Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000029475 (Fbxl10)
Chromosomal location
Chr 5: 123320688 - 123439832 (-)
Description
F-box and leucine-rich repeat protein 10 Gene [Source:MGI (curated);Acc:Fbxl10-003]
RefSeq_dna
NM_001003953 NM_001005866 NM_013910 
RefSeq_peptide
NP_001003953.1 NP_001005866.1 NP_038938.1 
UniGene
Mm.86406 
MGI
MGI:1354737 
Uniprot/SWISSPROT
Q6P1G2 
Human Ortholog
ENSG00000089094 (FBXL10)
Omim not available
UniTrap UNI33518
Vector Insertion
Chr 5: 123438876 - 123439833
Public Clones IST12123H9 (tigm) IST13338B1 (tigm) IST10561F5 (tigm) IST11361D3 (tigm)
IST14414B7 (tigm) IST13712H9 (tigm) IST10356H6 (tigm) IST14786A4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31560
Vector Insertion
Chr 5: 123438475 - 123438910
Public Clones IST12890D9 (tigm) IST14717E4 (tigm) IST10365C12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13030
Vector Insertion
Chr 5: 123437816 - 123438475
Public Clones E001D12 (ggtc) CMHD-GT_476E12-3 (cmhd) CMHD-GT_335F9-3 (cmhd) CMHD-GT_338G9-3 (cmhd)
PST1047-1 (escells) IST10830H6 (tigm) IST10080H3 (tigm)
Private Clones OST369482 (lexicon) OST298443 (lexicon) OST296716 (lexicon) OST265313 (lexicon)
OST251631 (lexicon) OST210475 (lexicon) OST193061 (lexicon) OST170796 (lexicon)
OST155668 (lexicon) OST149792 (lexicon) OST142588 (lexicon) OST103257 (lexicon)
OST99611 (lexicon) OST9963 (lexicon)
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15521
Vector Insertion
Chr 5: 123434470 - 123437816
Public Clones E020G02 (ggtc) PST4308-NR (escells) IST12333D7 (tigm) IST10337B2 (tigm)
IST10983D10 (tigm)
Private Clones OST333453 (lexicon) OST278647 (lexicon) OST186100 (lexicon)
Severity of mutation (?) Insertion after 5% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19470
Vector Insertion
Chr 5: 123432833 - 123434470
Public Clones IST14329D7 (tigm) IST11534C12 (tigm)
Private Clones OST390652 (lexicon) OST267261 (lexicon) OST190230 (lexicon)
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17114
Vector Insertion
Chr 5: 123411598 - 123432785
Public Clones IST12098B7 (tigm) IST14882D7 (tigm) IST11354B4 (tigm) IST10875E9 (tigm)
IST11259C10 (tigm) IST11259B11 (tigm) IST10783E9 (tigm) IST10931G1 (tigm)
Private Clones OST449034 (lexicon) OST303052 (lexicon)
Severity of mutation (?) Insertion after 8% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32087
Vector Insertion
Chr 5: 123399078 - 123411129
Public Clones IST12231A2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 15% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4017
Vector Insertion
Chr 5: 123397890 - 123399078
Public Clones AQ1011 (sanger)
Private Clones OST419990 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24228
Vector Insertion
Chr 5: 123391078 - 123397735
Public Clones D115C09 (ggtc) IST12227A8 (tigm) IST12227B8 (tigm) IST10032A11 (tigm)
Private Clones OST230418 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36483
Vector Insertion
Chr 5: 123384741 - 123391078
Public Clones IST10969C3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11698
Vector Insertion
Chr 5: 123371481 - 123382475
Public Clones (sanger) M120A05 (ggtc) IST12719G12 (tigm) IST13129C9 (tigm) IST10679C4 (tigm)
IST10725B4 (tigm) IST10482H1 (tigm) IST10326E12 (tigm) IST10421H4 (tigm)
IST13299F12 (tigm) IST13488G7 (tigm) IST12902G5 (tigm) IST11129C8 (tigm)
IST11798C4 (tigm) IST12845G12 (tigm) IST11043E3 (tigm) IST10725A1 (tigm)
IST12483E12 (tigm) IST12633F6 (tigm) IST10513F12 (tigm) IST10116F8 (tigm)
IST11270D3 (tigm) IST14950E9 (tigm) IST10562C6 (tigm) IST14471D6 (tigm)
IST11448D9 (tigm) IST12667D5 (tigm) IST14452H3 (tigm) IST13150E6 (tigm)
IST14452H4 (tigm) IST13032A2 (tigm) IST10890F4 (tigm) IST10461D5 (tigm)
IST14421E10 (tigm) IST14435A9 (tigm) IST11481C11 (tigm) IST14215F11 (tigm)
IST13968A12 (tigm) IST10995H6 (tigm) IST12329B11 (tigm)
Private Clones OST180217 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1820
Vector Insertion
Chr 5: 123350360 - 123371393
Public Clones AL0304 (sanger) AB0140 (sanger) CA0031 (sanger) RRT430 (baygenomics)
XL516 (baygenomics) RRT156 (baygenomics) CMHD-GT_525B4-5S (cmhd) IST12188F10HMR1 (tigm)
IST12187D12HMR1 (tigm) IST14182B5 (tigm) IST11041E8 (tigm) IST12184E1HMR1 (tigm)
IST12172H12BBR1 (tigm) IST11792B7 (tigm) IST15060E8 (tigm) IST12188H9HMR1 (tigm)
IST14548B11 (tigm) IST11550D5 (tigm) IST10917G2 (tigm) IST12191G7HMR1 (tigm)
IST12187D12BBR1 (tigm) IST12830A10 (tigm) IST14455H7 (tigm) IST12184B6HMR1 (tigm)
IST10755F7 (tigm) IST10944G11 (tigm) IST10881D6 (tigm) IST12188F10BBR1 (tigm)
IST10917D7 (tigm) IST15012D3 (tigm) IST10837C12 (tigm) IST12179C8HMR1 (tigm)
IST12172H12HMR1 (tigm) IST14394H12 (tigm) IST14535A7 (tigm) IST12173H8HMR1 (tigm)
IST14423B10 (tigm) IST14418E11 (tigm) IST14992E7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18303
Vector Insertion
Chr 5: 123338764 - 123350157
Public Clones IST14308A4 (tigm) IST14968D5 (tigm)
Private Clones OST426129 (lexicon) OST365425 (lexicon) OST281318 (lexicon) OST210027 (lexicon)
OST43245 (lexicon)
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7450
Vector Insertion
Chr 5: 123333472 - 123338538
Public Clones PT032 (baygenomics) RRT043 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 48% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2996
Vector Insertion
Chr 5: 123331760 - 123331972
Public Clones XR0280 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 60% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7485
Vector Insertion
Chr 5: 123331068 - 123331645
Public Clones RRR004 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 63% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12912
Vector Insertion
Chr 5: 123321713 - 123321907
Public Clones CMHD-GT_496.1H6-3 (cmhd) CMHD-GT_344C3-3 (cmhd)
Private Clones OST380936 (lexicon) OST311549 (lexicon)
Severity of mutation (?) Insertion after 95% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36389
Vector Insertion
Chr 5: 123320687 - 123328663
Public Clones (ggtc) IST14794B12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 95% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000046073
Sequence
ATGGAGGCAGAGAAAGACTCTGGAAGAAGATTG - UNI13030 - - UNI15521 - - UNI31560 - - UNI33518 - CGTGCGATTGACCG

CCAGAGATACGACGAGAACGAAGACTTGTCGGACGTGGAGGAAATTGTCAGCGTCCGTGGCTTCAGCCTGGAGGAGAAGCTACGTAGCCAGTTATACCAG

GGGGACTTCGTGCATGCTATGGAAGGCAAAG - UNI15521 - ATTTTAACTATGAGTACGTACAGAGAGAAGCTCTCAGGGTCCCCCTGGTTTTTCG

GGACAAGGATGGACTAGGGATCAA - UNI15521 - - UNI19470 - GATGCCAGACCCTGATTTCACAGTCCGAGACGTCAAACTCCTGGTGG -

 UNI17114 - GGAGCCGCCGTTTGGTGGATGTCATGGACGTCAACACCCAGAAGGGTACCGAGATGAGCATGTCCCAGTTTGTGCGCTACTACGAGAC

ACCAGAGGCACAGCGGGATAAACTGTACAACGTCATCAGCCTCGAGTTCAGCCATACGAAGCTGGAGCATCTGGTCAAGCGTCCCACTGTG - UNI320

87 - GTGGACCTGGTCGACTGGGTGGACAACATGTGGCCTCAGCATCTAAAGGAAAAGCAGACAGAAGCCACCAATGCCCTTGCAGAGATGAAGTACCC

CAAAGTGAAAAA - UNI32087 - GTACTGTCTGATGAGCGTGAAGGGCTGTTTCACTGACTTCCACATTGACTTTGGAGGCACCTCCGTGTGGTACC

ATGTGTTCCGTGGTGGCAAG - UNI4017 - - UNI32087 - ATCTTTTGGCTGATCCCTCCAACCCTGCACAACTTGGCTTTGTACGAGGAGTGG

GTGCTGTCTGGCAAACAGAGCGACATCTTTCTGGGAGACCGCGTGGAACGCTGCCAAAGAATTGAGCTGAAGCAAGGCTACACCTTTTTCATCCCTTCCG

 - UNI24228 - - UNI36483 - GTTGGATCCATGCGGTTTATACGCCTGTGGACTCTCTGGTGTTCGGCGGGAACATCCTGCATAGCTTCAACGT

GCCCATGCAGCTGCGGATCTACGAGATCGAGGACAGGACCCGG - UNI36483 - GTTCAGCCCAAGTTCCGTTACCCCTTCTACTATGAGATGTGCT

GGTATGTCTTGGAGAGATATGTGTACTGTGTGACCCAGCGCTCCTACCTCACTCAGGAATACCAGAGAGAATTAATGCTTATTG - UNI36483 - AT

GCCCCAAGAAAAACCAGTGTAGACGGCTTTTCATCCGACTCCTGGCTGGACATGGAGGAGGAGTCCTGCGAGCAGCAGCCACAGGAGGAAGAGGAGGAGG

AGGAGGACAAGGAGGAGGAAGGAGATGGTGCAGATAAAACACCCAAGCCACCCACCGATGACCCCACCTCACCCACCAGCACCCCGCCCGAAGACCAGGA

CAGCACAGGGAAGAAGCCTAAAGCCCCTGCCATACGGTTCCTCAAGAGGACGTTGTCCAATGAGTCAGAGGAAAGTGTCAAGTCGACCTCGATGCCCACG

GACGATCCCAAGACGCCCACGGGCTCCCCGGCCACCGAGGTTTCTACCAAGTGGACTCACCTTACCGAATTTGAACTGAAGGGCTTGAAAGCCCTGGTTG

AAAAGCTAGAGTCCCTTCCGGAGAATAAGAAGTGTGTCCCTGAGGGAATCGAGGACCCCCAGGCCCTCCTGGAAGGTGTAAAG - UNI11698 - AAT

GTACTGAAAGAGCACGTGGATGACGACCCCACCCTGGCCATCACCGGGGTCCCTGTGGTCAGCTGGCCAAAGAAAACTGCAAAG - UNI1820 - - U

NI18303 - AACCGGGTGGTGGGTCGGCCTAAGGGCAAGTTGGGCCCGGCCTCAGCGGTGAAGTTGGCTGCCAACCGAACAACAGCAGGAGCTCGCAGG

CGCCGGACGCGATGCCGCAAGTGCGAGGCCTGCCTGCGGACGGAGTGTGGAGAGTGCCACTTTTGCAAGGACATGAAGAAGTTTGGAGGTCCTGGGCGCA

TGAAGCAGAGCTGCATCATGCGGCAGTGCATCGCG - UNI7450 - CCAGTGCTGCCCCACACCGCCGTGTGCCTTGTGTGTGGCGAGGCAGGGAAGG

AGGACACAGTGGAAGAGGAAGAAGGCAAGTTTAACCTCATGCTCATGGAATGCTCCATCTGCAACGAGATCATCCACCCTGGATGCCTTAAG ATTAAGG

AATCGGAGGGTGTGGTCAACGATGAGCTTCCCAACTGCTGGGAGTGTCCGAAGTGTAACCATGCCGGCAAGACCGGGAAA CAAAAGCGTGGCCCTGGCT

TTAAGTATGCCTCCAACCTGCCTGGCTCCTTGCTCAAGGAGCAGAAGATGAACCGGGACAACAAGGAAGGGCAAGAGCCTGCCAAGCGGAGAAGTGAGTG

TGAAGAGGCTCCCCGTCGGAGGTCAGACGAGCACCCCAAAAAGGTGCCTGCAGATGGCATCCTCCGCCGAAAGTCTGATGATGTGCACCTGAGGAGGAAG

CGGAAATACGAGAAGCCCCAAGAGCTGAGTGGACGCAAGCGA - UNI2996 - GCCTCGTCGCTTCAAACGTCCCCCGGTTCCTCCTCTCACCTCTCG

CCGAGGCCCCCTCTAGGCAGCAGTCTCAGCCCTTGGTGGAGATCCAGTCTCACTTACTTCCAGCAGCAG - UNI7485 - CTAAAACCTGGCAAAGAA

GATAAGCTTTTCAGGAAAAAG CGGCGGTCCTGGAAGAACGCTGAGGATCGTCTGTCACTGGCCAACAAGCCCCTTCGGCGCTTTAAGCAGGAACCGGAG

GACGATCTGCCTGAGGCACCTCCTAAGACCCGGGAGAGTGATCAGTCACGTTCCAGCTCACCCACTGCTGGTCCCAGCACTGAGGGAGCTGAAGGCCCAG

AAGAGAAGAAAAAGGTGAAGATGCGCCGGAAGCGGCGACTTGTTAACAAGGAGCTGAGCAAAGAGCTAAGCAAGGAGCTCAACCATGAGATCCAAAAGAC

GGAGAGCACCCTGGCTCACGAGAGCCAGCAGCCCATCAAGTCAGAGCCTGAGAGCGAGAACGACGAGCCCAAGAGGCCCTTAAGCCACTGCGAGCGCCCC

CACCGCTTCAGCAAAGGGCTCAACGGCACACCTCGGGAGCTGCGGCACTCGCTGGGACCTGGCCTGCGTAGTCCACCTCGTGTTATGTCCCGGCCCCCGC

CCTCTGCATCCCCACCCAAGTGCATCCAGATGGAGCGTCACGTGATCCGGCCACCGCCCATCAGCCCCCCACCTGACTCGCTGCCCCTGGATGATGGAGC

AGCCCACGTCATGCATAGGGAGGTGTGGATGGCAGTCTTCAGCTACCTCAGCCACCGAGACCTGTGTGTCTGCATGCGGGTCTGCAGGACCTGGAACCGC

TG GTGCTGCGATAAGCGGTTGTGGACCCGCATCGACCTGAACCGCTGCAAGTCCATCACACCCCTGATGCTGAGCGGTATCATCCGGCGACAGCCTGTC

TCCCTTGACCTCAGTTGGACCAACATCTCCAAGAAGCAGCTGAGTTGGCTCATCAACCGGTTGCCTG GGCTCCGAGACTTGGTGCTGTCAGGCTGCTCA

TGGATCGCTGTCTCAGCCCTCTGTAGCTCCAGTTGTCCATTGCTCCGGACCCTGGATGTCCAGTGGGTAGAAGGACTAAAGGATGCCCAGATGAGGGATC

TCCTGTCTCCACCCACAGACAACAGGCCAG - UNI36389 - GTCAGATGGACAATCGGAGCAAGCTCCGGAACATTGTAGAGCTGCGCCTAGCTGGC

CTGGACATCACAGATGTCTCCCTGCGGCTCATTATTCGCCATATGCCCCTGCTCTCGAAGCTCCAACTCAGTTACTGTAACCACATCAATGACCAGTCCA

TCAACCTGCTCACTGCCGTCGGCACCACCACCCGAGACTCGCTGACAGAGGTCAACCTATCAG - UNI12912 - - UNI36389 - ACTGTAATAA

GGTAACTGACCTGTGCCTGTCCTTCTTCAAACGCTGTGGAAATATCTGTCATATTGACCTGAGGTACTGCAAGCAAGTCACCAAGGAAGGCTGTGAGCAA

TTCATAGCTGAAATGTCTGTGAGTGTCCAATTTGGGCAAGTGGAAGAGAAACTCCTGCAAAAACTAAGTTAGTTCCAGGACAAGTATGTAAATATGGAGG

GTTGGGGGGAATACAACCAGGAAGGGTGAAAGACTGCAAAATCAAGTGGGCCTATTATTTCCCTTTGGAATTTGAAACAAGAGACTACAGGACACAGTTC

TGTTTTGCAAATCTTGCCAAGGGGGAAGCCATTCAACCACCCATTTTGGGATGAGTGAGCCAGATGTTTTCCTTTGCTCTTTCTGCATCGTAACTGCACT

GCTTTCTGGACCATTTCTAAGGCGGCCTTTAGAAGACATTCCAATTGGAAAGGAAGATGAGCTTTGGAGAAATCCTCTTAGAAGCCTAAGCTTGGTGTTT

TTATCAGTAGTTTTTGTTTGGGGCACTTGTTCCTTGCAATGCTGAGGCTTCTGGCGTCAACATGGAGTGGACCACACACACACCATCTGCAGCCGTCGTT

GATACATTTTGTTTAGTTGGTTTTGTTACATCTTACATTATGCAGAACTATTTTTGTATAAATTGTTTAAAAATTATTTATGGGAGATTTGAATGCATAC

CAGTGTTTTTATTATTTAGATTGCCAACTGTCCTTCAGGTAGGAGAGTTAACCTGTACTATGTCAGCATAAAAAGCCCATCTCCAGATGTGCCCAGGTGT

GACAGGGGGCTATGACCTTCCACTTAAAAAGCATGTTTAACTGGATGCTGAGAGCCTACTGTGTATGTCAAGAAGCTACACAAGCATGTTGTGGATATGT

GTAAAGTATAGTCCAGGTAAAACACTTTGCCAAGTTTCAATAGACTTCACCTCTCCCTCAGACTTGAGCCTTTACACTCAGGAGGGTTTGCTCCAAGCAT

GAGCTCTTGTATTCTACTTACATAGGTCTAATTTATACCAAGAATCAGGTAGAATAAATGTGCCCACACCCTCTCCTTTGTCCTCCTCCTCTCAAGTGTT

CAGTTCTCACTTTAGTTGGTAAGTTCTGCATCCCTTGTTGTTTGGTGGTGTTTCCTAACCTTTCCCTGATGCAGTTTGACCTTTGTTGGATTTATATAAA

CAATTGT
Translation
MEAEKDSGRRL - UNI13030 - - UNI15521 - - UNI31560 - - UNI33518 - RAIDRQRYDENEDLSDVEEIVSVRGFSLEEKLRSQL

YQGDFVHAMEGKD - UNI15521 - DFNYEYVQREALRVPLVFRDKDGLGIK - UNI15521 - - UNI19470 - KMPDPDFTVRDVKLLVG -

 UNI17114 - GSRRLVDVMDVNTQKGTEMSMSQFVRYYETPEAQRDKLYNVISLEFSHTKLEHLVKRPTV - UNI32087 - VDLVDWVDNMWPQH

LKEKQTEATNALAEMKYPKVKK - UNI32087 - KYCLMSVKGCFTDFHIDFGGTSVWYHVFRGGK - UNI4017 - - UNI32087 - IFWLIP

PTLHNLALYEEWVLSGKQSDIFLGDRVERCQRIELKQGYTFFIPSG - UNI24228 - - UNI36483 - GWIHAVYTPVDSLVFGGNILHSFNVPM

QLRIYEIEDRTR - UNI36483 - VQPKFRYPFYYEMCWYVLERYVYCVTQRSYLTQEYQRELMLID - UNI36483 - DAPRKTSVDGFSSDSWL

DMEEESCEQQPQEEEEEEEDKEEEGDGADKTPKPPTDDPTSPTSTPPEDQDSTGKKPKAPAIRFLKRTLSNESEESVKSTSMPTDDPKTPTGSPATEVST

KWTHLTEFELKGLKALVEKLESLPENKKCVPEGIEDPQALLEGVK - UNI11698 - NVLKEHVDDDPTLAITGVPVVSWPKKTAK - UNI1820 -

 - UNI18303 - NRVVGRPKGKLGPASAVKLAANRTTAGARRRRTRCRKCEACLRTECGECHFCKDMKKFGGPGRMKQSCIMRQCIA - UNI7450 

- PVLPHTAVCLVCGEAGKEDTVEEEEGKFNLMLMECSICNEIIHPGCLK IKESEGVVNDELPNCWECPKCNHAGKTGK QKRGPGFKYASNLPGSLLK

EQKMNRDNKEGQEPAKRRSECEEAPRRRSDEHPKKVPADGILRRKSDDVHLRRKRKYEKPQELSGRKR - UNI2996 - ASSLQTSPGSSSHLSPRPP

LGSSLSPWWRSSLTYFQQQ - UNI7485 - LKPGKEDKLFRKK RRSWKNAEDRLSLANKPLRRFKQEPEDDLPEAPPKTRESDQSRSSSPTAGPSTE

GAEGPEEKKKVKMRRKRRLVNKELSKELSKELNHEIQKTESTLAHESQQPIKSEPESENDEPKRPLSHCERPHRFSKGLNGTPRELRHSLGPGLRSPPRV

MSRPPPSASPPKCIQMERHVIRPPPISPPPDSLPLDDGAAHVMHREVWMAVFSYLSHRDLCVCMRVCRTWNRW WCCDKRLWTRIDLNRCKSITPLMLSG

IIRRQPVSLDLSWTNISKKQLSWLINRLPG GLRDLVLSGCSWIAVSALCSSSCPLLRTLDVQWVEGLKDAQMRDLLSPPTDNRPG - UNI36389 - 

GQMDNRSKLRNIVELRLAGLDITDVSLRLIIRHMPLLSKLQLSYCNHINDQSINLLTAVGTTTRDSLTEVNLSD - UNI12912 - - UNI36389 -

 DCNKVTDLCLSFFKRCGNICHIDLRYCKQVTKEGCEQFIAEMSVSVQFGQVEEKLLQKLS
Transcript ENSMUST00000118027
Sequence
CCAACAACAAAACAGCGATGCCAAGGCGCTAACAGCGCCCGGTGCGTCCCAGGCTCCCTTCTGGCCCCACACCTCCTACGGCTGCGGTCCCCGACACCCC

CAACCCGAGCCCCCCCTTTCCCCAACTAGCCTAGCCGCAAGCTCCGAGCGCGATCGGCAACAATGTTTACGTTCCGGGGATTATGACGTCGACGCCTCCC

CCCCCACAACTGCTGAAAATGGTTTCCTAGGACTTTGCAAACGGATCTGCTTAAGTGTTGGTGCAAAACTTTGTAGATATCGGCTCTGGCTTGCTCTATT

TATTTATTTTTTTGCTTTCTTTTCTTTGGTCTTCCCTCCTTTCCCCCTCCGCCAAAATGCAGGGGGCAGGAGTGTTGACAATTAATTGGTGAACTCTCCT

AAAAAAATGGAGGCAGAGAAAGACTCTGGAAGAAGATTG - UNI13030 - - UNI15521 - - UNI31560 - - UNI33518 - CGTGCGAT

TGACCGCCAGAGATACGACGAGAACGAAGACTTGTCGGACGTGGAGGAAATTGTCAGCGTCCGTGGCTTCAGCCTGGAGGAGAAGCTACGTAGCCAGTTA

TACCAGGGGGACTTCGTGCATGCTATGGAAGGCAAAG - UNI15521 - ATTTTAACTATGAGTACGTACAGAGAGAAGCTCTCAGGGTCCCCCTGGT

TTTTCGGGACAAGGATGGACTAGGGATCAA - UNI15521 - - UNI19470 - GATGCCAGACCCTGATTTCACAGTCCGAGACGTCAAACTCCTG

GTGG - UNI17114 - GGAGCCGCCGTTTGGTGGATGTCATGGACGTCAACACCCAGAAGGGTACCGAGATGAGCATGTCCCAGTTTGTGCGCTACTA

CGAGACACCAGAGGCACAGCGGGATAAACTGTACAACGTCATCAGCCTCGAGTTCAGCCATACGAAGCTGGAGCATCTGGTCAAGCGTCCCACTGTG - 

UNI32087 - GTGGACCTGGTCGACTGGGTGGACAACATGTGGCCTCAGCATCTAAAGGAAAAGCAGACAGAAGCCACCAATGCCCTTGCAGAGATGAA

GTACCCCAAAGTGAAAAA - UNI32087 - GTACTGTCTGATGAGCGTGAAGGGCTGTTTCACTGACTTCCACATTGACTTTGGAGGCACCTCCGTGT

GGTACCATGTGTTCCGTGGTGGCAAG - UNI4017 - - UNI32087 - ATCTTTTGGCTGATCCCTCCAACCCTGCACAACTTGGCTTTGTACGAG

GAGTGGGTGCTGTCTGGCAAACAGAGCGACATCTTTCTGGGAGACCGCGTGGAACGCTGCCAAAGAATTGAGCTGAAGCAAGGCTACACCTTTTTCATCC

CTTCCG - UNI24228 - - UNI36483 - GTTGGATCCATGCGGTTTATACGCCTGTGGACTCTCTGGTGTTCGGCGGGAACATCCTGCATAGCTT

CAACGTGCCCATGCAGCTGCGGATCTACGAGATCGAGGACAGGACCCGG - UNI36483 - GTTCAGCCCAAGTTCCGTTACCCCTTCTACTATGAGA

TGTGCTGGTATGTCTTGGAGAGATATGTGTACTGTGTGACCCAGCGCTCCTACCTCACTCAGGAATACCAGAGAGAATTAATGCTTATTG - UNI3648

3 - ATGCCCCAAGAAAAACCAGTGTAGACGGCTTTTCATCCGACTCCTGGCTGGACATGGAGGAGGAGTCCTGCGAGCAGCAGCCACAGGAGGAAGAGG

AGGAGGAGGAGGACAAGGAGGAGGAAGGAGATGGTGCAGATAAAACACCCAAGCCACCCACCGATGACCCCACCTCACCCACCAGCACCCCGCCCGAAGA

CCAGGACAGCACAGGGAAGAAGCCTAAAGCCCCTGCCATACGGTTCCTCAAGAGGACGTTGTCCAATGAGTCAGAGGAAAGTGTCAAGTCGACCTCGATG

CCCACGGACGATCCCAAGACGCCCACGGGCTCCCCGGCCACCGAGGTTTCTACCAAGTGGACTCACCTTACCGAATTTGAACTGAAGGGCTTGAAAGCCC

TGGTTGAAAAGCTAGAGTCCCTTCCGGAGAATAAGAAGTGTGTCCCTGAGGGAATCGAGGACCCCCAGGCCCTCCTGGAAGGTGTAAAG - UNI11698

 - AATGTACTGAAAGAGCACGTGGATGACGACCCCACCCTGGCCATCACCGGGGTCCCTGTGGTCAGCTGGCCAAAGAAAACTGCAAAG - UNI1820

 - - UNI18303 - AACCGGGTGGTGGGTCGGCCTAAGGGCAAGTTGGGCCCGGCCTCAGCGGTGAAGTTGGCTGCCAACCGAACAACAGCAGGAGCT

CGCAGGCGCCGGACGCGATGCCGCAAGTGCGAGGCCTGCCTGCGGACGGAGTGTGGAGAGTGCCACTTTTGCAAGGACATGAAGAAGTTTGGAGGTCCTG

GGCGCATGAAGCAGAGCTGCATCATGCGGCAGTGCATCGCG - UNI7450 - CCAGTGCTGCCCCACACCGCCGTGTGCCTTGTGTGTGGCGAGGCAG

GGAAGGAGGACACAGTGGAAGAGGAAGAAGGCAAGTTTAACCTCATGCTCATGGAATGCTCCATCTGCAACGAGATCATCCACCCTGGATGCCTTAAG A

TTAAGGAATCGGAGGGTGTGGTCAACGATGAGCTTCCCAACTGCTGGGAGTGTCCGAAGTGTAACCATGCCGGCAAGACCGGGAAA CAAAAGCGTGGCC

CTGGCTTTAAGTATGCCTCCAACCTGCCTGGCTCCTTGCTCAAGGAGCAGAAGATGAACCGGGACAACAAGGAAGGGCAAGAGCCTGCCAAGCGGAGAAG

TGAGTGTGAAGAGGCTCCCCGTCGGAGGTCAGACGAGCACCCCAAAAAGGTGCCTGCAGATGGCATCCTCCGCCGAAAGTCTGATGATGTGCACCTGAGG

AGGAAGCGGAAATACGAGAAGCCCCAAGAGCTGAGTGGACGCAAGCGA - UNI2996 - - UNI7485 - CTAAAACCTGGCAAAGAAGATAAGCTT

TTCAGGAAAAAG CGGCGGTCCTGGAAGAACGCTGAGGATCGTCTGTCACTGGCCAACAAGCCCCTTCGGCGCTTTAAGCAGGAACCGGAGGACGATCTG

CCTGAGGCACCTCCTAAGACCCGGGAGAGTGATCAGTCACGTTCCAGCTCACCCACTGCTGGTCCCAGCACTGAGGGAGCTGAAGGCCCAGAAGAGAAGA

AAAAGGTGAAGATGCGCCGGAAGCGGCGACTTGTTAACAAGGAGCTGAGCAAAGAGCTAAGCAAGGAGCTCAACCATGAGATCCAAAAGACGGAGAGCAC

CCTGGCTCACGAGAGCCAGCAGCCCATCAAGTCAGAGCCTGAGAGCGAGAACGACGAGCCCAAGAGGCCCTTAAGCCACTGCGAGCGCCCCCACCGCTTC

AGCAAAGGGCTCAACGGCACACCTCGGGAGCTGCGGCACTCGCTGGGACCTGGCCTGCGTAGTCCACCTCGTGTTATGTCCCGGCCCCCGCCCTCTGCAT

CCCCACCCAAGTGCATCCAGATGGAGCGTCACGTGATCCGGCCACCGCCCATCAGCCCCCCACCTGACTCGCTGCCCCTGGATGATGGAGCAGCCCACGT

CATGCATAGGGAGGTGTGGATGGCAGTCTTCAGCTACCTCAGCCACCGAGACCTGTGTGTCTGCATGCGGGTCTGCAGGACCTGGAACCGCTG GTGCTG

CGATAAGCGGTTGTGGACCCGCATCGACCTGAACCGCTGCAAGTCCATCACACCCCTGATGCTGAGCGGTATCATCCGGCGACAGCCTGTCTCCCTTGAC

CTCAGTTGGACCAACATCTCCAAGAAGCAGCTGAGTTGGCTCATCAACCGGTTGCCTG GGCTCCGAGACTTGGTGCTGTCAGGCTGCTCATGGATCGCT

GTCTCAGCCCTCTGTAGCTCCAGTTGTCCATTGCTCCGGACCCTGGATGTCCAGTGGGTAGAAGGACTAAAGGATGCCCAGATGAGGGATCTCCTGTCTC

CACCCACAGACAACAGGCCAG - UNI36389 - GTCAGATGGACAATCGGAGCAAGCTCCGGAACATTGTAGAGCTGCGCCTAGCTGGCCTGGACATC

ACAGATGTCTCCCTGCGGCTCATTATTCGCCATATGCCCCTGCTCTCGAAGCTCCAACTCAGTTACTGTAACCACATCAATGACCAGTCCATCAACCTGC

TCACTGCCGTCGGCACCACCACCCGAGACTCGCTGACAGAGGTCAACCTATCAG - UNI12912 - - UNI36389 - ACTGTAATAAGGTAACTGA

CCTGTGCCTGTCCTTCTTCAAACGCTGTGGAAATATCTGTCATATTGACCTGAGGTACTGCAAGCAAGTCACCAAGGAAGGCTGTGAGCAATTCATAGCT

GAAATGTCTGTGAGTGTCCAATTTGGGCAAGTGGAAGAGAAACTCCTGCAAAAACTAAGTTAGTTCCAGGACAAGTATGTAAATATGGAGGGTTGGGGGG

AATACAACCAGGAAGGGTGAAAGACTGCAAAATCAAGTGGGCCTATTATTTCCCTTTGGAATTTGAAACAAGAGACTACAGGACACAGTTCTGTTTTGCA

AATCTTGCCAAGGGGGAAGCCATTCAACCACCCATTTTGGGATGAGTGAGCCAGATGTTTTCCTTTGCTCTTTCTGCATCGTAACTGCACTGCTTTCTGG

ACCATTTCTAAGGCGGCCTTTAGAAGACATTCCAATTGGAAAGGAAGATGAGCTTTGGAGAAATCCTCTTAGAAGCCTAAGCTTGGTGTTTTTATCAGTA

GTTTTTGTTTGGGGCACTTGTTCCTTGCAATGCTGAGGCTTCTGGCGTCAACATGGAGTGGACCACACACACACCATCTGCAGCCGTCGTTGATACATTT

TGTTTAGTTGGTTTTGTTACATCTTACATTATGCAGAACTATTTTTGTATAAATTGTTTAAAAATTATTTATGGGAGATTTGAATGCATACCAGTGTTTT

TATTATTTAGATTGCCAACTGTCCTTCAGGTAGGAGAGTTAACCTGTACTATGTCAGCATAAAAAGCCCATCTCCAGATGTGCCCAGGTGTGACAGGGGG

CTATGACCTTCCACTTAAAAAGCATGTTTAACTGGATGCTGAGAGCCTACTGTGTATGTCAAGAAGCTACACAAGCATGTTGTGGATATGTGTAAAGTAT

AGTCCAGGTAAAACACTTTGCCAAGTTTCAATAGACTTCACCTCTCCCTCAGACTTGAGCCTTTACACTCAGGAGGGTTTGCTCCAAGCATGAGCTCTTG

TATTCTACTTACATAGGTCTAATTTATACCAAGAATCAGGTAGAATAAATGTGCCCACACCCTCTCCTTTGTCCTCCTCCTCTCAAGTGTTCAGTTCTCA

CTTTAGTTGGTAAGTTCTGCATCCCTTGTTGTTTGGTGGTGTTTCCTAACCTTTCCCTGATGCAGTTTGACCTTTGTTGGATTTATATAAACAATTGTAC

Translation
MEAEKDSGRRL - UNI13030 - - UNI15521 - - UNI31560 - - UNI33518 - RAIDRQRYDENEDLSDVEEIVSVRGFSLEEKLRSQL

YQGDFVHAMEGKD - UNI15521 - DFNYEYVQREALRVPLVFRDKDGLGIK - UNI15521 - - UNI19470 - KMPDPDFTVRDVKLLVG -

 UNI17114 - GSRRLVDVMDVNTQKGTEMSMSQFVRYYETPEAQRDKLYNVISLEFSHTKLEHLVKRPTV - UNI32087 - VDLVDWVDNMWPQH

LKEKQTEATNALAEMKYPKVKK - UNI32087 - KYCLMSVKGCFTDFHIDFGGTSVWYHVFRGGK - UNI4017 - - UNI32087 - IFWLIP

PTLHNLALYEEWVLSGKQSDIFLGDRVERCQRIELKQGYTFFIPSG - UNI24228 - - UNI36483 - GWIHAVYTPVDSLVFGGNILHSFNVPM

QLRIYEIEDRTR - UNI36483 - VQPKFRYPFYYEMCWYVLERYVYCVTQRSYLTQEYQRELMLID - UNI36483 - DAPRKTSVDGFSSDSWL

DMEEESCEQQPQEEEEEEEDKEEEGDGADKTPKPPTDDPTSPTSTPPEDQDSTGKKPKAPAIRFLKRTLSNESEESVKSTSMPTDDPKTPTGSPATEVST

KWTHLTEFELKGLKALVEKLESLPENKKCVPEGIEDPQALLEGVK - UNI11698 - NVLKEHVDDDPTLAITGVPVVSWPKKTAK - UNI1820 -

 - UNI18303 - NRVVGRPKGKLGPASAVKLAANRTTAGARRRRTRCRKCEACLRTECGECHFCKDMKKFGGPGRMKQSCIMRQCIA - UNI7450 

- PVLPHTAVCLVCGEAGKEDTVEEEEGKFNLMLMECSICNEIIHPGCLK IKESEGVVNDELPNCWECPKCNHAGKTGK QKRGPGFKYASNLPGSLLK

EQKMNRDNKEGQEPAKRRSECEEAPRRRSDEHPKKVPADGILRRKSDDVHLRRKRKYEKPQELSGRKR - UNI2996 - - UNI7485 - LKPGKED

KLFRKK RRSWKNAEDRLSLANKPLRRFKQEPEDDLPEAPPKTRESDQSRSSSPTAGPSTEGAEGPEEKKKVKMRRKRRLVNKELSKELSKELNHEIQKT

ESTLAHESQQPIKSEPESENDEPKRPLSHCERPHRFSKGLNGTPRELRHSLGPGLRSPPRVMSRPPPSASPPKCIQMERHVIRPPPISPPPDSLPLDDGA

AHVMHREVWMAVFSYLSHRDLCVCMRVCRTWNRW WCCDKRLWTRIDLNRCKSITPLMLSGIIRRQPVSLDLSWTNISKKQLSWLINRLPG GLRDLVLS

GCSWIAVSALCSSSCPLLRTLDVQWVEGLKDAQMRDLLSPPTDNRPG - UNI36389 - GQMDNRSKLRNIVELRLAGLDITDVSLRLIIRHMPLLSK

LQLSYCNHINDQSINLLTAVGTTTRDSLTEVNLSD - UNI12912 - - UNI36389 - DCNKVTDLCLSFFKRCGNICHIDLRYCKQVTKEGCEQF

IAEMSVSVQFGQVEEKLLQKLS
Transcript ENSMUST00000086200
Sequence
GTGGTGGGGGAGTCTCCTTAGGAAGTGAGTGTGCGCGCGCGCTCGTGGGGAGATGAGGCAGCTGCTG - UNI13030 - - UNI15521 - - UNI3

1560 - CGTGCGATTGACCGCCAGAGATACGACGAGAACGAAGACTTGTCGGACGTGGAGGAAATTGTCAGCGTCCGTGGCTTCAGCCTGGAGGAGAAG

CTACGTAGCCAGTTATACCAGGGGGACTTCGTGCATGCTATGGAAGGCAAAG - UNI15521 - ATTTTAACTATGAGTACGTACAGAGAGAAGCTCT

CAGGGTCCCCCTGGTTTTTCGGGACAAGGATGGACTAGGGATCAA - UNI15521 - - UNI19470 - GATGCCAGACCCTGATTTCACAGTCCGA

GACGTCAAACTCCTGGTGG - UNI17114 - GGAGCCGCCGTTTGGTGGATGTCATGGACGTCAACACCCAGAAGGGTACCGAGATGAGCATGTCCCA

GTTTGTGCGCTACTACGAGACACCAGAGGCACAGCGGGATAAACTGTACAACGTCATCAGCCTCGAGTTCAGCCATACGAAGCTGGAGCATCTGGTCAAG

CGTCCCACTGTG - UNI32087 - GTGGACCTGGTCGACTGGGTGGACAACATGTGGCCTCAGCATCTAAAGGAAAAGCAGACAGAAGCCACCAATGC

CCTTGCAGAGATGAAGTACCCCAAAGTGAAAAA - UNI32087 - GTACTGTCTGATGAGCGTGAAGGGCTGTTTCACTGACTTCCACATTGACTTTG

GAGGCACCTCCGTGTGGTACCATGTGTTCCGTGGTGGCAAG - UNI4017 - - UNI32087 - ATCTTTTGGCTGATCCCTCCAACCCTGCACAAC

TTGGCTTTGTACGAGGAGTGGGTGCTGTCTGGCAAACAGAGCGACATCTTTCTGGGAGACCGCGTGGAACGCTGCCAAAGAATTGAGCTGAAGCAAGGCT

ACACCTTTTTCATCCCTTCCG - UNI24228 - - UNI36483 - GTTGGATCCATGCGGTTTATACGCCTGTGGACTCTCTGGTGTTCGGCGGGAA

CATCCTGCATAGCTTCAACGTGCCCATGCAGCTGCGGATCTACGAGATCGAGGACAGGACCCGG - UNI36483 - GTTCAGCCCAAGTTCCGTTACC

CCTTCTACTATGAGATGTGCTGGTATGTCTTGGAGAGATATGTGTACTGTGTGACCCAGCGCTCCTACCTCACTCAGGAATACCAGAGAGAATTAATGCT

TATTG - UNI36483 - ATGCCCCAAGAAAAACCAGTGTAGACGGCTTTTCATCCGACTCCTGGCTGGACATGGAGGAGGAGTCCTGCGAGCAGCAGC

CACAGGAGGAAGAGGAGGAGGAGGAGGACAAGGAGGAGGAAGGAGATGGTGCAGATAAAACACCCAAGCCACCCACCGATGACCCCACCTCACCCACCAG

CACCCCGCCCGAAGACCAGGACAGCACAGGGAAGAAGCCTAAAGCCCCTGCCATACGGTTCCTCAAGAGGACGTTGTCCAATGAGTCAGAGGAAAGTGTC

AAGTCGACCTCGATGCCCACGGACGATCCCAAGACGCCCACGGGCTCCCCGGCCACCGAGGTTTCTACCAAGTGGACTCACCTTACCGAATTTGAACTGA

AGGGCTTGAAAGCCCTGGTTGAAAAGCTAGAGTCCCTTCCGGAGAATAAGAAGTGTGTCCCTGAGGGAATCGAGGACCCCCAGGCCCTCCTGGAAGGTGT

AAAG - UNI11698 - AATGTACTGAAAGAGCACGTGGATGACGACCCCACCCTGGCCATCACCGGGGTCCCTGTGGTCAGCTGGCCAAAGAAAACTG

CAAAG - UNI1820 - - UNI18303 - AACCGGGTGGTGGGTCGGCCTAAGGGCAAGTTGGGCCCGGCCTCAGCGGTGAAGTTGGCTGCCAACCGA

ACAACAGCAGGAGCTCGCAGGCGCCGGACGCGATGCCGCAAGTGCGAGGCCTGCCTGCGGACGGAGTGTGGAGAGTGCCACTTTTGCAAGGACATGAAGA

AGTTTGGAGGTCCTGGGCGCATGAAGCAGAGCTGCATCATGCGGCAGTGCATCGCG - UNI7450 - CCAGTGCTGCCCCACACCGCCGTGTGCCTTG

TGTGTGGCGAGGCAGGGAAGGAGGACACAGTGGAAGAGGAAGAAGGCAAGTTTAACCTCATGCTCATGGAATGCTCCATCTGCAACGAGATCATCCACCC

TGGATGCCTTAAG ATTAAGGAATCGGAGGGTGTGGTCAACGATGAGCTTCCCAACTGCTGGGAGTGTCCGAAGTGTAACCATGCCGGCAAGACCGGGAA

A CAAAAGCGTGGCCCTGGCTTTAAGTATGCCTCCAACCTGCCTGGCTCCTTGCTCAAGGAGCAGAAGATGAACCGGGACAACAAGGAAGGGCAAGAGCC

TGCCAAGCGGAGAAGTGAGTGTGAAGAGGCTCCCCGTCGGAGGTCAGACGAGCACCCCAAAAAGGTGCCTGCAGATGGCATCCTCCGCCGAAAGTCTGAT

GATGTGCACCTGAGGAGGAAGCGGAAATACGAGAAGCCCCAAGAGCTGAGTGGACGCAAGCGA - UNI2996 - GCCTCGTCGCTTCAAACGTCCCCC

GGTTCCTCCTCTCACCTCTCGCCGAGGCCCCCTCTAGGCAGCAGTCTCAGCCCTTGGTGGAGATCCAGTCTCACTTACTTCCAGCAGCAG - UNI7485

 - CTAAAACCTGGCAAAGAAGATAAGCTTTTCAGGAAAAAG CGGCGGTCCTGGAAGAACGCTGAGGATCGTCTGTCACTGGCCAACAAGCCCCTTCGG

CGCTTTAAGCAGGAACCGGAGGACGATCTGCCTGAGGCACCTCCTAAGACCCGGGAGAGTGATCAGTCACGTTCCAGCTCACCCACTGCTGGTCCCAGCA

CTGAGGGAGCTGAAGGCCCAGAAGAGAAGAAAAAGGTGAAGATGCGCCGGAAGCGGCGACTTGTTAACAAGGAGCTGAGCAAAGAGCTAAGCAAGGAGCT

CAACCATGAGATCCAAAAGACGGAGAGCACCCTGGCTCACGAGAGCCAGCAGCCCATCAAGTCAGAGCCTGAGAGCGAGAACGACGAGCCCAAGAGGCCC

TTAAGCCACTGCGAGCGCCCCCACCGCTTCAGCAAAGGGCTCAACGGCACACCTCGGGAGCTGCGGCACTCGCTGGGACCTGGCCTGCGTAGTCCACCTC

GTGTTATGTCCCGGCCCCCGCCCTCTGCATCCCCACCCAAGTGCATCCAGATGGAGCGTCACGTGATCCGGCCACCGCCCATCAGCCCCCCACCTGACTC

GCTGCCCCTGGATGATGGAGCAGCCCACGTCATGCATAGGGAGGTGTGGATGGCAGTCTTCAGCTACCTCAGCCACCGAGACCTGTGTGTCTGCATGCGG

GTCTGCAGGACCTGGAACCGCTG GTGCTGCGATAAGCGGTTGTGGACCCGCATCGACCTGAACCGCTGCAAGTCCATCACACCCCTGATGCTGAGCGGT

ATCATCCGGCGACAGCCTGTCTCCCTTGACCTCAGTTGGACCAACATCTCCAAGAAGCAGCTGAGTTGGCTCATCAACCGGTTGCCTG GGCTCCGAGAC

TTGGTGCTGTCAGGCTGCTCATGGATCGCTGTCTCAGCCCTCTGTAGCTCCAGTTGTCCATTGCTCCGGACCCTGGATGTCCAGTGGGTAGAAGGACTAA

AGGATGCCCAGATGAGGGATCTCCTGTCTCCACCCACAGACAACAGGCCAG - UNI36389 - GTCAGATGGACAATCGGAGCAAGCTCCGGAACATT

GTAGAGCTGCGCCTAGCTGGCCTGGACATCACAGATGTCTCCCTGCGGCTCATTATTCGCCATATGCCCCTGCTCTCGAAGCTCCAACTCAGTTACTGTA

ACCACATCAATGACCAGTCCATCAACCTGCTCACTGCCGTCGGCACCACCACCCGAGACTCGCTGACAGAGGTCAACCTATCAG - UNI12912 - - 

UNI36389 - ACTGTAATAAGGTAACTGACCTGTGCCTGTCCTTCTTCAAACGCTGTGGAAATATCTGTCATATTGACCTGAGGTACTGCAAGCAAGTC

ACCAAGGAAGGCTGTGAGCAATTCATAGCTGAAATGTCTGTGAGTGTCCAATTTGGGCAAGTGGAAGAGAAACTCCTGCAAAAACTAAGTTAGTTCCAGG

ACAAGTATGTAAATATGGAGGGTTGGGGGGAATACAACCAGGAAGGGTGAAAGACTGCAAAATCAAGTGGGCCTATTATTTCCCTTTGGAATTTGAAACA

AGAGACTACAGGACACAGTTCTGTTTTGCAAATCTTGCCAAGGGGGAAGCCATTCAACCACCCATTTTGGGATGAGTGAGCCAGATGTTTTCCTTTGCTC

TTTCTGCATCGTAACTGCACTGCTTTCTGGACCATTTCTAAGGCGGCCTTTAGAAGACATTCCAATTGGAAAGGAAGATGAGCTTTGGAGAAATCCTCTT

AGAAGCCTAAGCTTGGTGTTTTTATCAGTAGTTTTTGTTTGGGGCACTTGTTCCTTGCAATGCTGAGGCTTCTGGCGTCAACATGGAGTGGACCACACAC

ACACCATCTGCAGCCGTCGTTGATACATTTTGTTTAGTTGGTTTTGTTACATCTTACATTATGCAGAACTATTTTTGTATAAATTGTTTAAAAATTATTT

ATGGGAGATTTGAATGCATACCAGTGTTTTTATTATTTAGATTGCCAACTGTCCTTCAGGTAGGAGAGTTAACCTGTACTATGTCAGCATAAAAAGCCCA

TCTCCAGATGTGCCCAGGTGTGACAGGGGGCTATGACCTTCCACTTAAAAAGCATGTTTAACTGGATGCTGAGAGCCTACTGTGTATGTCAAGAAGCTAC

ACAAGCATGTTGTGGATATGTGTAAAGTATAGTCCAGGTAAAACACTTTGCCAAGTTTCAATAGACTTCACCTCTCCCTCAGACTTGAGCCTTTACACTC

AGGAGGGTTTGCTCCAAGCATGAGCTCTTGTATTCTACTTACATAGGTCTAATTTATACCAAGAATCAGGTAGAATAAATGTGCCCACACCCTCTCCTTT

GTCCTCCTCCTCTCAAGTGTTCAGTTCTCACTTTAGTTGGTAAGTTCTGCATCCCTTGTTGTTTGGTGGTGTTTCCTAACCTTTCCCTGATGCAGTTTGA

CCTTTGTTGGATTTATATAAACAATTGT
Translation
MRQLL - UNI13030 - - UNI15521 - - UNI31560 - RAIDRQRYDENEDLSDVEEIVSVRGFSLEEKLRSQLYQGDFVHAMEGKD - UNI

15521 - DFNYEYVQREALRVPLVFRDKDGLGIK - UNI15521 - - UNI19470 - KMPDPDFTVRDVKLLVG - UNI17114 - GSRRLVD

VMDVNTQKGTEMSMSQFVRYYETPEAQRDKLYNVISLEFSHTKLEHLVKRPTV - UNI32087 - VDLVDWVDNMWPQHLKEKQTEATNALAEMKYPK

VKK - UNI32087 - KYCLMSVKGCFTDFHIDFGGTSVWYHVFRGGK - UNI4017 - - UNI32087 - IFWLIPPTLHNLALYEEWVLSGKQS

DIFLGDRVERCQRIELKQGYTFFIPSG - UNI24228 - - UNI36483 - GWIHAVYTPVDSLVFGGNILHSFNVPMQLRIYEIEDRTR - UNI3

6483 - VQPKFRYPFYYEMCWYVLERYVYCVTQRSYLTQEYQRELMLID - UNI36483 - DAPRKTSVDGFSSDSWLDMEEESCEQQPQEEEEEEE

DKEEEGDGADKTPKPPTDDPTSPTSTPPEDQDSTGKKPKAPAIRFLKRTLSNESEESVKSTSMPTDDPKTPTGSPATEVSTKWTHLTEFELKGLKALVEK

LESLPENKKCVPEGIEDPQALLEGVK - UNI11698 - NVLKEHVDDDPTLAITGVPVVSWPKKTAK - UNI1820 - - UNI18303 - NRVVG

RPKGKLGPASAVKLAANRTTAGARRRRTRCRKCEACLRTECGECHFCKDMKKFGGPGRMKQSCIMRQCIA - UNI7450 - PVLPHTAVCLVCGEAGK

EDTVEEEEGKFNLMLMECSICNEIIHPGCLK IKESEGVVNDELPNCWECPKCNHAGKTGK QKRGPGFKYASNLPGSLLKEQKMNRDNKEGQEPAKRRS

ECEEAPRRRSDEHPKKVPADGILRRKSDDVHLRRKRKYEKPQELSGRKR - UNI2996 - ASSLQTSPGSSSHLSPRPPLGSSLSPWWRSSLTYFQQQ

 - UNI7485 - LKPGKEDKLFRKK RRSWKNAEDRLSLANKPLRRFKQEPEDDLPEAPPKTRESDQSRSSSPTAGPSTEGAEGPEEKKKVKMRRKRRL

VNKELSKELSKELNHEIQKTESTLAHESQQPIKSEPESENDEPKRPLSHCERPHRFSKGLNGTPRELRHSLGPGLRSPPRVMSRPPPSASPPKCIQMERH

VIRPPPISPPPDSLPLDDGAAHVMHREVWMAVFSYLSHRDLCVCMRVCRTWNRW WCCDKRLWTRIDLNRCKSITPLMLSGIIRRQPVSLDLSWTNISKK

QLSWLINRLPG GLRDLVLSGCSWIAVSALCSSSCPLLRTLDVQWVEGLKDAQMRDLLSPPTDNRPG - UNI36389 - GQMDNRSKLRNIVELRLAG

LDITDVSLRLIIRHMPLLSKLQLSYCNHINDQSINLLTAVGTTTRDSLTEVNLSD - UNI12912 - - UNI36389 - DCNKVTDLCLSFFKRCGN

ICHIDLRYCKQVTKEGCEQFIAEMSVSVQFGQVEEKLLQKLS
Transcript ENSMUST00000121739
Sequence
AAAAGTTATGCAGTCTGTACAGATACAGTGCTGAGGTAATTTCTTTCTGAGCCCCTCAGATGCCTCCTCCATATGGCAGGTTCGCAAATGGATAAGGGTC

TGGACAGGCTGGCCCCTCCCCCCAGGCATGCAGTAGAAAAGCAAAACAGAAAAAGAAATCACACATACAAAATACTTTGAATTTAGGTCGCCAGCATAG 

- UNI13030 - - UNI15521 - - UNI31560 - - UNI33518 - CGTGCGATTGACCGCCAGAGATACGACGAGAACGAAGACTTGTCGGAC

GTGGAGGAAATTGTCAGCGTCCGTGGCTTCAGCCTGGAGGAGAAGCTACGTAGCCAGTTATACCAGGGGGACTTCGTGCATGCTATGGAAGGCAAAG - 

UNI15521 - ATTTTAACTATGAGTACGTACAGAGAGAAGCTCTCAGGGTCCCCCTGGTTTTTCGGGACAAGGATGGACTAGGGATCAA - UNI1552

1 - - UNI19470 - GATGCCAGACCCTGATTTCACAGTCCGAGACGTCAAACTCCTGGTGG - UNI17114 - GGAGCCGCCGTTTGGTGGATGT

CATGGACGTCAACACCCAGAAGGGTACCGAGATGAGCATGTCCCAGTTTGTGCGCTACTACGAGACACCAGAGGCACAGCGGGATAAACTGTACAACGTC

ATCAGCCTCGAGTTCAGCCATACGAAGCTGGAGCATCTGGTCAAGCGTCCCACTGTG - UNI32087 - GTGGACCTGGTCGACTGGGTGGACAACAT

GTGGCCTCAGCATCTAAAGGAAAAGCAGACAGAAGCCACCAATGCCCTTGCAGAGATGAAGTACCCCAAAGTGAAAAA - UNI32087 - GTACTGTC

TGATGAGCGTGAAGGGCTGTTTCACTGACTTCCACATTGACTTTGGAGGCACCTCCGTGTGGTACCATGTGTTCCGTGGTGGCAAG - UNI4017 - -

 UNI32087 - ATCTTTTGGCTGATCCCTCCAACCCTGCACAACTTGGCTTTGTACGAGGAGTGGGTGCTGTCTGGCAAACAGAGCGACATCTTTCTGG

GAGACCGCGTGGAACGCTGCCAAAGAATTGAGCTGAAGCAAGGCTACACCTTTTTCATCCCTTCCG - UNI24228 - - UNI36483 - GTTGGAT

CCATGCGGTTTATACGCCTGTGGACTCTCTGGTGTTCGGCGGGAACATCCTGCATAGCTTCAACGTGCCCATGCAGCTGCGGATCTACGAGATCGAGGAC

AGGACCCGG - UNI36483 - GTTCAGCCCAAGTTCCGTTACCCCTTCTACTATGAGATGTGCTGGTATGTCTTGGAGAGATATGTGTACTGTGTGAC

CCAGCGCTCCTACCTCACTCAGGAATACCAGAGAGAATTAATGCTTATTG - UNI36483 - ATGCCCCAAGAAAAACCAGTGTAGACGGCTTTTCAT

CCGACTCCTGGCTGGACATGGAGGAGGAGTCCTGCGAGCAGCAGCCACAGGAGGAAGAGGAGGAGGAGGAGGACAAGGAGGAGGAAGGAGATGGTGCAGA

TAAAACACCCAAGCCACCCACCGATGACCCCACCTCACCCACCAGCACCCCGCCCGAAGACCAGGACAGCACAGGGAAGAAGCCTAAAGCCCCTGCCATA

CGGTTCCTCAAGAGGACGTTGTCCAATGAGTCAGAGGAAAGTGTCAAGTCGACCTCGATGCCCACGGACGATCCCAAGACGCCCACGGGCTCCCCGGCCA

CCGAGGTTTCTACCAAGTGGACTCACCTTACCGAATTTGAACTGAAGGGCTTGAAAGCCCTGGTTGAAAAGCTAGAGTCCCTTCCGGAGAATAAGAAGTG

TGTCCCTGAGGGAATCGAGGACCCCCAGGCCCTCCTGGAAGGTGTAAAG - UNI11698 - AATGTACTGAAAGAGCACGTGGATGACGACCCCACCC

TGGCCATCACCGGGGTCCCTGTGGTCAGCTGGCCAAAGAAAACTGCAAAG - UNI1820 - - UNI18303 - AACCGGGTGGTGGGTCGGCCTAAG

GGCAAGTTGGGCCCGGCCTCAGCGGTGAAGTTGGCTGCCAACCGAACAACAGCAGGAGCTCGCAGGCGCCGGACGCGATGCCGCAAGTGCGAGGCCTGCC

TGCGGACGGAGTGTGGAGAGTGCCACTTTTGCAAGGACATGAAGAAGTTTGGAGGTCCTGGGCGCATGAAGCAGAGCTGCATCATGCGGCAGTGCATCGC

G - UNI7450 - CCAGTGCTGCCCCACACCGCCGTGTGCCTTGTGTGTGGCGAGGCAGGGAAGGAGGACACAGTGGAAGAGGAAGAAGGCAAGTTTAA

CCTCATGCTCATGGAATGCTCCATCTGCAACGAGATCATCCACCCTGGATGCCTTAAG ATTAAGGAATCGGAGGGTGTGGTCAACGATGAGCTTCCCAA

CTGCTGGGAGTGTCCGAAGTGTAACCATGCCGGCAAGACCGGGAAA CAAAAGCGTGGCCCTGGCTTTAAGTATGCCTCCAACCTGCCTGGCTCCTTGCT

CAAGGAGCAGAAGATGAACCGGGACAACAAGGAAGGGCAAGAGCCTGCCAAGCGGAGAAGTGAGTGTGAAGAGGCTCCCCGTCGGAGGTCAGACGAGCAC

CCCAAAAAGGTGCCTGCAGATGGCATCCTCCGCCGAAAGTCTGATGATGTGCACCTGAGGAGGAAGCGGAAATACGAGAAGCCCCAAGAGCTGAGTGGAC

GCAAGCGA - UNI2996 - GCCTCGTCGCTTCAAACGTCCCCCGGTTCCTCCTCTCACCTCTCGCCGAGGCCCCCTCTAGGCAGCAGTCTCAGCCCTT

GGTGGAGATCCAGTCTCACTTACTTCCAGCAGCAG - UNI7485 - CTAAAACCTGGCAAAGAAGATAAGCTTTTCAGGAAAAAG CGGCGGTCCTGG

AAGAACGCTGAGGATCGTCTGTCACTGGCCAACAAGCCCCTTCGGCGCTTTAAGCAGGAACCGGAGGACGATCTGCCTGAGGCACCTCCTAAGACCCGGG

AGAGTGATCAGTCACGTTCCAGCTCACCCACTGCTGGTCCCAGCACTGAGGGAGCTGAAGGCCCAGAAGAGAAGAAAAAGGTGAAGATGCGCCGGAAGCG

GCGACTTGTTAACAAGGAGCTGAGCAAAGAGCTAAGCAAGGAGCTCAACCATGAGATCCAAAAGACGGAGAGCACCCTGGCTCACGAGAGCCAGCAGCCC

ATCAAGTCAGAGCCTGAGAGCGAGAACGACGAGCCCAAGAGGCCCTTAAGCCACTGCGAGCGCCCCCACCGCTTCAGCAAAGGGCTCAACGGCACACCTC

GGGAGCTGCGGCACTCGCTGGGACCTGGCCTGCGTAGTCCACCTCGTGTTATGTCCCGGCCCCCGCCCTCTGCATCCCCACCCAAGTGCATCCAGATGGA

GCGTCACGTGATCCGGCCACCGCCCATCAGCCCCCCACCTGACTCGCTGCCCCTGGATGATGGAGCAGCCCACGTCATGCATAGGGAGGTGTGGATGGCA

GTCTTCAGCTACCTCAGCCACCGAGACCTGTGTGTCTGCATGCGGGTCTGCAGGACCTGGAACCGCTG GTGCTGCGATAAGCGGTTGTGGACCCGCATC

GACCTGAACCGCTGCAAGTCCATCACACCCCTGATGCTGAGCGGTATCATCCGGCGACAGCCTGTCTCCCTTGACCTCAGTTGGACCAACATCTCCAAGA

AGCAGCTGAGTTGGCTCATCAACCGGTTGCCTG GGCTCCGAGACTTGGTGCTGTCAGGCTGCTCATGGATCGCTGTCTCAGCCCTCTGTAGCTCCAGTT

GTCCATTGCTCCGGACCCTGGATGTCCAGTGGGTAGAAGGACTAAAGGATGCCCAGATGAGGGATCTCCTGTCTCCACCCACAGACAACAGGCCAG - U

NI36389 - GTCAGATGGACAATCGGAGCAAGCTCCGGAACATTGTAGAGCTGCGCCTAGCTGGCCTGGACATCACAGATGTCTCCCTGCGGCTCATTA

TTCGCCATATGCCCCTGCTCTCGAAGCTCCAACTCAGTTACTGTAACCACATCAATGACCAGTCCATCAACCTGCTCACTGCCGTCGGCACCACCACCCG

AGACTCGCTGACAGAGGTCAACCTATCAG - UNI12912 - - UNI36389 - ACTGTAATAAGGTAACTGACCTGTGCCTGTCCTTCTTCAAACGC

TGTGGAAATATCTGTCATATTGACCTGAGGTACTGCAAGCAAGTCACCAAGGAAGGCTGTGAGCAATTCATAGCTGAAATGTCTGTGAGTGTCCAATTTG

GGCAAGTGGAAGAGAAACTCCTGCAAAAACTAAGTTAGTTCCAGGACAA
Translation
 - UNI13030 - - UNI15521 - - UNI31560 - - UNI33518 - MEGKD - UNI15521 - DFNYEYVQREALRVPLVFRDKDGLGIK 

- UNI15521 - - UNI19470 - KMPDPDFTVRDVKLLVG - UNI17114 - GSRRLVDVMDVNTQKGTEMSMSQFVRYYETPEAQRDKLYNVIS

LEFSHTKLEHLVKRPTV - UNI32087 - VDLVDWVDNMWPQHLKEKQTEATNALAEMKYPKVKK - UNI32087 - KYCLMSVKGCFTDFHIDFG

GTSVWYHVFRGGK - UNI4017 - - UNI32087 - IFWLIPPTLHNLALYEEWVLSGKQSDIFLGDRVERCQRIELKQGYTFFIPSG - UNI242

28 - - UNI36483 - GWIHAVYTPVDSLVFGGNILHSFNVPMQLRIYEIEDRTR - UNI36483 - VQPKFRYPFYYEMCWYVLERYVYCVTQRS

YLTQEYQRELMLID - UNI36483 - DAPRKTSVDGFSSDSWLDMEEESCEQQPQEEEEEEEDKEEEGDGADKTPKPPTDDPTSPTSTPPEDQDSTGK

KPKAPAIRFLKRTLSNESEESVKSTSMPTDDPKTPTGSPATEVSTKWTHLTEFELKGLKALVEKLESLPENKKCVPEGIEDPQALLEGVK - UNI1169

8 - NVLKEHVDDDPTLAITGVPVVSWPKKTAK - UNI1820 - - UNI18303 - NRVVGRPKGKLGPASAVKLAANRTTAGARRRRTRCRKCEAC

LRTECGECHFCKDMKKFGGPGRMKQSCIMRQCIA - UNI7450 - PVLPHTAVCLVCGEAGKEDTVEEEEGKFNLMLMECSICNEIIHPGCLK IKES

EGVVNDELPNCWECPKCNHAGKTGK QKRGPGFKYASNLPGSLLKEQKMNRDNKEGQEPAKRRSECEEAPRRRSDEHPKKVPADGILRRKSDDVHLRRKR

KYEKPQELSGRKR - UNI2996 - ASSLQTSPGSSSHLSPRPPLGSSLSPWWRSSLTYFQQQ - UNI7485 - LKPGKEDKLFRKK RRSWKNAED

RLSLANKPLRRFKQEPEDDLPEAPPKTRESDQSRSSSPTAGPSTEGAEGPEEKKKVKMRRKRRLVNKELSKELSKELNHEIQKTESTLAHESQQPIKSEP

ESENDEPKRPLSHCERPHRFSKGLNGTPRELRHSLGPGLRSPPRVMSRPPPSASPPKCIQMERHVIRPPPISPPPDSLPLDDGAAHVMHREVWMAVFSYL

SHRDLCVCMRVCRTWNRW WCCDKRLWTRIDLNRCKSITPLMLSGIIRRQPVSLDLSWTNISKKQLSWLINRLPG GLRDLVLSGCSWIAVSALCSSSCP

LLRTLDVQWVEGLKDAQMRDLLSPPTDNRPG - UNI36389 - GQMDNRSKLRNIVELRLAGLDITDVSLRLIIRHMPLLSKLQLSYCNHINDQSINL

LTAVGTTTRDSLTEVNLSD - UNI12912 - - UNI36389 - DCNKVTDLCLSFFKRCGNICHIDLRYCKQVTKEGCEQFIAEMSVSVQFGQVEEK

LLQKLS
Transcript ENSMUST00000031435
Sequence
TGCGAGGCGCGCGGTGGCGGCGGCGGCTCCCTCCTCGCCGCGCGGGAGCCCGAGCGCTAGCCAGGGTGAGCCGAGCCTGCTCCCTGCGGGCGGCGGCGGC

GCTGCTCCAGCCATGTCAGCGCGCGCGAGGCTGGGCCCACCATGAGCCATGGCCATGTCCGTGAGCGCCGAGGACGACGACTATGAATCGGAGCCCGACC

AG - UNI18303 - AACCGGGTGGTGGGTCGGCCTAAGGGCAAGTTGGGCCCGGCCTCAGCGGTGAAGTTGGCTGCCAACCGAACAACAGCAGGAGCT

CGCAGGCGCCGGACGCGATGCCGCAAGTGCGAGGCCTGCCTGCGGACGGAGTGTGGAGAGTGCCACTTTTGCAAGGACATGAAGAAGTTTGGAGGTCCTG

GGCGCATGAAGCAGAGCTGCATCATGCGGCAGTGCATCGCG - UNI7450 - CCAGTGCTGCCCCACACCGCCGTGTGCCTTGTGTGTGGCGAGGCAG

GGAAGGAGGACACAGTGGAAGAGGAAGAAGGCAAGTTTAACCTCATGCTCATGGAATGCTCCATCTGCAACGAGATCATCCACCCTGGATGCCTTAAG A

TTAAGGAATCGGAGGGTGTGGTCAACGATGAGCTTCCCAACTGCTGGGAGTGTCCGAAGTGTAACCATGCCGGCAAGACCGGGAAA CAAAAGCGTGGCC

CTGGCTTTAAGTATGCCTCCAACCTGCCTGGCTCCTTGCTCAAGGAGCAGAAGATGAACCGGGACAACAAGGAAGGGCAAGAGCCTGCCAAGCGGAGAAG

TGAGTGTGAAGAGGCTCCCCGTCGGAGGTCAGACGAGCACCCCAAAAAGGTGCCTGCAGATGGCATCCTCCGCCGAAAGTCTGATGATGTGCACCTGAGG

AGGAAGCGGAAATACGAGAAGCCCCAAGAGCTGAGTGGACGCAAGCGA - UNI2996 - GCCTCGTCGCTTCAAACGTCCCCCGGTTCCTCCTCTCAC

CTCTCGCCGAGGCCCCCTCTAGGCAGCAGTCTCAGCCCTTGGTGGAGATCCAGTCTCACTTACTTCCAGCAGCAG - UNI7485 - CTAAAACCTGGC

AAAGAAGATAAGCTTTTCAGGAAAAAG CGGCGGTCCTGGAAGAACGCTGAGGATCGTCTGTCACTGGCCAACAAGCCCCTTCGGCGCTTTAAGCAGGAA

CCGGAGGACGATCTGCCTGAGGCACCTCCTAAGACCCGGGAGAGTGATCAGTCACGTTCCAGCTCACCCACTGCTGGTCCCAGCACTGAGGGAGCTGAAG

GCCCAGAAGAGAAGAAAAAGGTGAAGATGCGCCGGAAGCGGCGACTTGTTAACAAGGAGCTGAGCAAAGAGCTAAGCAAGGAGCTCAACCATGAGATCCA

AAAGACGGAGAGCACCCTGGCTCACGAGAGCCAGCAGCCCATCAAGTCAGAGCCTGAGAGCGAGAACGACGAGCCCAAGAGGCCCTTAAGCCACTGCGAG

CGCCCCCACCGCTTCAGCAAAGGGCTCAACGGCACACCTCGGGAGCTGCGGCACTCGCTGGGACCTGGCCTGCGTAGTCCACCTCGTGTTATGTCCCGGC

CCCCGCCCTCTGCATCCCCACCCAAGTGCATCCAGATGGAGCGTCACGTGATCCGGCCACCGCCCATCAGCCCCCCACCTGACTCGCTGCCCCTGGATGA

TGGAGCAGCCCACGTCATGCATAGGGAGGTGTGGATGGCAGTCTTCAGCTACCTCAGCCACCGAGACCTGTGTGTCTGCATGCGGGTCTGCAGGACCTGG

AACCGCTG GTGCTGCGATAAGCGGTTGTGGACCCGCATCGACCTGAACCGCTGCAAGTCCATCACACCCCTGATGCTGAGCGGTATCATCCGGCGACAG

CCTGTCTCCCTTGACCTCAGTTGGACCAACATCTCCAAGAAGCAGCTGAGTTGGCTCATCAACCGGTTGCCTG GGCTCCGAGACTTGGTGCTGTCAGGC

TGCTCATGGATCGCTGTCTCAGCCCTCTGTAGCTCCAGTTGTCCATTGCTCCGGACCCTGGATGTCCAGTGGGTAGAAGGACTAAAGGATGCCCAGATGA

GGGATCTCCTGTCTCCACCCACAGACAACAGGCCAG - UNI36389 - GTCAGATGGACAATCGGAGCAAGCTCCGGAACATTGTAGAGCTGCGCCTA

GCTGGCCTGGACATCACAGATGTCTCCCTGCGGCTCATTATTCGCCATATGCCCCTGCTCTCGAAGCTCCAACTCAGTTACTGTAACCACATCAATGACC

AGTCCATCAACCTGCTCACTGCCGTCGGCACCACCACCCGAGACTCGCTGACAGAGGTCAACCTATCAG - UNI12912 - - UNI36389 - ACTG

TAATAAGGTAACTGACCTGTGCCTGTCCTTCTTCAAACGCTGTGGAAATATCTGTCATATTGACCTGAGGTACTGCAAGCAAGTCACCAAGGAAGGCTGT

GAGCAATTCATAGCTGAAATGTCTGTGAGTGTCCAATTTGGGCAAGTGGAAGAGAAACTCCTGCAAAAACTAAGTTAGTTCCAGGACAAGTATGTAAATA

TGGAGGGTTGGGGGGAATACAACCAGGAAGGGTGAAAGACTGCAAAATCAAGTGGGCCTATTATTTCCCTTTGGAATTTGAAACAAGAGACTACAGGACA

CAGTTCTGTTTTGCAAATCTTGCCAAGGGGGAAGCCATTCAACCACCCATTTTGGGATGAGTGAGCCAGATGTTTTCCTTTGCTCTTTCTGCATCGTAAC

TGCACTGCTTTCTGGACCATTTCTAAGGCGGCCTTTAGAAGACATTCCAATTGGAAAGGAAGATGAGCTTTGGAGAAATCCTCTTAGAAGCCTAAGCTTG

GTGTTTTTATCAGTAGTTTTTGTTTGGGGCACTTGTTCCTTGCAATGCTGAGGCTTCTGGCGTCAACATGGAGTGGACCACACACACACCATCTGCAGCC

GTCGTTGATACATTTTGTTTAGTTGGTTTTGTTACATCTTACATTATGCAGAACTATTTTTGTATAAATTGTTTAAAAATTATTTATGGGAGATTTGAAT

GCATACCAGTGTTTTTATTATTTAGATTGCCAACTGTCCTTCAGGTAGGAGAGTTAACCTGTACTATGTCAGCATAAAAAGCCCATCTCCAGATGTGCCC

AGGTGTGACAGGGGGCTATGACCTTCCACTTAAAAAGCATGTTTAACTGGATGCTGAGAGCCTACTGTGTATGTCAAGAAGCTACACAAGCATGTTGTGG

ATATGTGTAAAGTATAGTCCAGGTAAAACACTTTGCCAAGTTTCAATAGACTTCACCTCTCCCTCAGACTTGAGCCTTTACACTCAGGAGGGTTTGCTCC

AAGCATGAGCTCTTGTATTCTACTTACATAGGTCTAATTTATACCAAGAATCAGGTAGAATAAATGTGCCCACACCCTCTCCTTTGTCCTCCTCCTCTCA

AGTGTTCAGTTCTCACTTTAGTTGGTAAGTTCTGCATCCCTTGTTGTTTGGTGGTGTTTCCTAACCTTTCCCTGATGCAGTTTGACCTTTGTTGGATTTA

TATAAACAATTGT
Translation
MAMSVSAEDDDYESEPDQ - UNI18303 - NRVVGRPKGKLGPASAVKLAANRTTAGARRRRTRCRKCEACLRTECGECHFCKDMKKFGGPGRMKQSC

IMRQCIA - UNI7450 - PVLPHTAVCLVCGEAGKEDTVEEEEGKFNLMLMECSICNEIIHPGCLK IKESEGVVNDELPNCWECPKCNHAGKTGK Q

KRGPGFKYASNLPGSLLKEQKMNRDNKEGQEPAKRRSECEEAPRRRSDEHPKKVPADGILRRKSDDVHLRRKRKYEKPQELSGRKR - UNI2996 - A

SSLQTSPGSSSHLSPRPPLGSSLSPWWRSSLTYFQQQ - UNI7485 - LKPGKEDKLFRKK RRSWKNAEDRLSLANKPLRRFKQEPEDDLPEAPPKT

RESDQSRSSSPTAGPSTEGAEGPEEKKKVKMRRKRRLVNKELSKELSKELNHEIQKTESTLAHESQQPIKSEPESENDEPKRPLSHCERPHRFSKGLNGT

PRELRHSLGPGLRSPPRVMSRPPPSASPPKCIQMERHVIRPPPISPPPDSLPLDDGAAHVMHREVWMAVFSYLSHRDLCVCMRVCRTWNRW WCCDKRLW

TRIDLNRCKSITPLMLSGIIRRQPVSLDLSWTNISKKQLSWLINRLPG GLRDLVLSGCSWIAVSALCSSSCPLLRTLDVQWVEGLKDAQMRDLLSPPTD

NRPG - UNI36389 - GQMDNRSKLRNIVELRLAGLDITDVSLRLIIRHMPLLSKLQLSYCNHINDQSINLLTAVGTTTRDSLTEVNLSD - UNI12

912 - - UNI36389 - DCNKVTDLCLSFFKRCGNICHIDLRYCKQVTKEGCEQFIAEMSVSVQFGQVEEKLLQKLS

For any suggestions or comments, please send an email to unitrap@crg.es