTTAAGAA
Translation
MPACCSWNDVLQYETNKVTRIQSTNYGTVKWVLHMIVFSYIS SFALVSDKLYQRKEPVISSVHTKVKGIAEVTENVTEGGVTKLGHSIFDTADYTFPLQ

 GNSFFVMTNYVKSEGQVQTLCPE - UNI26868 - YPRRGAQCSSDRRCKKGWMDPQSKG GIQTGRCVPYDKTRKTCEVSAWCPTEEEKEAPR RP

ALLRSAENFTVLIKNNIHFPGHNYTT TRNILPTMNGSCTFHKTWDPQCSIFRLGDIFQEAGENFTEVAVQ GGIMGIEIYWDCNLDSWSHHCRPRYSFR

RLDDKNTDESFVPGYNFR RYAKYYKENNVEKRTLIKAFGIRFDILVFGT GGKFDIIQLVVYIGSTLSYFGL ATVCIDLLINTYSSAFCRSGVYPYCK

CCEPCTVNEYYYRKKCESIMEPKP - UNI33242 - TLKYVSFVDEPHIRMVDQQLLGKSLQVVKGQEVP - UNI35958 - T
Transcript ENSMUST00000100737
Sequence
AGGACCCGCCCCCGCTGCAGTCACTGGAGGAACTGGAAGTTAACCGTTCCTGCTGAGAAATCGGTGTGTTTCCTTTGGCTGCTCCTAGGTGAGGGTTTGC

TGTGGTCTAGCCTGGGAAGTAGGTCTAGCCCAAGTCCAGCCTGAACAGAGCGAGCCTGTCGCCATGCCGGCTTGCTGCAGCTGGAACGATGTCTTGCAGT

ATGAGACAAACAAAGTCACCCGGATCCAGAGCACGAATTATGGCACCGTCAAGTGGGTCTTGCACATGATCGTCTTTTCCTACATTAG CTTTGCTTTGG

TGAGCGATAAGCTGTACCAGCGGAAAGAGCCTGTTATCAGCTCCGTGCACACCAAGGTCAAAGGCATAGCAGAGGTGACGGAGAATGTCACAGAGGGTGG

GGTGACGAAGTTAGGACACAGCATCTTTGACACTGCAGACTACACCTTCCCTTTGCAG GGGAACTCATTCTTTGTCATGACAAACTATGTCAAGTCAGA

AGGCCAAGTGCAGACGCTGTGTCCTGAG - UNI26868 - TATCCCAGGCGCGGTGCACAGTGCTCTTCTGACCGGCGTTGTAAAAAGGGGTGGATGG

ACCCACAGAGCAAAG GAATCCAGACTGGCAGGTGTGTTCCATATGACAAGACAAGGAAGACCTGTGAAGTCTCTGCCTGGTGTCCTACTGAGGAGGAGA

AAGAAGCTCCCCG ACCTGCACTCTTGAGGAGCGCCGAAAACTTCACCGTACTCATCAAGAATAATATCCACTTCCCCGGCCACAACTATACCAC GAGA

AACATCTTGCCAACTATGAACGGCTCTTGTACCTTTCACAAGACTTGGGACCCTCAGTGTTCCATCTTCCGACTAGGGGACATCTTCCAGGAAGCAGGAG

AGAACTTTACAGAGGTGGCAGTTCAG GGAGGAATCATGGGTATCGAGATCTACTGGGATTGCAACCTAGACAGCTGGTCCCATCACTGCCGACCCAGGT

ACAGCTTCCGCCGCCTGGATGACAAGAACACGGATGAGTCCTTCGTCCCCGGCTACAACTTCAG ATATGCCAAGTACTATAAGGAGAACAATGTGGAAA

AGCGGACGTTGATCAAAGCCTTCGGCATCCGTTTTGACATCCTGGTTTTCGGCACT GGAGGAAAATTTGACATCATCCAGCTGGTTGTATACATTGGAT

CCACCCTGTCCTACTTTGGCTTG GCCACTGTGTGCATTGACTTGCTCATCAACACATACTCCAGTGCTTTCTGCAGGTCGGGGGTTTACCCCTACTGTA

AGTGCTGTGAGCCCTGCACAGTGAACGAGTATTACTACAGAAAGAAGTGTGAGTCCATCATGGAACCCAAGCCG - UNI33242 - ACGTTGAAGTAT

GTGTCCTTTGTCGACGAGCCGCACATTCGCATGGTGGACCAGCAGCTGCTTGGGAAAAGTCTGCAAGTTGTCAAAGGCCAAGAAGTTCCA - UNI3595

8 - AGACCCCAGATGGACTTCTCCGACCTGTCTAGGCTGTCCCTATCTCTCCACGACTCACCCCTGACTCCTGGACAATCTGAGGAAATTCAGCTGCTC

CATGAAGAGGTGGCCCCTAAGTCCGGGGACAGCCCGAGTTGGTGCCAGTGTGGAAATTGCCTCCCGTCTCGCCTACCGGAGCAACGCAGGGCCCTGGAGG

AGCTGTGCTGCCGGAGGAAGCCGGGGCGGTGCATCACCACCTCCAAGCTCTTCCATAAGCTCGTGCTGTCCCGAGACACCCTGCAGCTCCTCCTGCTTTA

CCAGGATCCCTTGCTGGTGCTGGGGGAAGAGGCCACCAACAGCAGGCTGCGACACCGTGCTTACAGGTGCTATGCCACCTGGCGCTTCGGCTCCCAGGAC

ATGGCCGACTTTGCCATTCTGCCCAGCTGTTGCCGCTGGAGGATCCGGAAGGAGTTCCCCAAGACCGAGGGGCAGTATAGTGGCTTCAAGTATCCCTACT

GATGGTACGGCTGCCACATCATGGTGGCTCACAATACAGCTTCCCTTGGAAAGACCTAGAGACACGTTTTCAACCCACTGGAACTTAAGGTTTGCCCCTC

GTAAGCTGTGTTGAAGAAGAGAGCTGATTAGACCAATGGCGAGCTCGCAAACCATTCTCCACGTGGATGAGAACCGGATGCACATCTGAGCCTGCAGCCT

GACCCTGGTCTGCGGCGCCACCCTCAGCTTAAAATGTGTACATAGGCTCCTCATATCCCAACCTCCCCACCTACTTTCTCTGAACTAGCATTGCGGAGGT

GGTGAAGGTGTTCTCTCCCGTCCACGTTTACACAGCTCCATGGATGCAAAGGTGCAACCCTGAAAACCAAACCTTTAGAGATTCGAGAGTACTCTGAGAA

ATTAAATATGGCCCCAAATTCTTTGACATCCTCCGCAACCCAACCCATAAGACCCAAAGGTGTTTTTTTCTCTCCTCTCATCCCGTAGCAGATGTGATGT

TACATCTATTATTTGGGGCCCTTGTTTTAAGAGGCTAGCAACTTCTGATTCCTATGCTTGGAACTCTTGCTGAGAGGAAGCCAGCCCAAGTTAAAAGTCT

GATAATAAGAGCTTCTCCGCTGTGAAGAAGTCCAAGCAGCTTTAGGACGAAGTACCCAATCCGAGCCAGCTCATCACCTCTAAGTGCAGTCACCACACAG

GGAAAGAAGCTGCCACTTTCAGGTGATTTCAGACCCATGACTTAAACTGCAGGAGACGACTGCCCAGTCAGCCCCGAGGACCACTCTGCTGCCTTAAGTC

ATTACATTTGGGAGAGGCGGGTTGACACACAGCAATAGGCAACTGGGACAAGAGATGCTGACTGAGGCCCAGAGTCACTACAAAATATAACAGCTACTTC

TATTGGGCAGCTGTAAGAGGTCACATTAACCAGACTAGAAGCCATCAAATCTAACTGCATACAAGTTACAGTCTGACCTGCCTTGCTCTCCTATGGTTCC

AAGTCACTAGTACTGTGAGAAACCGGTTGGTAAAAGCTGCCTCTGTGCCTTTCACGTCCCGGACTGTACAGCCAACGAGTCCGAGGCAATCTGAATGCTC

CTTTAGAAAGTAGCCCAAGCTGCCAGGAGAGGCGTCAACCCATGCTCAGAAGGCCGACTCTAGGCCAGCCTGAGCTACATCGCAAGACCATGTCTTTATT

TTTTATTTTTGTAAGATTTATTTTATGTTTGAGTGTTTTGCCTGCACCATGTGTGTGCCTGGTGCCGGTGGAGGTCAGAAGAGAGTGTTGGACCCCCTGG

AACTGGAACTGCAGGTGGTTGGGAGCCACCATGGTGGTGTTGGGAAGTGAACTTGAGTCCTCCGCAATAGCAACAAGGGCTCTTAACTACTGAGCCATCT

CTCCACCTTCAAAACCACGTCTTAAAATCATAATCTTGATAATTAGAAAAGGGAGGGGGAAGAGAGGCTAGGGAGATGGTTCTGTGGGTTAGAGCATTTT

CTCCTCAGGCATGAGGACTGACCTACGTTGGGATCACAGCAGCCACATAAAGTCTGGATGTGGCCTGTCATGATGGCTTGGCAGGGGTAGGGGTGGGAAA

AGAGCTTGCTTTGCAATCTGATGACCTTGAAAGCCATGGTGAAACTGGAGAGCCATGTTCTCTGACTTCCACATGAACCACACACATACTCACACACATA

CACACATATAAATCATACATGCACACTAGTAATAAATAAAATAGATGTAATTTTTAAGGGAAGCCAGTGCCCTTCATCGTTTTCTACAACCACTAAACAT

GGAAGAGGGAACCTTTACAGGTTTGGGGTCCTGCCTCGGGATTTCATTTTGATAGTTTTCTTTTTCTTCTAGACCTAGATACTTGTTTCTCACAGAACAG

AGACTTTGAGTATTATGAGATGCTTTGACTGACTCTAAGACTTGCCATTTTAAGGCGTCTAAGATCAAGAAGCCATGCTCTCAATGGAGAGGGTGGGGCT

GAGGCACCTTCATGAAGGAGGCCCATGCTCACAAGCCTGACGGATGACCTCAGACGGATGACCTCAGACGGATGACCTCAGACGGATGACCTCAGACGGA

TGACCTCAGACGGATGACCTCAGTTCCATCCTCGGGACCCACACAGTGGAGAGAGCACTGACTTCCACATGCAAGCATGGCATGTGTCCACCCCCAGTCT

CCCAGTAAATGAATTTAAGTCCATTTTCACTGTATTTTTGTTTGTTTTTGGTTTTGTTATTCTTTTTCAAGACTGGAAAGCCCTGGCTGTCCTGGAATTC

ACGTGTAGACCAGGCTGGCCTTGAACTCAGAGATTCCACCTGCCTCTGCCTCCCGAGTGCTGGGATTAAAGGGTGTAGCACCACCACCAGGCTCGGAGAT

ATTTTTTTAAAGTAGACTGTATTTGACTTCAGAGTTGAGCTTTTTACTCCAAGCATTCTATGGAAGAGCTACAGGCTTCCCTCCCTGTAGCCTCCCAGTC

TCTACACCTTTATCTTTGATGCCTACTTCCAAGTGTACTTATATCGCCTTGCTAAGGCTTCAGACAGTGACTGACCACTGGACTCTTCTAGTGTTTCCTT

GTGCCTTTGGCCACTGGTGCTCTCCTGAGGGTGACATGCCACTCTGTGGATAAAAATGACGCTTTCTTCAGCAGCAATGATATTTGCATCTTTATTTTTG

GTCTACTGCGTGGGCAATGCCGTGGTCTGAGGCCGTGAGCAGTTCATTTCTCAGGGTAAAGTTCTTGTTGTTAGATGCATTCTGTTCTGTCAGTTGCCCG

GTAGCCATGCCTTCCTTGGTCAGAACTGAGAGCAGCTTCCTGACGCAGCCCGGCTGACTTCCTGGACGACTGGGGGTGGGTTTTCACTTCTCTCTTTAAA

GGGAACCATCTTCTAAACTCTTCCTAATTTCGTGTAAGGGTTTTTTTTAAAACTATTTCATAATAAAACTTGATTTCAATTC
Translation
MPACCSWNDVLQYETNKVTRIQSTNYGTVKWVLHMIVFSYIS SFALVSDKLYQRKEPVISSVHTKVKGIAEVTENVTEGGVTKLGHSIFDTADYTFPLQ

 GNSFFVMTNYVKSEGQVQTLCPE - UNI26868 - YPRRGAQCSSDRRCKKGWMDPQSKG GIQTGRCVPYDKTRKTCEVSAWCPTEEEKEAPR RP

ALLRSAENFTVLIKNNIHFPGHNYTT TRNILPTMNGSCTFHKTWDPQCSIFRLGDIFQEAGENFTEVAVQ GGIMGIEIYWDCNLDSWSHHCRPRYSFR

RLDDKNTDESFVPGYNFR RYAKYYKENNVEKRTLIKAFGIRFDILVFGT GGKFDIIQLVVYIGSTLSYFGL ATVCIDLLINTYSSAFCRSGVYPYCK

CCEPCTVNEYYYRKKCESIMEPKP - UNI33242 - TLKYVSFVDEPHIRMVDQQLLGKSLQVVKGQEVP - UNI35958 - RPQMDFSDLSRLSL

SLHDSPLTPGQSEEIQLLHEEVAPKSGDSPSWCQCGNCLPSRLPEQRRALEELCCRRKPGRCITTSKLFHKLVLSRDTLQLLLLYQDPLLVLGEEATNSR

LRHRAYRCYATWRFGSQDMADFAILPSCCRWRIRKEFPKTEGQYSGFKYPY
Transcript ENSMUST00000086247
Sequence
AGGACCCGCCCCCGCTGCAGTCACTGGAGGAACTGGAAGTTAACCGTTCCTGCTGAGAAATCGGTGTGTTTCCTTTGGCTGCTCCTAGGTGAGGGTTTGC

TGTGGTCTAGCCTGGGAAGTAGGTCTAGCCCAAGTCCAGCCTGAACAGAGCGAGCCTGTCGCCATGCCGGCTTGCTGCAGCTGGAACGATGTCTTGCAGT

ATGAGACAAACAAAGTCACCCGGATCCAGAGCACGAATTATGGCACCGTCAAGTGGGTCTTGCACATGATCGTCTTTTCCTACATTAG CTTTGCTTTGG

TGAGCGATAAGCTGTACCAGCGGAAAGAGCCTGTTATCAGCTCCGTGCACACCAAGGTCAAAGGCATAGCAGAGGTGACGGAGAATGTCACAGAGGGTGG

GGTGACGAAGTTAGGACACAGCATCTTTGACACTGCAGACTACACCTTCCCTTTGCAG GGGAACTCATTCTTTGTCATGACAAACTATGTCAAGTCAGA

AGGCCAAGTGCAGACGCTGTGTCCTGAG - UNI26868 - GATCTTTCCAACCTCCAGGAGAGTAACCAGACTTCCAAACCACTGCTCAGGAATCCCA

GAGCCAAGAAGGAAGAAGGCTTAAGCCTGGAGCTGGCCTAAAGTTCTGCTGCCTCCTGGTAGTTCTGTGATCGCAGAGAGGCCCAGCTCAAAAGGGAGGC

AGATACTTGGTCTGTCAGCCAGGAGAATGGTCAAAAAGCTCCCCAATCCATGCAACAATCACAAAATTAATGTTAGAGTTTCTTTTAGAGATT
Translation
MPACCSWNDVLQYETNKVTRIQSTNYGTVKWVLHMIVFSYIS SFALVSDKLYQRKEPVISSVHTKVKGIAEVTENVTEGGVTKLGHSIFDTADYTFPLQ

 GNSFFVMTNYVKSEGQVQTLCPE - UNI26868 - DLSNLQESNQTSKPLLRNPRAKKEEGLSLELA

For any suggestions or comments, please send an email to unitrap@crg.es