Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000029478 (Ncor2)
Chromosomal location
Chr 5: 125497523 - 125659589 (-)
Description
nuclear receptor co-repressor 2 Gene [Source:MGI (curated);Acc:Ncor2-002]
RefSeq_dna
NM_011424 
RefSeq_peptide
NP_035554.2 
UniGene
Mm.278646 Mm.472258 
MGI
MGI:1337080 
Uniprot/SWISSPROT
Q9WU42 
Uniprot/SPTREMBL
Q3TG88 Q3TZ10 Q80ZV7 
Human Ortholog
ENSG00000196498 (NCOR2)
Omim not available
UniTrap UNI18902
Vector Insertion
Chr 5: 125634023 - 125659366
Public Clones (sanger) E020H02 (ggtc) D054H07 (ggtc) IST13050C7 (tigm) IST13549D11 (tigm)
IST14451A1 (tigm) IST14636A10 (tigm)
Private Clones OST411825 (lexicon) OST264586 (lexicon) OST224976 (lexicon) OST185952 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30560
Vector Insertion
Chr 5: 125605139 - 125634023
Public Clones (sanger) IST12151C10BBR1 (tigm) IST14330B2 (tigm) IST14188G8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25795
Vector Insertion
Chr 5: 125605139 - 125605271
Public Clones not available
Private Clones OST166159 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17689
Vector Insertion
Chr 5: 125605139 - 125605351
Public Clones not available
Private Clones OST438166 (lexicon) OST225528 (lexicon) OST136051 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25772
Vector Insertion
Chr 5: 125599851 - 125599980
Public Clones not available
Private Clones OST166798 (lexicon)
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2098
Vector Insertion
Chr 5: 125598986 - 125599165
Public Clones AL0253 (sanger) XK421 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7790
Vector Insertion
Chr 5: 125568337 - 125572023
Public Clones RRM275 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 12% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12291
Vector Insertion
Chr 5: 125548319 - 125549301
Public Clones YTC796 (baygenomics) A044D08 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 22% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6109
Vector Insertion
Chr 5: 125536246 - 125546209
Public Clones YHD268 (baygenomics) YTC783 (baygenomics) CSA142 (baygenomics) XH266 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 25% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6062
Vector Insertion
Chr 5: 125529766 - 125531280
Public Clones YHD121 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 29% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1593
Vector Insertion
Chr 5: 125516497 - 125517190
Public Clones CC0027 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 49% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI67
Vector Insertion
Chr 5: 125509169 - 125509251
Public Clones GC0319 (tigem)
Private Clones not available
Severity of mutation (?) Insertion after 73% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI668
Vector Insertion
Chr 5: 125500417 - 125503240
Public Clones DC0409 (sanger) RHA165 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 92% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000111402
Sequence
CAGGAGCGGAGCCGCGGGCAGCGCAGGCCGGGCCGCATCCCCGTCCCCGCGCCAGCCGCCCGCGCCCGCCATGCGCGCCCCGCAGCGGCCCGCGCGTCCG

GGCCCCGCGTCGTAGCGCGGCGGGCGGAGACCGCAGGCTCTCAGCCCGGACCCGCCGCATCCTCGAGCCCGATCGGCGCCGTAGCCCGGCGCCAGCGCCC

GGTGCCGCCGCCGGCGAG - UNI18902 - - UNI30560 - TGCTCCTGAGTCTTTGAGGAACACAGCCTCCTGGTGGAAGTTCGTG - UNI176

89 - - UNI30560 - GCACCTGTGACGAGGTCACCTGCCAGCAGATGACCGAGACCAGCCCTTAGTCCTAGGTGTGGTCAAGAGTGTCTTGGGCTCC

AAAGCCTACCTGGACCCTACCACCATGTCAGGATCCACACAGCCTGTGGCACAGACATGGCGGGCTGCTGAGCCCCGCTACCCACCCCATGGCATCTCCT

ACCCGGTGCAGATAGCCCGGTCCCACACG - UNI17689 - - UNI25772 - - UNI25795 - - UNI30560 - GACGTGGGGCTGCTTGAG

TACCAACACCACCCCCGTGACTACACCTCACACCTGTCACCCGGTTCCATCATCCAGCCACAGAGGAGGCGGCCCTCACTGCTGTCAGAGTTCCAGCCTG

GGAGTGAACG - UNI2098 - - UNI25772 - GTCTCAGGAGCTCCACCTGCGCCCTGAGTCCCGCACGTTCCTGCCTGAGCTGGGCAAGCCCGAC

ATAGAATTCACCGAGAGCAAGCGCCCCCGCCTGGAGCTACTACCCGATACCCTGCTGCGCCCATCACCCCTGCTGGCCACTGGGCAGCCGAGTGGGTCTG

AAGACCTTACCAAG - UNI2098 - GACCGTAGCCTGGCAGGCAAGCTGGAGCCTGTGTCACCTCCCAGTCCCCCGCACGCTGACCCTGAGCTAGAGC

TGGCGCCATCTCGACTGTCCAAGGAGGAGCTGATCCAGAACATGGACCGCGTGGACCGTGAGATCACCATGGTAGAGCAGCAGATCTCCAAGCTGAAGAA

GAAGCAG CAACAGTTGGAGGAGGAGGCCGCCAAGCCGCCCGAACCCGAGAAGCCTGTGTCGCCACCACCCATAGAATCAAAGCACCGAAGCCTGGTCCA

GATCATCTACGATGAGAACCGG AAGAAAGCCGAAGCCGCACACCGGATCCTAGAAGGCCTGGGGCCCCAGGTGGAGCTG CCTCTGTACAACCAGCCGT

CTGACACACGCCAGTACCATGAAAACATCAAAAT AAACCAGGCGATGCGGAAGAAGCTGATCTTGTACTTTAAGCGGAGGAACCACGCGCGCAAGCAGT

GG - UNI7790 - GAACAGCGCTTCTGCCAGCGCTATGACCAGCTCATGGAGGCGTGGGAGAAGAAGGTAGAGCGCATAGAGAACAATCCGCGAAGGA

GGGCCAAGGAGAGCAAGGTGAGGGAGTACTACGAGAAACAGTTCCCGGAGATCCGCAAGCAGCGGGAGCTGCAGGAGCGCATGCAGAG CAGGGTGGGCC

AGCGTGGCAGTGGGCTCTCCATGTCGGCTGCCCGCAGTGAGCATGAGGTTTCTGAGATCATTGATGGCTTGTCTGAGCAGGAG AATCTGGAGAAGCAGA

TGCGCCAGCTGGCCGTGATCCCGCCCATGTTGTACGACGCGGACCAGCAGAGGATCAAGTTCATCAACATGAATGGACTCATGGATGACCCCATGAAGGT

CTACAAGGACCGTCAGGTTACCAACATGTGGAGCGAGCAGGAGAGGGACACCTTCCGTGAGAA GTTTATGCAGCACCCTAAGAACTTTGGCCTGATTGC

CTCATTCCTGGAGAGAAAG ACGGTCGCTGAGTGTGTCCTCTATTACTACCTGACCAAGAAGAATGAAAATTACAAGAGCTTGGTGAGGCGGAGCTATCG

GCGCCGTGGCAAGAGCCAG CAGCAGCAGCAGCAGCAACAACAGCAGCAGCAGCAGCAGATGGCACGGAGCAGCCAGGAGGAGAAGGAGGAGAAGGAGAA

GGAGAAGGAGGCCGACAAGGAGGAAGAGAAGCAGGATGCGGAGAACGAGAAGGAAGAACTCAGCAA - UNI12291 - GGAGAAGACAGACGACACTT

CTGGCGAGGACAACGATGAGAAAGAGGCCGTGGCCTCCAAAGGCCGCAAAACTGCCAACAGCCAAGGCCGCCGCAAAGGCCGTATCACGCGCTCCATGGC

CAACGAGGCCAACCATGAGGAGACAGCCACCCCACAGCAAAGTTCAGAGCTGG CTTCCATGGAGATGAACGAGAGTTCTCGCTGGACTGAGGAAGAGAT

GGAGACAGCAAAGAAAG - UNI6109 - GCCTCCTGGAACATGGGAGGAACTGGTCAGCCATTGCCCGTATGGTGGGCTCCAAGACCGTGTCCCAGTG

TAAGAACTTCTACTTCAACTACAAGAAGAGGCAGAACCTGGACGAAATCCTTCAGCAGCACAAGCTAAAGATG GAGAAGGAGAGGAACGCTCGGAGGAA

GAAGAAGAAGACCCCAGCTGCGGCGAGCGAGGAGACAGCCTTCCCACCTGCCGCTGAGGACGAAGAGATGGAAGCATCAGGCGCAAGTGCCAATGAGGAA

GAGCTGGCGGAGGAGGCAGAAG - UNI6062 - CCTCACAGGCCTCTGGGAATGAGGTTCCCAGAGTTGGGGAGTGCAGTGGCCCAG CTGCTGTCAA

CAACAGCTCTGATACTGAGAGTGTCCCATCCCCGCGTTCAGAAGCCACGAAGGACACTGGGCCTAAACCCACTGGCACTGAAGCATTGCCCGCTGCCACC

CAGCCACCTGTTCCTCCTCCAGAAGAACCGGCAGTAGCCCCTGCTGAGCCCTCCCCAGTCCCTGATGCCAGTGGCCCACCATCCCCAGAGCCTTCCCCAT

CACCTGCCGCACCCCCGGCTACTGTGGACAAGGATGAACAAGAAGCCCCGGCTGCTCCAGCTCCCCAGACAGAGGATGCCAAGGAGCAGAAGTCTGAGGC

CGAGGAGATCGATGTGGGAAAGCCAGAGGAGCCCGAGGCCTCTGAGGAGCCCCCGGAGAGTGTAAAGAGTGACCACAAGGAGGAGACCGAGGAAGAGCCT

GAAGACAAAGCCAAGGGCACAGAGGCCATTGAAACTGTGTCTGAGGCACCACTTAAGGTGGAGGAGGCTGGTAGCAAGGCAGCTGTGACCAAGGGTTCCA

GCTCAGGTGCCACCCAGGACAGTGACTCCAGTGCCACCTGCAGTGCCGATGAGGTGGACGAACCCGAAGGAGGTGACAAGGGCAG GCTGCTGTCACCAA

GGCCCAGCCTCCTCACCCCGGCTGGAGATCCCCGGGCCAGTACCTCGCCCCAGAAGCCGCTGGACCTGAAGCAGCTGAAGCAGCGAGCAGCCGCCATCCC

CCCTATC GTCACCAAGGTCCATGAGCCCCCCCGGGAGGACACAGTACCCCCAAAGCCAGTTCCCCCTGTGCCTCCACCCACGCAGCACCTACAGCCAGA

GGGTGACGTGTCTCAGCAGTCGGGAGGAAGTCCACGTGGCAAGTCCCGCAGCCCAGTGCCTCCTGCCGAGAAAGAGG CAGAGAAACCCGCATTCTTTCC

GGCTTTCCCAACTGAGGGCCCAAAGCTACCGACTGAGCCCCCACGCTGGTCATCGGGCCTGCCCTTCCCCATCCCTCCACGGGAGGTGATCAAGACTTCC

CCACACGCCGCTGACCCCTCTGCCTTCTCCTACACACCCCCCG GTCACCCGCTGCCTCTGGGCCTCCACGATAGTGCCCGGCCCGTCCTGCCACGTCCC

CCCATCTCTAACCCCCCACCCCTCATCTCCTCTGCCAAGCATCCCGGCGTACTTGAGAGGCAGCTGGGTGCCATCTCCCAG CAGGGGATGTCAGTCCAG

CTTCGTGTGCCTCACTCAGAGCATGCCAAGGCCCCCATGGGCCCTCTCACCATGGGGCTGCCCCTTGCCGTGGACCCTAAGAAGCTGG CCCCCTTCAGT

GGAGTGAAGCAGGAACAGTTGTCCCCTCGGGGTCAGGCTGGGCCACCTGAAAGTCTGGGAGTGCCCACTGCTCAGGAGACCTCTGTGCTGAGAG GGACA

GCACTGGGTTCCGCCACCAGTGGAAGCATCACCAAGGGCCTCCCCAGTACCCGGGCTGCAGACGGCCCCAGCTACAGAGGCTCTATCACCCAC - UNI1

593 - GGCACGCCCGCAGACGTCCTCTACAAGGGTACCATCAGCAGGATCGTCGGTGAGGACAGCCCAAGTCGCCTTGACCGGGCACGAGAGGACACCC

TGCCCAAGGGCCATGTCATCTATGAGGGCAAGAAAGGCCACGTCCTATCCTATGAAG GTGGTATGTCCGTGTCACAGTGCTCTAAGGAGGATGGAAGGA

GCAGCTCGGGCCCACCCCATGAGACTGCCGCCCCTAAACGCACCTATGACATGATGGAGGGCCGTGTAGGCAGGACTGTCACCTCAGCCAGCATAGAGG 

GACTCATGGGCCGCGCCATCCCTGAGCAGCACAGCCCCCACCTCAAGGAGCAGCATCACATCCGAGGCTCCATCACGCAAG GCATCCCGAGGTCCTATG

TGGAGGCGCAGGAGGACTACTTACGGCGGGAGGCCAAGCTCTTGAAGCGAGAAGGGACACCACCACCCCCACCACCACCTCGGGACCTGACTGAGACCTA

CAAGCCCCGGCCCCTGGACCCTCTGGGTCCCCTGAAGCTGAAGCCGACTCACGAGGGTGTGGTAGCAACTGTGAAGGAGGCGGGCCGCTCTATCCATGAG

ATCCCGAGAGAGGAGCTGCGCCGCACACCTGAGCTACCCCTGGCACCACGGCCTCTGAAGGAGGGTTCCATCACCCAG GGCACCCCACTCAAGTACGAC

TCTGGGGCACCCTCCACTGGCACCAAGAAACACGACGTGCGCTCCATCATCGGCAGCCCCGGCCGGCCTTTCCCTGCCCTGCACCCGCTGGACATAATGG

CTGACGCCCGGGCACTGGAGCGTGCCTGCTATGAAGAGAGTCTGAAGAGCCGGTCAGGGACCAGCAGTGGTGCAGGGGGCTCCATCACACGTGGGGCTCC

AGTCGTCGTGCCTGAACTGGGCAAGCCACGGCAAAGCCCACTGACTTACGAAGACCACGGGGCACCCTTCACCAGTCACCTGCCACGTGGCTCCCCTGTG

ACCACGAGGGAGCCCACGCCACGCCTTCAGGAAG GCAGCCTCCTATCCAGCAAGGCGTCCCAGGACCGGAAGCTGACATCTACACCCCGGGAGATCGCC

AAGTCCCCACACAGCACTGTGCCCGAGCACCACCCTCACCCCATCTCCCCCTATGAGCACTTGCTCCGGGGCGTGACTGGTGTGGACCTGTACCGTGGTC

ACATCCCATTGGCCTTTGACCCCACCTCCATACCCCGAGGGATCCCTCTGGAAGCAG CAGCCGCAGCCTACTACCTGCCCCGGCACTTGGCCCCCAGCC

CCACCTACCCACACCTGTACCCACCTTACCTCATCCGCGGCTACCCTGACACGGCGGCCCTGGAGAACCGCCAGACCATCATCAATGACTACATCACCTC

GCAGCAGATGCACCACAACGCTGCCTCCGCCATGGCCCAGCGTGCTGACATGCTGAGGGGTCTGTCACCGCGAGAGTCCTCGCTGGCCCTCAATTATGCC

GCTGGCCCAAGAG GCATTATCGACCTGTCCCAAGTGCCACACCTGCCCGTGCTGGTGCCACCAACGCCAGGCACCCCTGCCACCGCCATCGACCGCCTT

GCCTACCTCCCCACTGCGCCCCCACCCTTCAGCAGCCGCCACAGTAGCTCACCGCTGTCCCCAG GAGGCCCCACTCACCTAGCTAAACCAACTGCCACA

TCTTCATCGGAGCGGGAACGGGAACGTGAGCGGGAACGAGACAAGTCCATCCTCACGTCTACCACTACAGTGGAGCATGCACCCATCTGGAGACCTG - 

UNI67 - GTACGGAGCAGAGCAGCGGGGCTGGGGGCAGCAGCCGCCCCGCCTCCCACACCCACCAGCACTCGCCCATCTCCCCCCGGACCCAGGACGCC

TTGCAGCAGAGGCCCAGTGTGCTGCACAACACGAGCATGAAGGGCGTGGTCACCTCCGTGGAACCCGGCACGCCCACGGTCCTGAGGTGGGCCAG GTCC

ACCTCCACCTCTTCGCCTGTCCGCCCAGCTGCCACATTCCCACCTGCCACCCACTGCCCACTTGGTGGCACCCTTGAAGGGGTCTACCCTACCCTCATGG

AGCCCGTCCTGTTACCCAAGGAGACCTCTCGGGTCGCCCGGCCCGAGCGGCCCCGTGTGGACGCTGGCCATGCCTTCCTCACCAAACCCCCGGCCCGGGA

GCCCGCCTCCTCACCCAGCAAGAGCTCCGAGCCCCGATCCCTAGCACCCCCCAGCTCCAGCCACACAGCCATCGCCCGCACCCCAGCAAAGAACCTTGCA

CCCCACCATGCCAGTCCGGACCCGCCGGCGCCCACCTCGGCCTCAGATCTGCACCGAGAAAAGACTCAAAGTAAACCCTTTTCCATCCAGGAATTGGAAC

TCCGTTCTCTGG GTTACCACAGTGGAGCTGGCTACAGCCCCGATGGGGTGGAGCCCATCAGCCCGGTGAGCTCCCCCAGCCTGACCCACGACAAGGGGC

TCTCCAAACCTCTGGAAGAGCTAGAGAAGAGCCACTTGGAAGGGGAGCTGCGGCACAAGCAGCCAG GCCCCATGAAGCTCAGCGCGGAGGCTGCCCATC

TCCCACATCTGCGGCCACTGCCCGAGAGCCAGCCCTCATCTAGCCCACTCCTCCAGACTGCCCCAGGCATCAAAGGTCACCAGAGGGTGGTCACCTTGGC

TCAGCACATCAGT GAGGTCATTACGCAGGACTACACGCGCCACCACCCGCAGCAGCTCAGTGGCCCCCTTCCCGCCCCTCTCTACTCCTTTCCCGGAGC

CAGCTGCCCTGTCCTGGATCTTCGCCGCCCACCCAGTGACCTCTACCTCCCACCCCCCGACCATGGCACCCCAGCCCGGGGATCCCCCCACAGTGAAGGG

GGCAAAAG GTCCCCAGAACCCAGCAAAACATCGGTCCTGGGCAGCAGCGAGGATGCCATTGAGCCTGTGTCCCCACCAGAGGGCATGACTGAGCCAGGA

CATGCTCGGAGCACTGCGTACCCACTGCTGTATCGAGACGGGGAACAGGGCGAGCCCAG GATGGGCTCTAAGTCTCCAGGCAACACCAGCCAGCCGCCA

GCCTTCTTCAGTAAGCTGACTGAGAGCAACTCCGCCATGGTGAAGTCGAAGAAGCAGGAGATCAACAAGAAACTCAACACCCACAACCGGAACGAGCCAG

AATACA ATATTGGCCAGCCTGGGACGGAAATCTTCAACATGCCCGCCATCACTGGAGCAG - UNI668 - GCCTTATGACCTGTAGAAGCCAGGCGG

TGCAAGAACACGCCAGCACCAACATGGGGCTAGAGGCCATTATTAGAAAGGCACTCATGGGTAAATATGATCAGTGGGAAGAGCCCCCGCCGCTCGGCGC

CAATGCTTTTAACCCTCTGAATGCCAGCGCCAGTCTGCCCGCTGCTGCTATGCCCATAACCACTGCTGACGGACGGAGTGACCACGCACTCACCTCGCCA

G GTGGAGGTGGGAAAGCCAAGGTCTCTGGCAGACCTAGCAGCCGAAAAGCCAAGTCGCCAGCACCAGGCCTAGCGTCCGGAGACCGACCCCCTTCTGTC

TCCTCAGTACACTCAGAGGGGGACTGCAATCGCCGAACACCACTCACCAACCGTGTGTGGGAGGACCGGCCCTCATCTGCAG GGTCCACGCCATTCCCC

TACAACCCTTTGATTATGAGGCTACAGGCAGGTGTCATGGCCTCCCCGCCCCCACCTGGCCTTGCGGCAGGCAGCGGGCCCCTAGCTGGTCCCCACCACG

CCTGGGATGAGGAGCCCAAGCCACTGCTGTGTTCACAGTATGAGACACTCTCGGACAGCGAGTGACCACGGATTGGGGGGGAGCGGTGCCAGGTCCCCGC

ACAAGGCAGAAGCAGCCCAGCATGGAGCAGACAGCTGCTGACTCCCGAGACTGAGGAAGGAGCCCCTGAGTCTGCCTGCGCGTCCATCCGTCCGTCCGTC

CACTCATCTGTCCATCCAGAGCTGGCATCCTGCCTGTCTAAAGCCTTAACTAAGACTCCCACCCCGGGCTGGCCCTGCGCAGTGACCTTACACTCAGGGG

ATGTTTACCTGGTGCTCGAGAGGGGAGTGGACAGGAGGGGAGGGACAGCGGGCCAGGAGGGGGGGGGACAGCAATCGTGTGTCAGTCGCACTCGTGCATC

TGGGGCAGCGGGGACCCACCACAGGCTGACCAGGCACCTCCATGCCACCGCCTCGCCCCTTACCGCATTTGGAACCAAAGTCTAAGCTGAACTCTCGCGT

GGTCCTGCCCCTCCCTCTGCCCCCAGCCCGCTTGCGCTCTGGACAGACAGACGTTCCCAGCTTATCCTGCCCTAATGCTGTCATCATCGCAGTCTCCAAA

GGCCACCCAGCCCACAAGACTGGGAGCCCATCAGACCAGGTGGGTGCACAAGGGGCCAGGCCTGGCCTGGGGCACGGATGCTTGCAGGAACTGGACCGTT

TCCCGGCCTGTTGCTGTGGCAACGGGAGGGAAGGCACGTGTAAATGGTGTTGGCTTACAGGGTATATTTTTGATACCTTCAATGAGTTAATTCAGACGTC

TCACACAAGGAAGGACTCGCCCGTGTTTCTGCCGCTGTGCTTTGGTCTCTACCTACTGTTTCAGAGGCACGTGCCAGCCAAGGCGGTGGCCCCACCATAC

GCAGGACTTGGGGGTCAGGGGCTCCGGCACACGGCACTGTGCCCTTCCCCCCCACCCCCTTCCTTGGGCAAAATGGACTTGATGCGTATTCTGTGGCCGC

TCTCTGTGCACGGCGGCATTCTGTCATTTACACATGTTGTTCCAATTAGAAAGCAAATATACTCAAGTGACAACGTT
Translation
 - UNI18902 - - UNI30560 -  - UNI17689 - - UNI30560 - MSGSTQPVAQTWRAAEPRYPPHGISYPVQIARSHT - UNI17689

 - - UNI25772 - - UNI25795 - - UNI30560 - DVGLLEYQHHPRDYTSHLSPGSIIQPQRRRPSLLSEFQPGSER - UNI2098 - - 

UNI25772 - RSQELHLRPESRTFLPELGKPDIEFTESKRPRLELLPDTLLRPSPLLATGQPSGSEDLTK - UNI2098 - DRSLAGKLEPVSPPSP

PHADPELELAPSRLSKEELIQNMDRVDREITMVEQQISKLKKKQ QQLEEEAAKPPEPEKPVSPPPIESKHRSLVQIIYDENR KKAEAAHRILEGLGPQ

VEL PLYNQPSDTRQYHENIKI INQAMRKKLILYFKRRNHARKQW - UNI7790 - EQRFCQRYDQLMEAWEKKVERIENNPRRRAKESKVREYYEK

QFPEIRKQRELQERMQS SRVGQRGSGLSMSAARSEHEVSEIIDGLSEQE NLEKQMRQLAVIPPMLYDADQQRIKFINMNGLMDDPMKVYKDRQVTNMW

SEQERDTFREK KFMQHPKNFGLIASFLERK TVAECVLYYYLTKKNENYKSLVRRSYRRRGKSQ QQQQQQQQQQQQQMARSSQEEKEEKEKEKEADKE

EEKQDAENEKEELSK - UNI12291 - KEKTDDTSGEDNDEKEAVASKGRKTANSQGRRKGRITRSMANEANHEETATPQQSSELA ASMEMNESSRW

TEEEMETAKKG - UNI6109 - GLLEHGRNWSAIARMVGSKTVSQCKNFYFNYKKRQNLDEILQQHKLKM EKERNARRKKKKTPAAASEETAFPPAA

EDEEMEASGASANEEELAEEAEA - UNI6062 - ASQASGNEVPRVGECSGPA AAVNNSSDTESVPSPRSEATKDTGPKPTGTEALPAATQPPVPPP

EEPAVAPAEPSPVPDASGPPSPEPSPSPAAPPATVDKDEQEAPAAPAPQTEDAKEQKSEAEEIDVGKPEEPEASEEPPESVKSDHKEETEEEPEDKAKGT

EAIETVSEAPLKVEEAGSKAAVTKGSSSGATQDSDSSATCSADEVDEPEGGDKGR RLLSPRPSLLTPAGDPRASTSPQKPLDLKQLKQRAAAIPPI VT

KVHEPPREDTVPPKPVPPVPPPTQHLQPEGDVSQQSGGSPRGKSRSPVPPAEKEA AEKPAFFPAFPTEGPKLPTEPPRWSSGLPFPIPPREVIKTSPHA

ADPSAFSYTPPG GHPLPLGLHDSARPVLPRPPISNPPPLISSAKHPGVLERQLGAISQ QGMSVQLRVPHSEHAKAPMGPLTMGLPLAVDPKKLA APF

SGVKQEQLSPRGQAGPPESLGVPTAQETSVLRG GTALGSATSGSITKGLPSTRAADGPSYRGSITH - UNI1593 - GTPADVLYKGTISRIVGEDS

PSRLDRAREDTLPKGHVIYEGKKGHVLSYEG GGMSVSQCSKEDGRSSSGPPHETAAPKRTYDMMEGRVGRTVTSASIEG GLMGRAIPEQHSPHLKEQH

HIRGSITQG GIPRSYVEAQEDYLRREAKLLKREGTPPPPPPPRDLTETYKPRPLDPLGPLKLKPTHEGVVATVKEAGRSIHEIPREELRRTPELPLAPR

PLKEGSITQ GTPLKYDSGAPSTGTKKHDVRSIIGSPGRPFPALHPLDIMADARALERACYEESLKSRSGTSSGAGGSITRGAPVVVPELGKPRQSPLTY

EDHGAPFTSHLPRGSPVTTREPTPRLQEG GSLLSSKASQDRKLTSTPREIAKSPHSTVPEHHPHPISPYEHLLRGVTGVDLYRGHIPLAFDPTSIPRGI

PLEAA AAAAYYLPRHLAPSPTYPHLYPPYLIRGYPDTAALENRQTIINDYITSQQMHHNAASAMAQRADMLRGLSPRESSLALNYAAGPRG GIIDLSQ

VPHLPVLVPPTPGTPATAIDRLAYLPTAPPPFSSRHSSSPLSPG GGPTHLAKPTATSSSERERERERERDKSILTSTTTVEHAPIWRPG - UNI67 -

 GTEQSSGAGGSSRPASHTHQHSPISPRTQDALQQRPSVLHNTSMKGVVTSVEPGTPTVLRWAR RSTSTSSPVRPAATFPPATHCPLGGTLEGVYPTLM

EPVLLPKETSRVARPERPRVDAGHAFLTKPPAREPASSPSKSSEPRSLAPPSSSHTAIARTPAKNLAPHHASPDPPAPTSASDLHREKTQSKPFSIQELE

LRSLG GYHSGAGYSPDGVEPISPVSSPSLTHDKGLSKPLEELEKSHLEGELRHKQPG GPMKLSAEAAHLPHLRPLPESQPSSSPLLQTAPGIKGHQRV

VTLAQHIS EVITQDYTRHHPQQLSGPLPAPLYSFPGASCPVLDLRRPPSDLYLPPPDHGTPARGSPHSEGGKR RSPEPSKTSVLGSSEDAIEPVSPPE

GMTEPGHARSTAYPLLYRDGEQGEPR RMGSKSPGNTSQPPAFFSKLTESNSAMVKSKKQEINKKLNTHNRNEPEYN NIGQPGTEIFNMPAITGAG - 

UNI668 - GLMTCRSQAVQEHASTNMGLEAIIRKALMGKYDQWEEPPPLGANAFNPLNASASLPAAAMPITTADGRSDHALTSPG GGGGKAKVSGRPS

SRKAKSPAPGLASGDRPPSVSSVHSEGDCNRRTPLTNRVWEDRPSSAG GSTPFPYNPLIMRLQAGVMASPPPPGLAAGSGPLAGPHHAWDEEPKPLLCS

QYETLSDSE
Transcript ENSMUST00000111401
Sequence
CAGGAGCGGAGCCGCGGGCAGCGCAGGCCGGGCCGCATCCCCGTCCCCGCGCCAGCCGCCCGCGCCCGCCATGCGCGCCCCGCAGCGGCCCGCGCGTCCG

GGCCCCGCGTCGTAGCGCGGCGGGCGGAGACCGCAGGCTCTCAGCCCGGACCCGCCGCATCCTCGAGCCCGATCGGCGCCGTAGCCCGGCGCCAGCGCCC

GGTGCCGCCGCCGGCGAG - UNI18902 - - UNI30560 - TGCTCCTGAGTCTTTGAGGAACACAGCCTCCTGGTGGAAGTTCGTG - UNI176

89 - - UNI30560 - GCACCTGTGACGAGGTCACCTGCCAGCAGATGACCGAGACCAGCCCTTAGTCCTAGGTGTGGTCAAGAGTGTCTTGGGCTCC

AAAGCCTACCTGGACCCTACCACCATGTCAGGATCCACACAGCCTGTGGCACAGACATGGCGGGCTGCTGAGCCCCGCTACCCACCCCATGGCATCTCCT

ACCCGGTGCAGATAGCCCGGTCCCACACG - UNI17689 - - UNI25772 - - UNI25795 - - UNI30560 - GACGTGGGGCTGCTTGAG

TACCAACACCACCCCCGTGACTACACCTCACACCTGTCACCCGGTTCCATCATCCAGCCACAGAGGAGGCGGCCCTCACTGCTGTCAGAGTTCCAGCCTG

GGAGTGAACG - UNI2098 - - UNI25772 - GTCTCAGGAGCTCCACCTGCGCCCTGAGTCCCGCACGTTCCTGCCTGAGCTGGGCAAGCCCGAC

ATAGAATTCACCGAGAGCAAGCGCCCCCGCCTGGAGCTACTACCCGATACCCTGCTGCGCCCATCACCCCTGCTGGCCACTGGGCAGCCGAGTGGGTCTG

AAGACCTTACCAAG - UNI2098 - GACCGTAGCCTGGCAGGCAAGCTGGAGCCTGTGTCACCTCCCAGTCCCCCGCACGCTGACCCTGAGCTAGAGC

TGGCGCCATCTCGACTGTCCAAGGAGGAGCTGATCCAGAACATGGACCGCGTGGACCGTGAGATCACCATGGTAGAGCAGCAGATCTCCAAGCTGAAGAA

GAAGCAG CAACAGTTGGAGGAGGAGGCCGCCAAGCCGCCCGAACCCGAGAAGCCTGTGTCGCCACCACCCATAGAATCAAAGCACCGAAGCCTGGTCCA

GATCATCTACGATGAGAACCGG AAGAAAGCCGAAGCCGCACACCGGATCCTAGAAGGCCTGGGGCCCCAGGTGGAGCTG CCTCTGTACAACCAGCCGT

CTGACACACGCCAGTACCATGAAAACATCAAAAT AAACCAGGCGATGCGGAAGAAGCTGATCTTGTACTTTAAGCGGAGGAACCACGCGCGCAAGCAGT

GG - UNI7790 - GAACAGCGCTTCTGCCAGCGCTATGACCAGCTCATGGAGGCGTGGGAGAAGAAGGTAGAGCGCATAGAGAACAATCCGCGAAGGA

GGGCCAAGGAGAGCAAGGTGAGGGAGTACTACGAGAAACAGTTCCCGGAGATCCGCAAGCAGCGGGAGCTGCAGGAGCGCATGCAGAG CAGGGTGGGCC

AGCGTGGCAGTGGGCTCTCCATGTCGGCTGCCCGCAGTGAGCATGAGGTTTCTGAGATCATTGATGGCTTGTCTGAGCAGGAG AATCTGGAGAAGCAGA

TGCGCCAGCTGGCCGTGATCCCGCCCATGTTGTACGACGCGGACCAGCAGAGGATCAAGTTCATCAACATGAATGGACTCATGGATGACCCCATGAAGGT

CTACAAGGACCGTCAGGTTACCAACATGTGGAGCGAGCAGGAGAGGGACACCTTCCGTGAGAA GTTTATGCAGCACCCTAAGAACTTTGGCCTGATTGC

CTCATTCCTGGAGAGAAAG ACGGTCGCTGAGTGTGTCCTCTATTACTACCTGACCAAGAAGAATGAAAATTACAAGAGCTTGGTGAGGCGGAGCTATCG

GCGCCGTGGCAAGAGCCAG CAGCAGCAGCAGCAGCAACAACAGCAGCAGCAGCAGCAGATGGCACGGAGCAGCCAGGAGGAGAAGGAGGAGAAGGAGAA

GGAGAAGGAGGCCGACAAGGAGGAAGAGAAGCAGGATGCGGAGAACGAGAAGGAAGAACTCAGCAA - UNI12291 - GGAGAAGACAGACGACACTT

CTGGCGAGGACAACGATGAGAAAGAGGCCGTGGCCTCCAAAGGCCGCAAAACTGCCAACAGCCAAGGCCGCCGCAAAGGCCGTATCACGCGCTCCATGGC

CAACGAGGCCAACCATGAGGAGACAGCCACCCCACAGCAAAGTTCAGAGCTGG CTTCCATGGAGATGAACGAGAGTTCTCGCTGGACTGAGGAAGAGAT

GGAGACAGCAAAGAAAG - UNI6109 - GCCTCCTGGAACATGGGAGGAACTGGTCAGCCATTGCCCGTATGGTGGGCTCCAAGACCGTGTCCCAGTG

TAAGAACTTCTACTTCAACTACAAGAAGAGGCAGAACCTGGACGAAATCCTTCAGCAGCACAAGCTAAAGATG GAGAAGGAGAGGAACGCTCGGAGGAA

GAAGAAGAAGACCCCAGCTGCGGCGAGCGAGGAGACAGCCTTCCCACCTGCCGCTGAGGACGAAGAGATGGAAGCATCAGGCGCAAGTGCCAATGAGGAA

GAGCTGGCGGAGGAGGCAGAAG - UNI6062 - CCTCACAGGCCTCTGGGAATGAGGTTCCCAGAGTTGGGGAGTGCAGTGGCCCAG CTGCTGTCAA

CAACAGCTCTGATACTGAGAGTGTCCCATCCCCGCGTTCAGAAGCCACGAAGGACACTGGGCCTAAACCCACTGGCACTGAAGCATTGCCCGCTGCCACC

CAGCCACCTGTTCCTCCTCCAGAAGAACCGGCAGTAGCCCCTGCTGAGCCCTCCCCAGTCCCTGATGCCAGTGGCCCACCATCCCCAGAGCCT CATCAC

CTGCCGCACCCCCGGCTACTGTGGACAAGGATGAACAAGAAGCCCCGGCTGCTCCAGCTCCCCAGACAGAGGATGCCAAGGAGCAGAAGTCTGAGGCCGA

GGAGATCGATGTGGGAA CCAGAGGAGCCCGAGGCCTCTGAGGAGCCCCCGGAGAGTGTAAAGAGTGACCACAAGGAGGAGACCGAGGAAGAGCCTGAAG

ACAAAGCCAAGGGCACAGAGGCCATTGAAACTGTGTCTGAGGCACCACTTAAGGTGGAGGAGGCTGGTAGCAAGGCAGCTGTGACCAAGGGTTCCAGCTC

AGGTGCCACCCAGGACAGTGACTCCAGTGCCACCTGCAGTGCCGATGAGGTGGACGAACCCGAAGGAGGTGACAAGGGCAG GCTGCTGTCACCAAGGCC

CAGCCTCCTCACCCCGGCTGGAGATCCCCGGGCCAGTACCTCGCCCCAGAAGCCGCTGGACCTGAAGCAGCTGAAGCAGCGAGCAGCCGCCATCCCCCCT

ATC GTCACCAAGGTCCATGAGCCCCCCCGGGAGGACACAGTACCCCCAAAGCCAGTTCCCCCTGTGCCTCCACCCACGCAGCACCTACAGCCAGAGGGT

GACGTGTCTCAGCAGTCGGGAGGAAGTCCACGTGGCAAGTCCCGCAGCCCAGTGCCTCCTGCCGAGAAAGAGG CAGAGAAACCCGCATTCTTTCCGGCT

TTCCCAACTGAGGGCCCAAAGCTACCGACTGAGCCCCCACGCTGGTCATCGGGCCTGCCCTTCCCCATCCCTCCACGGGAGGTGATCAAGACTTCCCCAC

ACGCCGCTGACCCCTCTGCCTTCTCCTACACACCCCCCG GTCACCCGCTGCCTCTGGGCCTCCACGATAGTGCCCGGCCCGTCCTGCCACGTCCCCCCA

TCTCTAACCCCCCACCCCTCATCTCCTCTGCCAAGCATCCCGGCGTACTTGAGAGGCAGCTGGGTGCCATCTCCCAG CAGGGGATGTCAGTCCAGCTTC

GTGTGCCTCACTCAGAGCATGCCAAGGCCCCCATGGGCCCTCTCACCATGGGGCTGCCCCTTGCCGTGGACCCTAAGAAGCTGG GGACAGCACTGGGTT

CCGCCACCAGTGGAAGCATCACCAAGGGCCTCCCCAGTACCCGGGCTGCAGACGGCCCCAGCTACAGAGGCTCTATCACCCAC - UNI1593 - GGCA

CGCCCGCAGACGTCCTCTACAAGGGTACCATCAGCAGGATCGTCGGTGAGGACAGCCCAAGTCGCCTTGACCGGGCACGAGAGGACACCCTGCCCAAGGG

CCATGTCATCTATGAGGGCAAGAAAGGCCACGTCCTATCCTATGAAG GTGGTATGTCCGTGTCACAGTGCTCTAAGGAGGATGGAAGGAGCAGCTCGGG

CCCACCCCATGAGACTGCCGCCCCTAAACGCACCTATGACATGATGGAGGGCCGTGTAGGCAGGACTGTCACCTCAGCCAGCATAGAGG GACTCATGGG

CCGCGCCATCCCTGAGCAGCACAGCCCCCACCTCAAGGAGCAGCATCACATCCGAGGCTCCATCACGCAAG GCATCCCGAGGTCCTATGTGGAGGCGCA

GGAGGACTACTTACGGCGGGAGGCCAAGCTCTTGAAGCGAGAAGGGACACCACCACCCCCACCACCACCTCGGGACCTGACTGAGACCTACAAGCCCCGG

CCCCTGGACCCTCTGGGTCCCCTGAAGCTGAAGCCGACTCACGAGGGTGTGGTAGCAACTGTGAAGGAGGCGGGCCGCTCTATCCATGAGATCCCGAGAG

AGGAGCTGCGCCGCACACCTGAGCTACCCCTGGCACCACGGCCTCTGAAGGAGGGTTCCATCACCCAG GGCACCCCACTCAAGTACGACTCTGGGGCAC

CCTCCACTGGCACCAAGAAACACGACGTGCGCTCCATCATCGGCAGCCCCGGCCGGCCTTTCCCTGCCCTGCACCCGCTGGACATAATGGCTGACGCCCG

GGCACTGGAGCGTGCCTGCTATGAAGAGAGTCTGAAGAGCCGGTCAGGGACCAGCAGTGGTGCAGGGGGCTCCATCACACGTGGGGCTCCAGTCGTCGTG

CCTGAACTGGGCAAGCCACGGCAAAGCCCACTGACTTACGAAGACCACGGGGCACCCTTCACCAGTCACCTGCCACGTGGCTCCCCTGTGACCACGAGGG

AGCCCACGCCACGCCTTCAGGAAG GCAGCCTCCTATCCAGCAAGGCGTCCCAGGACCGGAAGCTGACATCTACACCCCGGGAGATCGCCAAGTCCCCAC

ACAGCACTGTGCCCGAGCACCACCCTCACCCCATCTCCCCCTATGAGCACTTGCTCCGGGGCGTGACTGGTGTGGACCTGTACCGTGGTCACATCCCATT

GGCCTTTGACCCCACCTCCATACCCCGAGGGATCCCTCTGGAAGCAG CAGCCGCAGCCTACTACCTGCCCCGGCACTTGGCCCCCAGCCCCACCTACCC

ACACCTGTACCCACCTTACCTCATCCGCGGCTACCCTGACACGGCGGCCCTGGAGAACCGCCAGACCATCATCAATGACTACATCACCTCGCAGCAGATG

CACCACAACGCTGCCTCCGCCATGGCCCAGCGTGCTGACATGCTGAGGGGTCTGTCACCGCGAGAGTCCTCGCTGGCCCTCAATTATGCCGCTGGCCCAA

GAG GCATTATCGACCTGTCCCAAGTGCCACACCTGCCCGTGCTGGTGCCACCAACGCCAGGCACCCCTGCCACCGCCATCGACCGCCTTGCCTACCTCC

CCACTGCGCCCCCACCCTTCAGCAGCCGCCACAGTAGCTCACCGCTGTCCCCAG GAGGCCCCACTCACCTAGCTAAACCAACTGCCACATCTTCATCGG

AGCGGGAACGGGAACGTGAGCGGGAACGAGACAAGTCCATCCTCACGTCTACCACTACAGTGGAGCATGCACCCATCTGGAGACCTG - UNI67 - GT

ACGGAGCAGAGCAGCGGGGCTGGGGGCAGCAGCCGCCCCGCCTCCCACACCCACCAGCACTCGCCCATCTCCCCCCGGACCCAGGACGCCTTGCAGCAGA

GGCCCAGTGTGCTGCACAACACGAGCATGAAGGGCGTGGTCACCTCCGTGGAACCCGGCACGCCCACGGTCCTGAGGTGGGCCAG GTCCACCTCCACCT

CTTCGCCTGTCCGCCCAGCTGCCACATTCCCACCTGCCACCCACTGCCCACTTGGTGGCACCCTTGAAGGGGTCTACCCTACCCTCATGGAGCCCGTCCT

GTTACCCAAGGAGACCTCTCGGGTCGCCCGGCCCGAGCGGCCCCGTGTGGACGCTGGCCATGCCTTCCTCACCAAACCCCCGGCCCGGGAGCCCGCCTCC

TCACCCAGCAAGAGCTCCGAGCCCCGATCCCTAGCACCCCCCAGCTCCAGCCACACAGCCATCGCCCGCACCCCAGCAAAGAACCTTGCACCCCACCATG

CCAGTCCGGACCCGCCGGCGCCCACCTCGGCCTCAGATCTGCACCGAGAAAAGACTCAAAGTAAACCCTTTTCCATCCAGGAATTGGAACTCCGTTCTCT

GG GTTACCACAGTGGAGCTGGCTACAGCCCCGATGGGGTGGAGCCCATCAGCCCGGTGAGCTCCCCCAGCCTGACCCACGACAAGGGGCTCTCCAAACC

TCTGGAAGAGCTAGAGAAGAGCCACTTGGAAGGGGAGCTGCGGCACAAGCAGCCAG GCCCCATGAAGCTCAGCGCGGAGGCTGCCCATCTCCCACATCT

GCGGCCACTGCCCGAGAGCCAGCCCTCATCTAGCCCACTCCTCCAGACTGCCCCAGGCATCAAAGGTCACCAGAGGGTGGTCACCTTGGCTCAGCACATC

AGT GAGGTCATTACGCAGGACTACACGCGCCACCACCCGCAGCAGCTCAGTGGCCCCCTTCCCGCCCCTCTCTACTCCTTTCCCGGAGCCAGCTGCCCT

GTCCTGGATCTTCGCCGCCCACCCAGTGACCTCTACCTCCCACCCCCCGACCATGGCACCCCAGCCCGGGGATCCCCCCACAGTGAAGGGGGCAAAAG G

TCCCCAGAACCCAGCAAAACATCGGTCCTGGGCAGCAGCGAGGATGCCATTGAGCCTGTGTCCCCACCAGAGGGCATGACTGAGCCAGGACATGCTCGGA

GCACTGCGTACCCACTGCTGTATCGAGACGGGGAACAGGGCGAGCCCAG GATGGGCTCTAAGTCTCCAGGCAACACCAGCCAGCCGCCAGCCTTCTTCA

GTAAGCTGACTGAGAGCAACTCCGCCATGGTGAAGTCGAAGAAGCAGGAGATCAACAAGAAACTCAACACCCACAACCGGAACGAGCCAGAATACA ATA

TTGGCCAGCCTGGGACGGAAATCTTCAACATGCCCGCCATCACTGGAGCAG - UNI668 - GCCTTATGACCTGTAGAAGCCAGGCGGTGCAAGAACA

CGCCAGCACCAACATGGGGCTAGAGGCCATTATTAGAAAGGCACTCATGGGTAAATATGATCAGTGGGAAGAGCCCCCGCCGCTCGGCGCCAATGCTTTT

AACCCTCTGAATGCCAGCGCCAGTCTGCCCGCTGCTGCTATGCCCATAACCACTGCTGACGGACGGAGTGACCACGCACTCACCTCGCCAG GTGGAGGT

GGGAAAGCCAAGGTCTCTGGCAGACCTAGCAGCCGAAAAGCCAAGTCGCCAGCACCAGGCCTAGCGTCCGGAGACCGACCCCCTTCTGTCTCCTCAGTAC

ACTCAGAGGGGGACTGCAATCGCCGAACACCACTCACCAACCGTGTGTGGGAGGACCGGCCCTCATCTGCAG GGTCCACGCCATTCCCCTACAACCCTT

TGATTATGAGGCTACAGGCAGGTGTCATGGCCTCCCCGCCCCCACCTGGCCTTGCGGCAGGCAGCGGGCCCCTAGCTGGTCCCCACCACGCCTGGGATGA

GGAGCCCAAGCCACTGCTGTGTTCACAGTATGAGACACTCTCGGACAGCGAGTGACCACGGATTGGGGGGGAGCGGTGCCAGGTCCCCGCACAAGGCAGA

AGCAGCCCAGCATGGAGCAGACAGCTGCTGACTCCCGAGACTGAGGAAGGAGCCCCTGAGTCTGCCTGCGCGTCCATCCGTCCGTCCGTCCACTCATCTG

TCCATCCAGAGCTGGCATCCTGCCTGTCTAAAGCCTTAACTAAGACTCCCACCCCGGGCTGGCCCTGCGCAGTGACCTTACACTCAGGGGATGTTTACCT

GGTGCTCGAGAGGGGAGTGGACAGGAGGGGAGGGACAGCGGGCCAGGAGGGGGGGGGACAGCAATCGTGTGTCAGTCGCACTCGTGCATCTGGGGCAGCG

GGGACCCACCACAGGCTGACCAGGCACCTCCATGCCACCGCCTCGCCCCTTACCGCATTTGGAACCAAAGTCTAAGCTGAACTCTCGCGTGGTCCTGCCC

CTCCCTCTGCCCCCAGCCCGCTTGCGCTCTGGACAGACAGACGTTCCCAGCTTATCCTGCCCTAATGCTGTCATCATCGCAGTCTCCAAAGGCCACCCAG

CCCACAAGACTGGGAGCCCATCAGACCAGGTGGGTGCACAAGGGGCCAGGCCTGGCCTGGGGCACGGATGCTTGCAGGAACTGGACCGTTTCCCGGCCTG

TTGCTGTGGCAACGGGAGGGAAGGCACGTGTAAATGGTGTTGGCTTACAGGGTATATTTTTGATACCTTCAATGAGTTAATTCAGACGTCTCACACAAGG

AAGGACTCGCCCGTGTTTCTGCCGCTGTGCTTTGGTCTCTACCTACTGTTTCAGAGGCACGTGCCAGCCAAGGCGGTGGCCCCACCATACGCAGGACTTG

GGGGTCAGGGGCTCCGGCACACGGCACTGTGCCCTTCCCCCCCACCCCCTTCCTTGGGCAAAATGGACTTGATGCGTATTCTGTGGCCGCTCTCTGTGCA

CGGCGGCATTCTGTCATTTACACATGTTGTTCCAATTAGAAAGCAAATATACTCAAGTGACAACGTT
Translation
 - UNI18902 - - UNI30560 -  - UNI17689 - - UNI30560 - MSGSTQPVAQTWRAAEPRYPPHGISYPVQIARSHT - UNI17689

 - - UNI25772 - - UNI25795 - - UNI30560 - DVGLLEYQHHPRDYTSHLSPGSIIQPQRRRPSLLSEFQPGSER - UNI2098 - - 

UNI25772 - RSQELHLRPESRTFLPELGKPDIEFTESKRPRLELLPDTLLRPSPLLATGQPSGSEDLTK - UNI2098 - DRSLAGKLEPVSPPSP

PHADPELELAPSRLSKEELIQNMDRVDREITMVEQQISKLKKKQ QQLEEEAAKPPEPEKPVSPPPIESKHRSLVQIIYDENR KKAEAAHRILEGLGPQ

VEL PLYNQPSDTRQYHENIKI INQAMRKKLILYFKRRNHARKQW - UNI7790 - EQRFCQRYDQLMEAWEKKVERIENNPRRRAKESKVREYYEK

QFPEIRKQRELQERMQS SRVGQRGSGLSMSAARSEHEVSEIIDGLSEQE NLEKQMRQLAVIPPMLYDADQQRIKFINMNGLMDDPMKVYKDRQVTNMW

SEQERDTFREK KFMQHPKNFGLIASFLERK TVAECVLYYYLTKKNENYKSLVRRSYRRRGKSQ QQQQQQQQQQQQQMARSSQEEKEEKEKEKEADKE

EEKQDAENEKEELSK - UNI12291 - KEKTDDTSGEDNDEKEAVASKGRKTANSQGRRKGRITRSMANEANHEETATPQQSSELA ASMEMNESSRW

TEEEMETAKKG - UNI6109 - GLLEHGRNWSAIARMVGSKTVSQCKNFYFNYKKRQNLDEILQQHKLKM EKERNARRKKKKTPAAASEETAFPPAA

EDEEMEASGASANEEELAEEAEA - UNI6062 - ASQASGNEVPRVGECSGPA AAVNNSSDTESVPSPRSEATKDTGPKPTGTEALPAATQPPVPPP

EEPAVAPAEPSPVPDASGPPSPEP HHLPHPRLLWTRMNKKPRLLQLPRQRMPRSRSLRPRRSMWE PEEPEASEEPPESVKSDHKEETEEEPEDKAKGT

EAIETVSEAPLKVEEAGSKAAVTKGSSSGATQDSDSSATCSADEVDEPEGGDKGR RLLSPRPSLLTPAGDPRASTSPQKPLDLKQLKQRAAAIPPI VT

KVHEPPREDTVPPKPVPPVPPPTQHLQPEGDVSQQSGGSPRGKSRSPVPPAEKEA AEKPAFFPAFPTEGPKLPTEPPRWSSGLPFPIPPREVIKTSPHA

ADPSAFSYTPPG GHPLPLGLHDSARPVLPRPPISNPPPLISSAKHPGVLERQLGAISQ QGMSVQLRVPHSEHAKAPMGPLTMGLPLAVDPKKLG GTA

LGSATSGSITKGLPSTRAADGPSYRGSITH - UNI1593 - GTPADVLYKGTISRIVGEDSPSRLDRAREDTLPKGHVIYEGKKGHVLSYEG GGMSV

SQCSKEDGRSSSGPPHETAAPKRTYDMMEGRVGRTVTSASIEG GLMGRAIPEQHSPHLKEQHHIRGSITQG GIPRSYVEAQEDYLRREAKLLKREGTP

PPPPPPRDLTETYKPRPLDPLGPLKLKPTHEGVVATVKEAGRSIHEIPREELRRTPELPLAPRPLKEGSITQ GTPLKYDSGAPSTGTKKHDVRSIIGSP

GRPFPALHPLDIMADARALERACYEESLKSRSGTSSGAGGSITRGAPVVVPELGKPRQSPLTYEDHGAPFTSHLPRGSPVTTREPTPRLQEG GSLLSSK

ASQDRKLTSTPREIAKSPHSTVPEHHPHPISPYEHLLRGVTGVDLYRGHIPLAFDPTSIPRGIPLEAA AAAAYYLPRHLAPSPTYPHLYPPYLIRGYPD

TAALENRQTIINDYITSQQMHHNAASAMAQRADMLRGLSPRESSLALNYAAGPRG GIIDLSQVPHLPVLVPPTPGTPATAIDRLAYLPTAPPPFSSRHS

SSPLSPG GGPTHLAKPTATSSSERERERERERDKSILTSTTTVEHAPIWRPG - UNI67 - GTEQSSGAGGSSRPASHTHQHSPISPRTQDALQQRP

SVLHNTSMKGVVTSVEPGTPTVLRWAR RSTSTSSPVRPAATFPPATHCPLGGTLEGVYPTLMEPVLLPKETSRVARPERPRVDAGHAFLTKPPAREPAS

SPSKSSEPRSLAPPSSSHTAIARTPAKNLAPHHASPDPPAPTSASDLHREKTQSKPFSIQELELRSLG GYHSGAGYSPDGVEPISPVSSPSLTHDKGLS

KPLEELEKSHLEGELRHKQPG GPMKLSAEAAHLPHLRPLPESQPSSSPLLQTAPGIKGHQRVVTLAQHIS EVITQDYTRHHPQQLSGPLPAPLYSFPG

ASCPVLDLRRPPSDLYLPPPDHGTPARGSPHSEGGKR RSPEPSKTSVLGSSEDAIEPVSPPEGMTEPGHARSTAYPLLYRDGEQGEPR RMGSKSPGNT

SQPPAFFSKLTESNSAMVKSKKQEINKKLNTHNRNEPEYN NIGQPGTEIFNMPAITGAG - UNI668 - GLMTCRSQAVQEHASTNMGLEAIIRKAL

MGKYDQWEEPPPLGANAFNPLNASASLPAAAMPITTADGRSDHALTSPG GGGGKAKVSGRPSSRKAKSPAPGLASGDRPPSVSSVHSEGDCNRRTPLTN

RVWEDRPSSAG GSTPFPYNPLIMRLQAGVMASPPPPGLAAGSGPLAGPHHAWDEEPKPLLCSQYETLSDSE
Transcript ENSMUST00000111400
Sequence
CAGGAGCGGAGCCGCGGGCAGCGCAGGCCGGGCCGCATCCCCGTCCCCGCGCCAGCCGCCCGCGCCCGCCATGCGCGCCCCGCAGCGGCCCGCGCGTCCG

GGCCCCGCGTCGTAGCGCGGCGGGCGGAGACCGCAGGCTCTCAGCCCGGACCCGCCGCATCCTCGAGCCCGATCGGCGCCGTAGCCCGGCGCCAGCGCCC

GGTGCCGCCGCCGGCGAG - UNI18902 - - UNI30560 - TGCTCCTGAGTCTTTGAGGAACACAGCCTCCTGGTGGAAGTTCGTG - UNI176

89 - - UNI30560 - GCACCTGTGACGAGGTCACCTGCCAGCAGATGACCGAGACCAGCCCTTAGTCCTAGGTGTGGTCAAGAGTGTCTTGGGCTCC

AAAGCCTACCTGGACCCTACCACCATGTCAGGATCCACACAGCCTGTGGCACAGACATGGCGGGCTGCTGAGCCCCGCTACCCACCCCATGGCATCTCCT

ACCCGGTGCAGATAGCCCGGTCCCACACG - UNI2098 - - UNI17689 - - UNI25772 - - UNI25795 - - UNI30560 - CCTCTG

TACAACCAGCCGTCTGACACACGCCAGTACCATGAAAACATCAAAAT AAACCAGGCGATGCGGAAGAAGCTGATCTTGTACTTTAAGCGGAGGAACCAC

GCGCGCAAGCAGTGG - UNI7790 - GAACAGCGCTTCTGCCAGCGCTATGACCAGCTCATGGAGGCGTGGGAGAAGAAGGTAGAGCGCATAGAGAAC

AATCCGCGAAGGAGGGCCAAGGAGAGCAAGGTGAGGGAGTACTACGAGAAACAGTTCCCGGAGATCCGCAAGCAGCGGGAGCTGCAGGAGCGCATGCAGA

G CAGGGTGGGCCAGCGTGGCAGTGGGCTCTCCATGTCGGCTGCCCGCAGTGAGCATGAGGTTTCTGAGATCATTGATGGCTTGTCTGAGCAGGAG AAT

CTGGAGAAGCAGATGCGCCAGCTGGCCGTGATCCCGCCCATGTTGTACGACGCGGACCAGCAGAGGATCAAGTTCATCAACATGAATGGACTCATGGATG

ACCCCATGAAGGTCTACAAGGACCGTCAGGTTACCAACATGTGGAGCGAGCAGGAGAGGGACACCTTCCGTGAGAA GTTTATGCAGCACCCTAAGAACT

TTGGCCTGATTGCCTCATTCCTGGAGAGAAAG ACGGTCGCTGAGTGTGTCCTCTATTACTACCTGACCAAGAAGAATGAAAATTACAAGAGCTTGGTGA

GGCGGAGCTATCGGCGCCGTGGCAAGAGCCAG CAGCAGCAGCAGCAGCAACAACAGCAGCAGCAGCAGCAGATGGCACGGAGCAGCCAGGAGGAGAAGG

AGGAGAAGGAGAAGGAGAAGGAGGCCGACAAGGAGGAAGAGAAGCAGGATGCGGAGAACGAGAAGGAAGAACTCAGCAA - UNI12291 - GGAGAAG

ACAGACGACACTTCTGGCGAGGACAACGATGAGAAAGAGGCCGTGGCCTCCAAAGGCCGCAAAACTGCCAACAGCCAAGGCCGCCGCAAAGGCCGTATCA

CGCGCTCCATGGCCAACGAGGCCAACCATGAGGAGACAGCCACCCCACAGCAAAGTTCAGAGCTGG CTTCCATGGAGATGAACGAGAGTTCTCGCTGGA

CTGAGGAAGAGATGGAGACAGCAAAGAAAG - UNI6109 - GCCTCCTGGAACATGGGAGGAACTGGTCAGCCATTGCCCGTATGGTGGGCTCCAAGA

CCGTGTCCCAGTGTAAGAACTTCTACTTCAACTACAAGAAGAGGCAGAACCTGGACGAAATCCTTCAGCAGCACAAGCTAAAGATG GAGAAGGAGAGGA

ACGCTCGGAGGAAGAAGAAGAAGACCCCAGCTGCGGCGAGCGAGGAGACAGCCTTCCCACCTGCCGCTGAGGACGAAGAGATGGAAGCATCAGGCGCAAG

TGCCAATGAGGAAGAGCTGGCGGAGGAGGCAGAAG - UNI6062 - CCTCACAGGCCTCTGGGAATGAGGTTCCCAGAGTTGGGGAGTGCAGTGGCCC

AG CTGCTGTCAACAACAGCTCTGATACTGAGAGTGTCCCATCCCCGCGTTCAGAAGCCACGAAGGACACTGGGCCTAAACCCACTGGCACTGAAGCATT

GCCCGCTGCCACCCAGCCACCTGTTCCTCCTCCAGAAGAACCGGCAGTAGCCCCTGCTGAGCCCTCCCCAGTCCCTGATGCCAGTGGCCCACCATCCCCA

GAGCCT CATCACCTGCCGCACCCCCGGCTACTGTGGACAAGGATGAACAAGAAGCCCCGGCTGCTCCAGCTCCCCAGACAGAGGATGCCAAGGAGCAGA

AGTCTGAGGCCGAGGAGATCGATGTGGGAA CCAGAGGAGCCCGAGGCCTCTGAGGAGCCCCCGGAGAGTGTAAAGAGTGACCACAAGGAGGAGACCGAG

GAAGAGCCTGAAGACAAAGCCAAGGGCACAGAGGCCATTGAAACTGTGTCTGAGGCACCACTTAAGGTGGAGGAGGCTGGTAGCAAGGCAGCTGTGACCA

AGGGTTCCAGCTCAGGTGCCACCCAGGACAGTGACTCCAGTGCCACCTGCAGTGCCGATGAGGTGGACGAACCCGAAGGAGGTGACAAGGGCAG GCTGC

TGTCACCAAGGCCCAGCCTCCTCACCCCGGCTGGAGATCCCCGGGCCAGTACCTCGCCCCAGAAGCCGCTGGACCTGAAGCAGCTGAAGCAGCGAGCAGC

CGCCATCCCCCCTATC GTCACCAAGGTCCATGAGCCCCCCCGGGAGGACACAGTACCCCCAAAGCCAGTTCCCCCTGTGCCTCCACCCACGCAGCACCT

ACAGCCAGAGGGTGACGTGTCTCAGCAGTCGGGAGGAAGTCCACGTGGCAAGTCCCGCAGCCCAGTGCCTCCTGCCGAGAAAGAGG CAGAGAAACCCGC

ATTCTTTCCGGCTTTCCCAACTGAGGGCCCAAAGCTACCGACTGAGCCCCCACGCTGGTCATCGGGCCTGCCCTTCCCCATCCCTCCACGGGAGGTGATC

AAGACTTCCCCACACGCCGCTGACCCCTCTGCCTTCTCCTACACACCCCCCG GTCACCCGCTGCCTCTGGGCCTCCACGATAGTGCCCGGCCCGTCCTG

CCACGTCCCCCCATCTCTAACCCCCCACCCCTCATCTCCTCTGCCAAGCATCCCGGCGTACTTGAGAGGCAGCTGGGTGCCATCTCCCAG CAGGGGATG

TCAGTCCAGCTTCGTGTGCCTCACTCAGAGCATGCCAAGGCCCCCATGGGCCCTCTCACCATGGGGCTGCCCCTTGCCGTGGACCCTAAGAAGCTGG GG

ACAGCACTGGGTTCCGCCACCAGTGGAAGCATCACCAAGGGCCTCCCCAGTACCCGGGCTGCAGACGGCCCCAGCTACAGAGGCTCTATCACCCAC - U

NI1593 - GGCACGCCCGCAGACGTCCTCTACAAGGGTACCATCAGCAGGATCGTCGGTGAGGACAGCCCAAGTCGCCTTGACCGGGCACGAGAGGACA

CCCTGCCCAAGGGCCATGTCATCTATGAGGGCAAGAAAGGCCACGTCCTATCCTATGAAG GTGGTATGTCCGTGTCACAGTGCTCTAAGGAGGATGGAA

GGAGCAGCTCGGGCCCACCCCATGAGACTGCCGCCCCTAAACGCACCTATGACATGATGGAGGGCCGTGTAGGCAGGACTGTCACCTCAGCCAGCATAGA

GG GACTCATGGGCCGCGCCATCCCTGAGCAGCACAGCCCCCACCTCAAGGAGCAGCATCACATCCGAGGCTCCATCACGCAAG GCATCCCGAGGTCCT

ATGTGGAGGCGCAGGAGGACTACTTACGGCGGGAGGCCAAGCTCTTGAAGCGAGAAGGGACACCACCACCCCCACCACCACCTCGGGACCTGACTGAGAC

CTACAAGCCCCGGCCCCTGGACCCTCTGGGTCCCCTGAAGCTGAAGCCGACTCACGAGGGTGTGGTAGCAACTGTGAAGGAGGCGGGCCGCTCTATCCAT

GAGATCCCGAGAGAGGAGCTGCGCCGCACACCTGAGCTACCCCTGGCACCACGGCCTCTGAAGGAGGGTTCCATCACCCAG GGCACCCCACTCAAGTAC

GACTCTGGGGCACCCTCCACTGGCACCAAGAAACACGACGTGCGCTCCATCATCGGCAGCCCCGGCCGGCCTTTCCCTGCCCTGCACCCGCTGGACATAA

TGGCTGACGCCCGGGCACTGGAGCGTGCCTGCTATGAAGAGAGTCTGAAGAGCCGGTCAGGGACCAGCAGTGGTGCAGGGGGCTCCATCACACGTGGGGC

TCCAGTCGTCGTGCCTGAACTGGGCAAGCCACGGCAAAGCCCACTGACTTACGAAGACCACGGGGCACCCTTCACCAGTCACCTGCCACGTGGCTCCCCT

GTGACCACGAGGGAGCCCACGCCACGCCTTCAGGAAG GCAGCCTCCTATCCAGCAAGGCGTCCCAGGACCGGAAGCTGACATCTACACCCCGGGAGATC

GCCAAGTCCCCACACAGCACTGTGCCCGAGCACCACCCTCACCCCATCTCCCCCTATGAGCACTTGCTCCGGGGCGTGACTGGTGTGGACCTGTACCGTG

GTCACATCCCATTGGCCTTTGACCCCACCTCCATACCCCGAGGGATCCCTCTGGAAGCAG CAGCCGCAGCCTACTACCTGCCCCGGCACTTGGCCCCCA

GCCCCACCTACCCACACCTGTACCCACCTTACCTCATCCGCGGCTACCCTGACACGGCGGCCCTGGAGAACCGCCAGACCATCATCAATGACTACATCAC

CTCGCAGCAGATGCACCACAACGCTGCCTCCGCCATGGCCCAGCGTGCTGACATGCTGAGGGGTCTGTCACCGCGAGAGTCCTCGCTGGCCCTCAATTAT

GCCGCTGGCCCAAGAG GCATTATCGACCTGTCCCAAGTGCCACACCTGCCCGTGCTGGTGCCACCAACGCCAGGCACCCCTGCCACCGCCATCGACCGC

CTTGCCTACCTCCCCACTGCGCCCCCACCCTTCAGCAGCCGCCACAGTAGCTCACCGCTGTCCCCAG GAGGCCCCACTCACCTAGCTAAACCAACTGCC

ACATCTTCATCGGAGCGGGAACGGGAACGTGAGCGGGAACGAGACAAGTCCATCCTCACGTCTACCACTACAGTGGAGCATGCACCCATCTGGAGACCTG

 - UNI67 - GTACGGAGCAGAGCAGCGGGGCTGGGGGCAGCAGCCGCCCCGCCTCCCACACCCACCAGCACTCGCCCATCTCCCCCCGGACCCAGGAC

GCCTTGCAGCAGAGGCCCAGTGTGCTGCACAACACGAGCATGAAGGGCGTGGTCACCTCCGTGGAACCCGGCACGCCCACGGTCCTGAGGTGGGCCAG G

TCCACCTCCACCTCTTCGCCTGTCCGCCCAGCTGCCACATTCCCACCTGCCACCCACTGCCCACTTGGTGGCACCCTTGAAGGGGTCTACCCTACCCTCA

TGGAGCCCGTCCTGTTACCCAAGGAGACCTCTCGGGTCGCCCGGCCCGAGCGGCCCCGTGTGGACGCTGGCCATGCCTTCCTCACCAAACCCCCGGCCCG

GGAGCCCGCCTCCTCACCCAGCAAGAGCTCCGAGCCCCGATCCCTAGCACCCCCCAGCTCCAGCCACACAGCCATCGCCCGCACCCCAGCAAAGAACCTT

GCACCCCACCATGCCAGTCCGGACCCGCCGGCGCCCACCTCGGCCTCAGATCTGCACCGAGAAAAGACTCAAAGTAAACCCTTTTCCATCCAGGAATTGG

AACTCCGTTCTCTGG GTTACCACAGTGGAGCTGGCTACAGCCCCGATGGGGTGGAGCCCATCAGCCCGGTGAGCTCCCCCAGCCTGACCCACGACAAGG

GGCTCTCCAAACCTCTGGAAGAGCTAGAGAAGAGCCACTTGGAAGGGGAGCTGCGGCACAAGCAGCCAG GCCCCATGAAGCTCAGCGCGGAGGCTGCCC

ATCTCCCACATCTGCGGCCACTGCCCGAGAGCCAGCCCTCATCTAGCCCACTCCTCCAGACTGCCCCAGGCATCAAAGGTCACCAGAGGGTGGTCACCTT

GGCTCAGCACATCAGT GAGGTCATTACGCAGGACTACACGCGCCACCACCCGCAGCAGCTCAGTGGCCCCCTTCCCGCCCCTCTCTACTCCTTTCCCGG

AGCCAGCTGCCCTGTCCTGGATCTTCGCCGCCCACCCAGTGACCTCTACCTCCCACCCCCCGACCATGGCACCCCAGCCCGGGGATCCCCCCACAGTGAA

GGGGGCAAAAG GTCCCCAGAACCCAGCAAAACATCGGTCCTGGGCAGCAGCGAGGATGCCATTGAGCCTGTGTCCCCACCAGAGGGCATGACTGAGCCA

GGACATGCTCGGAGCACTGCGTACCCACTGCTGTATCGAGACGGGGAACAGGGCGAGCCCAG GATGGGCTCTAAGTCTCCAGGCAACACCAGCCAGCCG

CCAGCCTTCTTCAGTAAGCTGACTGAGAGCAACTCCGCCATGGTGAAGTCGAAGAAGCAGGAGATCAACAAGAAACTCAACACCCACAACCGGAACGAGC

CAGAATACA ATATTGGCCAGCCTGGGACGGAAATCTTCAACATGCCCGCCATCACTGGAGCAG - UNI668 - GCCTTATGACCTGTAGAAGCCAGG

CGGTGCAAGAACACGCCAGCACCAACATGGGGCTAGAGGCCATTATTAGAAAGGCACTCATGGGTAAATATGATCAGTGGGAAGAGCCCCCGCCGCTCGG

CGCCAATGCTTTTAACCCTCTGAATGCCAGCGCCAGTCTGCCCGCTGCTGCTATGCCCATAACCACTGCTGACGGACGGAGTGACCACGCACTCACCTCG

CCAG GTGGAGGTGGGAAAGCCAAGGTCTCTGGCAGACCTAGCAGCCGAAAAGCCAAGTCGCCAGCACCAGGCCTAGCGTCCGGAGACCGACCCCCTTCT

GTCTCCTCAGTACACTCAGAGGGGGACTGCAATCGCCGAACACCACTCACCAACCGTGTGTGGGAGGACCGGCCCTCATCTGCAG GGTCCACGCCATTC

CCCTACAACCCTTTGATTATGAGGCTACAGGCAGGTGTCATGGCCTCCCCGCCCCCACCTGGCCTTGCGGCAGGCAGCGGGCCCCTAGCTGGTCCCCACC

ACGCCTGGGATGAGGAGCCCAAGCCACTGCTGTGTTCACAGTATGAGACACTCTCGGACAGCGAGTGACCACGGATTGGGGGGGAGCGGTGCCAGGTCCC

CGCACAAGGCAGAAGCAGCCCAGCATGGAGCAGACAGCTGCTGACTCCCGAGACTGAGGAAGGAGCCCCTGAGTCTGCCTGCGCGTCCATCCGTCCGTCC

GTCCACTCATCTGTCCATCCAGAGCTGGCATCCTGCCTGTCTAAAGCCTTAACTAAGACTCCCACCCCGGGCTGGCCCTGCGCAGTGACCTTACACTCAG

GGGATGTTTACCTGGTGCTCGAGAGGGGAGTGGACAGGAGGGGAGGGACAGCGGGCCAGGAGGGGGGGGGACAGCAATCGTGTGTCAGTCGCACTCGTGC

ATCTGGGGCAGCGGGGACCCACCACAGGCTGACCAGGCACCTCCATGCCACCGCCTCGCCCCTTACCGCATTTGGAACCAAAGTCTAAGCTGAACTCTCG

CGTGGTCCTGCCCCTCCCTCTGCCCCCAGCCCGCTTGCGCTCTGGACAGACAGACGTTCCCAGCTTATCCTGCCCTAATGCTGTCATCATCGCAGTCTCC

AAAGGCCACCCAGCCCACAAGACTGGGAGCCCATCAGACCAGGTGGGTGCACAAGGGGCCAGGCCTGGCCTGGGGCACGGATGCTTGCAGGAACTGGACC

GTTTCCCGGCCTGTTGCTGTGGCAACGGGAGGGAAGGCACGTGTAAATGGTGTTGGCTTACAGGGTATATTTTTGATACCTTCAATGAGTTAATTCAGAC

GTCTCACACAAGGAAGGACTCGCCCGTGTTTCTGCCGCTGTGCTTTGGTCTCTACCTACTGTTTCAGAGGCACGTGCCAGCCAAGGCGGTGGCCCCACCA

TACGCAGGACTTGGGGGTCAGGGGCTCCGGCACACGGCACTGTGCCCTTCCCCCCCACCCCCTTCCTTGGGCAAAATGGACTTGATGCGTATTCTGTGGC

CGCTCTCTGTGCACGGCGGCATTCTGTCATTTACACATGTTGTTCCAATTAGAAAGCAAATATACTCAAGTGACAACGTT
Translation
 - UNI18902 - - UNI30560 -  - UNI17689 - - UNI30560 - MSGSTQPVAQTWRAAEPRYPPHGISYPVQIARSHT - UNI2098 

- - UNI17689 - - UNI25772 - - UNI25795 - - UNI30560 - PLYNQPSDTRQYHENIKI INQAMRKKLILYFKRRNHARKQW - U

NI7790 - EQRFCQRYDQLMEAWEKKVERIENNPRRRAKESKVREYYEKQFPEIRKQRELQERMQS SRVGQRGSGLSMSAARSEHEVSEIIDGLSEQE

 NLEKQMRQLAVIPPMLYDADQQRIKFINMNGLMDDPMKVYKDRQVTNMWSEQERDTFREK KFMQHPKNFGLIASFLERK TVAECVLYYYLTKKNENY

KSLVRRSYRRRGKSQ QQQQQQQQQQQQQMARSSQEEKEEKEKEKEADKEEEKQDAENEKEELSK - UNI12291 - KEKTDDTSGEDNDEKEAVASK

GRKTANSQGRRKGRITRSMANEANHEETATPQQSSELA ASMEMNESSRWTEEEMETAKKG - UNI6109 - GLLEHGRNWSAIARMVGSKTVSQCKN

FYFNYKKRQNLDEILQQHKLKM EKERNARRKKKKTPAAASEETAFPPAAEDEEMEASGASANEEELAEEAEA - UNI6062 - ASQASGNEVPRVGE

CSGPA AAVNNSSDTESVPSPRSEATKDTGPKPTGTEALPAATQPPVPPPEEPAVAPAEPSPVPDASGPPSPEP HHLPHPRLLWTRMNKKPRLLQLPRQ

RMPRSRSLRPRRSMWE PEEPEASEEPPESVKSDHKEETEEEPEDKAKGTEAIETVSEAPLKVEEAGSKAAVTKGSSSGATQDSDSSATCSADEVDEPEG

GDKGR RLLSPRPSLLTPAGDPRASTSPQKPLDLKQLKQRAAAIPPI VTKVHEPPREDTVPPKPVPPVPPPTQHLQPEGDVSQQSGGSPRGKSRSPVPP

AEKEA AEKPAFFPAFPTEGPKLPTEPPRWSSGLPFPIPPREVIKTSPHAADPSAFSYTPPG GHPLPLGLHDSARPVLPRPPISNPPPLISSAKHPGVL

ERQLGAISQ QGMSVQLRVPHSEHAKAPMGPLTMGLPLAVDPKKLG GTALGSATSGSITKGLPSTRAADGPSYRGSITH - UNI1593 - GTPADVL

YKGTISRIVGEDSPSRLDRAREDTLPKGHVIYEGKKGHVLSYEG GGMSVSQCSKEDGRSSSGPPHETAAPKRTYDMMEGRVGRTVTSASIEG GLMGRA

IPEQHSPHLKEQHHIRGSITQG GIPRSYVEAQEDYLRREAKLLKREGTPPPPPPPRDLTETYKPRPLDPLGPLKLKPTHEGVVATVKEAGRSIHEIPRE

ELRRTPELPLAPRPLKEGSITQ GTPLKYDSGAPSTGTKKHDVRSIIGSPGRPFPALHPLDIMADARALERACYEESLKSRSGTSSGAGGSITRGAPVVV

PELGKPRQSPLTYEDHGAPFTSHLPRGSPVTTREPTPRLQEG GSLLSSKASQDRKLTSTPREIAKSPHSTVPEHHPHPISPYEHLLRGVTGVDLYRGHI

PLAFDPTSIPRGIPLEAA AAAAYYLPRHLAPSPTYPHLYPPYLIRGYPDTAALENRQTIINDYITSQQMHHNAASAMAQRADMLRGLSPRESSLALNYA

AGPRG GIIDLSQVPHLPVLVPPTPGTPATAIDRLAYLPTAPPPFSSRHSSSPLSPG GGPTHLAKPTATSSSERERERERERDKSILTSTTTVEHAPIW

RPG - UNI67 - GTEQSSGAGGSSRPASHTHQHSPISPRTQDALQQRPSVLHNTSMKGVVTSVEPGTPTVLRWAR RSTSTSSPVRPAATFPPATHCP

LGGTLEGVYPTLMEPVLLPKETSRVARPERPRVDAGHAFLTKPPAREPASSPSKSSEPRSLAPPSSSHTAIARTPAKNLAPHHASPDPPAPTSASDLHRE

KTQSKPFSIQELELRSLG GYHSGAGYSPDGVEPISPVSSPSLTHDKGLSKPLEELEKSHLEGELRHKQPG GPMKLSAEAAHLPHLRPLPESQPSSSPL

LQTAPGIKGHQRVVTLAQHIS EVITQDYTRHHPQQLSGPLPAPLYSFPGASCPVLDLRRPPSDLYLPPPDHGTPARGSPHSEGGKR RSPEPSKTSVLG

SSEDAIEPVSPPEGMTEPGHARSTAYPLLYRDGEQGEPR RMGSKSPGNTSQPPAFFSKLTESNSAMVKSKKQEINKKLNTHNRNEPEYN NIGQPGTEI

FNMPAITGAG - UNI668 - GLMTCRSQAVQEHASTNMGLEAIIRKALMGKYDQWEEPPPLGANAFNPLNASASLPAAAMPITTADGRSDHALTSPG 

GGGGKAKVSGRPSSRKAKSPAPGLASGDRPPSVSSVHSEGDCNRRTPLTNRVWEDRPSSAG GSTPFPYNPLIMRLQAGVMASPPPPGLAAGSGPLAGPH

HAWDEEPKPLLCSQYETLSDSE
Transcript ENSMUST00000111398
Sequence
GCCGCCAGGAGCGGAGCCGCGGGCAGCGCAGGCCGGGCCGCATCCCCGTCCCCGCGCCAGCCGCCCGCGCCCGCCATGCGCGCCCCGCAGCGGCCCGCGC

GTCCGGGCCCCGCGTCGTAGCGCGGCGGGCGGAGACCGCAGGCTCTCAGCCCGGACCCGCCGCATCCTCGAGCCCGATCGGCGCCGTAGCCCGGCGCCAG

CGCCCGGTGCCGCCGCCGGCGAG - UNI18902 - - UNI30560 - TGCTCCTGAGTCTTTGAGGAACACAGCCTCCTGGTGGAAGTTCGTG - U

NI17689 - - UNI30560 - GCACCTGTGACGAGGTCACCTGCCAGCAGATGACCGAGACCAGCCCTTAGTCCTAGGTGTGGTCAAGAGTGTCTTGG

GCTCCAAAGCCTACCTGGACCCTACCACCATGTCAGGATCCACACAGCCTGTGGCACAGACATGGCGGGCTGCTGAGCCCCGCTACCCACCCCATGGCAT

CTCCTACCCGGTGCAGATAGCCCGGTCCCACACG - UNI17689 - - UNI25772 - - UNI25795 - - UNI30560 - GACGTGGGGCTGC

TTGAGTACCAACACCACCCCCGTGACTACACCTCACACCTGTCACCCGGTTCCATCATCCAGCCACAGAGGAGGCGGCCCTCACTGCTGTCAGAGTTCCA

GCCTGGGAGTGAACG - UNI2098 - - UNI25772 - GTCTCAGGAGCTCCACCTGCGCCCTGAGTCCCGCACGTTCCTGCCTGAGCTGGGCAAGC

CCGACATAGAATTCACCGAGAGCAAGCGCCCCCGCCTGGAGCTACTACCCGATACCCTGCTGCGCCCATCACCCCTGCTGGCCACTGGGCAGCCGAGTGG

GTCTGAAGACCTTACCAAG - UNI2098 - GACCGTAGCCTGGCAGGCAAGCTGGAGCCTGTGTCACCTCCCAGTCCCCCGCACGCTGACCCTGAGCT

AGAGCTGGCGCCATCTCGACTGTCCAAGGAGGAGCTGATCCAGAACATGGACCGCGTGGACCGTGAGATCACCATGGTAGAGCAGCAGATCTCCAAGCTG

AAGAAGAAGCAG CAACAGTTGGAGGAGGAGGCCGCCAAGCCGCCCGAACCCGAGAAGCCTGTGTCGCCACCACCCATAGAATCAAAGCACCGAAGCCTG

GTCCAGATCATCTACGATGAGAACCGG AAGAAAGCCGAAGCCGCACACCGGATCCTAGAAGGCCTGGGGCCCCAGGTGGAGCTG CCTCTGTACAACCA

GCCGTCTGACACACGCCAGTACCATGAAAACATCAAAAT AAACCAGGCGATGCGGAAGAAGCTGATCTTGTACTTTAAGCGGAGGAACCACGCGCGCAA

GCAGTGG - UNI7790 - GAACAGCGCTTCTGCCAGCGCTATGACCAGCTCATGGAGGCGTGGGAGAAGAAGGTAGAGCGCATAGAGAACAATCCGCG

AAGGAGGGCCAAGGAGAGCAAGGTGAGGGAGTACTACGAGAAACAGTTCCCGGAGATCCGCAAGCAGCGGGAGCTGCAGGAGCGCATGCAGAG CAGGGT

GGGCCAGCGTGGCAGTGGGCTCTCCATGTCGGCTGCCCGCAGTGAGCATGAGGTTTCTGAGATCATTGATGGCTTGTCTGAGCAGGAG AATCTGGAGAA

GCAGATGCGCCAGCTGGCCGTGATCCCGCCCATGTTGTACGACGCGGACCAGCAGAGGATCAAGTTCATCAACATGAATGGACTCATGGATGACCCCATG

AAGGTCTACAAGGACCGTCAGGTTACCAACATGTGGAGCGAGCAGGAGAGGGACACCTTCCGTGAGAA GTTTATGCAGCACCCTAAGAACTTTGGCCTG

ATTGCCTCATTCCTGGAGAGAAAG ACGGTCGCTGAGTGTGTCCTCTATTACTACCTGACCAAGAAGAATGAAAATTACAAGAGCTTGGTGAGGCGGAGC

TATCGGCGCCGTGGCAAGAGCCAG CAGCAGCAGCAGCAGCAACAACAGCAGCAGCAGCAGCAGATGGCACGGAGCAGCCAGGAGGAGAAGGAGGAGAAG

GAGAAGGAGAAGGAGGCCGACAAGGAGGAAGAGAAGCAGGATGCGGAGAACGAGAAGGAAGAACTCAGCAA - UNI12291 - GGAGAAGACAGACGA

CACTTCTGGCGAGGACAACGATGAGAAAGAGGCCGTGGCCTCCAAAGGCCGCAAAACTGCCAACAGCCAAGGCCGCCGCAAAGGCCGTATCACGCGCTCC

ATGGCCAACGAGGCCAACCATGAGGAGACAGCCACCCCACAGCAAAGTTCAGAGCTGG CTTCCATGGAGATGAACGAGAGTTCTCGCTGGACTGAGGAA

GAGATGGAGACAGCAAAGAAAG - UNI6109 - GCCTCCTGGAACATGGGAGGAACTGGTCAGCCATTGCCCGTATGGTGGGCTCCAAGACCGTGTCC

CAGTGTAAGAACTTCTACTTCAACTACAAGAAGAGGCAGAACCTGGACGAAATCCTTCAGCAGCACAAGCTAAAGATG GAGAAGGAGAGGAACGCTCGG

AGGAAGAAGAAGAAGACCCCAGCTGCGGCGAGCGAGGAGACAGCCTTCCCACCTGCCGCTGAGGACGAAGAGATGGAAGCATCAGGCGCAAGTGCCAATG

AGGAAGAGCTGGCGGAGGAGGCAGAAG - UNI6062 - CCTCACAGGCCTCTGGGAATGAGGTTCCCAGAGTTGGGGAGTGCAGTGGCCCAG CTGCT

GTCAACAACAGCTCTGATACTGAGAGTGTCCCATCCCCGCGTTCAGAAGCCACGAAGGACACTGGGCCTAAACCCACTGGCACTGAAGCATTGCCCGCTG

CCACCCAGCCACCTGTTCCTCCTCCAGAAGAACCGGCAGTAGCCCCTGCTGAGCCCTCCCCAGTCCCTGATGCCAGTGGCCCACCATCCCCAGAGCCTTC

CCCATCACCTGCCGCACCCCCGGCTACTGTGGACAAGGATGAACAAGAAGCCCCGGCTGCTCCAGCTCCCCAGACAGAGGATGCCAAGGAGCAGAAGTCT

GAGGCCGAGGAGATCGATGTGGGAAAGCCAGAGGAGCCCGAGGCCTCTGAGGAGCCCCCGGAGAGTGTAAAGAGTGACCACAAGGAGGAGACCGAGGAAG

AGCCTGAAGACAAAGCCAAGGGCACAGAGGCCATTGAAACTGTGTCTGAGGCACCACTTAAGGTGGAGGAGGCTGGTAGCAAGGCAGCTGTGACCAAGGG

TTCCAGCTCAGGTGCCACCCAGGACAGTGACTCCAGTGCCACCTGCAGTGCCGATGAGGTGGACGAACCCGAAGGAGGTGACAAGGGCAG GCTGCTGTC

ACCAAGGCCCAGCCTCCTCACCCCGGCTGGAGATCCCCGGGCCAGTACCTCGCCCCAGAAGCCGCTGGACCTGAAGCAGCTGAAGCAGCGAGCAGCCGCC

ATCCCCCCTATC GTCACCAAGGTCCATGAGCCCCCCCGGGAGGACACAGTACCCCCAAAGCCAGTTCCCCCTGTGCCTCCACCCACGCAGCACCTACAG

CCAGAGGGTGACGTGTCTCAGCAGTCGGGAGGAAGTCCACGTGGCAAGTCCCGCAGCCCAGTGCCTCCTGCCGAGAAAGAGG CAGAGAAACCCGCATTC

TTTCCGGCTTTCCCAACTGAGGGCCCAAAGCTACCGACTGAGCCCCCACGCTGGTCATCGGGCCTGCCCTTCCCCATCCCTCCACGGGAGGTGATCAAGA

CTTCCCCACACGCCGCTGACCCCTCTGCCTTCTCCTACACACCCCCCG GTCACCCGCTGCCTCTGGGCCTCCACGATAGTGCCCGGCCCGTCCTGCCAC

GTCCCCCCATCTCTAACCCCCCACCCCTCATCTCCTCTGCCAAGCATCCCGGCGTACTTGAGAGGCAGCTGGGTGCCATCTCCCAG CAGGGGATGTCAG

TCCAGCTTCGTGTGCCTCACTCAGAGCATGCCAAGGCCCCCATGGGCCCTCTCACCATGGGGCTGCCCCTTGCCGTGGACCCTAAGAAGCTGG GGACAG

CACTGGGTTCCGCCACCAGTGGAAGCATCACCAAGGGCCTCCCCAGTACCCGGGCTGCAGACGGCCCCAGCTACAGAGGCTCTATCACCCAC - UNI15

93 - GGCACGCCCGCAGACGTCCTCTACAAGGGTACCATCAGCAGGATCGTCGGTGAGGACAGCCCAAGTCGCCTTGACCGGGCACGAGAGGACACCCT

GCCCAAGGGCCATGTCATCTATGAGGGCAAGAAAGGCCACGTCCTATCCTATGAAG GTGGTATGTCCGTGTCACAGTGCTCTAAGGAGGATGGAAGGAG

CAGCTCGGGCCCACCCCATGAGACTGCCGCCCCTAAACGCACCTATGACATGATGGAGGGCCGTGTAGGCAGGACTGTCACCTCAGCCAGCATAGAGG G

ACTCATGGGCCGCGCCATCCCTGAGCAGCACAGCCCCCACCTCAAGGAGCAGCATCACATCCGAGGCTCCATCACGCAAG GCATCCCGAGGTCCTATGT

GGAGGCGCAGGAGGACTACTTACGGCGGGAGGCCAAGCTCTTGAAGCGAGAAGGGACACCACCACCCCCACCACCACCTCGGGACCTGACTGAGACCTAC

AAGCCCCGGCCCCTGGACCCTCTGGGTCCCCTGAAGCTGAAGCCGACTCACGAGGGTGTGGTAGCAACTGTGAAGGAGGCGGGCCGCTCTATCCATGAGA

TCCCGAGAGAGGAGCTGCGCCGCACACCTGAGCTACCCCTGGCACCACGGCCTCTGAAGGAGGGTTCCATCACCCAG GGCACCCCACTCAAGTACGACT

CTGGGGCACCCTCCACTGGCACCAAGAAACACGACGTGCGCTCCATCATCGGCAGCCCCGGCCGGCCTTTCCCTGCCCTGCACCCGCTGGACATAATGGC

TGACGCCCGGGCACTGGAGCGTGCCTGCTATGAAGAGAGTCTGAAGAGCCGGTCAGGGACCAGCAGTGGTGCAGGGGGCTCCATCACACGTGGGGCTCCA

GTCGTCGTGCCTGAACTGGGCAAGCCACGGCAAAGCCCACTGACTTACGAAGACCACGGGGCACCCTTCACCAGTCACCTGCCACGTGGCTCCCCTGTGA

CCACGAGGGAGCCCACGCCACGCCTTCAGGAAG GCAGCCTCCTATCCAGCAAGGCGTCCCAGGACCGGAAGCTGACATCTACACCCCGGGAGATCGCCA

AGTCCCCACACAGCACTGTGCCCGAGCACCACCCTCACCCCATCTCCCCCTATGAGCACTTGCTCCGGGGCGTGACTGGTGTGGACCTGTACCGTGGTCA

CATCCCATTGGCCTTTGACCCCACCTCCATACCCCGAGGGATCCCTCTGGAAGCAG CAGCCGCAGCCTACTACCTGCCCCGGCACTTGGCCCCCAGCCC

CACCTACCCACACCTGTACCCACCTTACCTCATCCGCGGCTACCCTGACACGGCGGCCCTGGAGAACCGCCAGACCATCATCAATGACTACATCACCTCG

CAGCAGATGCACCACAACGCTGCCTCCGCCATGGCCCAGCGTGCTGACATGCTGAGGGGTCTGTCACCGCGAGAGTCCTCGCTGGCCCTCAATTATGCCG

CTGGCCCAAGAG GCATTATCGACCTGTCCCAAGTGCCACACCTGCCCGTGCTGGTGCCACCAACGCCAGGCACCCCTGCCACCGCCATCGACCGCCTTG

CCTACCTCCCCACTGCGCCCCCACCCTTCAGCAGCCGCCACAGTAGCTCACCGCTGTCCCCAG GAGGCCCCACTCACCTAGCTAAACCAACTGCCACAT

CTTCATCGGAGCGGGAACGGGAACGTGAGCGGGAACGAGACAAGTCCATCCTCACGTCTACCACTACAGTGGAGCATGCACCCATCTGGAGACCTG - U

NI67 - GTACGGAGCAGAGCAGCGGGGCTGGGGGCAGCAGCCGCCCCGCCTCCCACACCCACCAGCACTCGCCCATCTCCCCCCGGACCCAGGACGCCT

TGCAGCAGAGGCCCAGTGTGCTGCACAACACGAGCATGAAGGGCGTGGTCACCTCCGTGGAACCCGGCACGCCCACGGTCCTGAGGTGGGCCAG GTCCA

CCTCCACCTCTTCGCCTGTCCGCCCAGCTGCCACATTCCCACCTGCCACCCACTGCCCACTTGGTGGCACCCTTGAAGGGGTCTACCCTACCCTCATGGA

GCCCGTCCTGTTACCCAAGGAGACCTCTCGGGTCGCCCGGCCCGAGCGGCCCCGTGTGGACGCTGGCCATGCCTTCCTCACCAAACCCCCGGCCCGGGAG

CCCGCCTCCTCACCCAGCAAGAGCTCCGAGCCCCGATCCCTAGCACCCCCCAGCTCCAGCCACACAGCCATCGCCCGCACCCCAGCAAAGAACCTTGCAC

CCCACCATGCCAGTCCGGACCCGCCGGCGCCCACCTCGGCCTCAGATCTGCACCGAGAAAAGACTCAAAGTAAACCCTTTTCCATCCAGGAATTGGAACT

CCGTTCTCTGG GTTACCACAGTGGAGCTGGCTACAGCCCCGATGGGGTGGAGCCCATCAGCCCGGTGAGCTCCCCCAGCCTGACCCACGACAAGGGGCT

CTCCAAACCTCTGGAAGAGCTAGAGAAGAGCCACTTGGAAGGGGAGCTGCGGCACAAGCAGCCAG GCCCCATGAAGCTCAGCGCGGAGGCTGCCCATCT

CCCACATCTGCGGCCACTGCCCGAGAGCCAGCCCTCATCTAGCCCACTCCTCCAGACTGCCCCAGGCATCAAAGGTCACCAGAGGGTGGTCACCTTGGCT

CAGCACATCAGT GAGGTCATTACGCAGGACTACACGCGCCACCACCCGCAGCAGCTCAGTGGCCCCCTTCCCGCCCCTCTCTACTCCTTTCCCGGAGCC

AGCTGCCCTGTCCTGGATCTTCGCCGCCCACCCAGTGACCTCTACCTCCCACCCCCCGACCATGGCACCCCAGCCCGGGGATCCCCCCACAGTGAAGGGG

GCAAAAG GTCCCCAGAACCCAGCAAAACATCGGTCCTGGGCAGCAGCGAGGATGCCATTGAGCCTGTGTCCCCACCAGAGGGCATGACTGAGCCAGGAC

ATGCTCGGAGCACTGCGTACCCACTGCTGTATCGAGACGGGGAACAGGGCGAGCCCAG GATGGGCTCTAAGTCTCCAGGCAACACCAGCCAGCCGCCAG

CCTTCTTCAGTAAGCTGACTGAGAGCAACTCCGCCATGGTGAAGTCGAAGAAGCAGGAGATCAACAAGAAACTCAACACCCACAACCGGAACGAGCCAGA

ATACA ATATTGGCCAGCCTGGGACGGAAATCTTCAACATGCCCGCCATCACTGGAGCAG - UNI668 - GCCTTATGACCTGTAGAAGCCAGGCGGT

GCAAGAACACGCCAGCACCAACATGGGGCTAGAGGCCATTATTAGAAAGGCACTCATGGGTAAATATGATCAGTGGGAAGAGCCCCCGCCGCTCGGCGCC

AATGCTTTTAACCCTCTGAATGCCAGCGCCAGTCTGCCCGCTGCTGCTATGCCCATAACCACTGCTGACGGACGGAGTGACCACGCACTCACCTCGCCAG

 GTGGAGGTGGGAAAGCCAAGGTCTCTGGCAGACCTAGCAGCCGAAAAGCCAAGTCGCCAGCACCAGGCCTAGCGTCCGGAGACCGACCCCCTTCTGTCT

CCTCAGTACACTCAGAGGGGGACTGCAATCGCCGAACACCACTCACCAACCGTGTGTGGGAGGACCGGCCCTCATCTGCAG GGTCCACGCCATTCCCCT

ACAACCCTTTGATTATGAGGCTACAGGCAGGTGTCATGGCCTCCCCGCCCCCACCTGGCCTTGCGGCAGGCAGCGGGCCCCTAGCTGGTCCCCACCACGC

CTGGGATGAGGAGCCCAAGCCACTGCTGTGTTCACAGTATGAGACACTCTCGGACAGCGAGTGACCACGGATTGGGGGGGAGCGGTGCCAGGTCCCCGCA

CAAGGCAGAAGCAGCCCAGCATGGAGCAGACAGCTGCTGACTCCCGAGACTGAGGAAGGAGCCCCTGAGTCTGCCTGCGCGTCCATCCGTCCGTCCGTCC

ACTCATCTGTCCATCCAGAGCTGGCATCCTGCCTGTCTAAAGCCTTAACTAAGACTCCCACCCCGGGCTGGCCCTGCGCAGTGACCTTACACTCAGGGGA

TGTTTACCTGGTGCTCGAGAGGGGAGTGGACAGGAGGGGAGGGACAGCGGGCCAGGAGGGGGGGGGACAGCAATCGTGTGTCAGTCGCACTCGTGCATCT

GGGGCAGCGGGGACCCACCACAGGCTGACCAGGCACCTCCATGCCACCGCCTCGCCCCTTACCGCATTTGGAACCAAAGTCTAAGCTGAACTCTCGCGTG

GTCCTGCCCCTCCCTCTGCCCCCAGCCCGCTTGCGCTCTGGACAGACAGACGTTCCCAGCTTATCCTGCCCTAATGCTGTCATCATCGCAGTCTCCAAAG

GCCACCCAGCCCACAAGACTGGGAGCCCATCAGACCAGGTGGGTGCACAAGGGGCCAGGCCTGGCCTGGGGCACGGATGCTTGCAGGAACTGGACCGTTT

CCCGGCCTGTTGCTGTGGCAACGGGAGGGAAGGCACGTGTAAATGGTGTTGGCTTACAGGGTATATTTTTGATACCTTCAATGAGTTAATTCAGACGTCT

CACACAAGGAAGGACTCGCCCGTGTTTCTGCCGCTGTGCTTTGGTCTCTACCTACTGTTTCAGAGGCACGTGCCAGCCAAGGCGGTGGCCCCACCATACG

CAGGACTTGGGGGTCAGGGGCTCCGGCACACGGCACTGTGCCCTTCCCCCCCACCCCCTTCCTTGGGCAAAATGGACTTGATGCGTATTCTGTGGCCGCT

CTCTGTGCACGGCGGCATTCTGTCATTTACACATGTTGTTCCAATTAGAAAGCAAATATACTCAAGTGACAACGTTTC
Translation
 - UNI18902 - - UNI30560 -  - UNI17689 - - UNI30560 - MSGSTQPVAQTWRAAEPRYPPHGISYPVQIARSHT - UNI17689

 - - UNI25772 - - UNI25795 - - UNI30560 - DVGLLEYQHHPRDYTSHLSPGSIIQPQRRRPSLLSEFQPGSER - UNI2098 - - 

UNI25772 - RSQELHLRPESRTFLPELGKPDIEFTESKRPRLELLPDTLLRPSPLLATGQPSGSEDLTK - UNI2098 - DRSLAGKLEPVSPPSP

PHADPELELAPSRLSKEELIQNMDRVDREITMVEQQISKLKKKQ QQLEEEAAKPPEPEKPVSPPPIESKHRSLVQIIYDENR KKAEAAHRILEGLGPQ

VEL PLYNQPSDTRQYHENIKI INQAMRKKLILYFKRRNHARKQW - UNI7790 - EQRFCQRYDQLMEAWEKKVERIENNPRRRAKESKVREYYEK

QFPEIRKQRELQERMQS SRVGQRGSGLSMSAARSEHEVSEIIDGLSEQE NLEKQMRQLAVIPPMLYDADQQRIKFINMNGLMDDPMKVYKDRQVTNMW

SEQERDTFREK KFMQHPKNFGLIASFLERK TVAECVLYYYLTKKNENYKSLVRRSYRRRGKSQ QQQQQQQQQQQQQMARSSQEEKEEKEKEKEADKE

EEKQDAENEKEELSK - UNI12291 - KEKTDDTSGEDNDEKEAVASKGRKTANSQGRRKGRITRSMANEANHEETATPQQSSELA ASMEMNESSRW

TEEEMETAKKG - UNI6109 - GLLEHGRNWSAIARMVGSKTVSQCKNFYFNYKKRQNLDEILQQHKLKM EKERNARRKKKKTPAAASEETAFPPAA

EDEEMEASGASANEEELAEEAEA - UNI6062 - ASQASGNEVPRVGECSGPA AAVNNSSDTESVPSPRSEATKDTGPKPTGTEALPAATQPPVPPP

EEPAVAPAEPSPVPDASGPPSPEPSPSPAAPPATVDKDEQEAPAAPAPQTEDAKEQKSEAEEIDVGKPEEPEASEEPPESVKSDHKEETEEEPEDKAKGT

EAIETVSEAPLKVEEAGSKAAVTKGSSSGATQDSDSSATCSADEVDEPEGGDKGR RLLSPRPSLLTPAGDPRASTSPQKPLDLKQLKQRAAAIPPI VT

KVHEPPREDTVPPKPVPPVPPPTQHLQPEGDVSQQSGGSPRGKSRSPVPPAEKEA AEKPAFFPAFPTEGPKLPTEPPRWSSGLPFPIPPREVIKTSPHA

ADPSAFSYTPPG GHPLPLGLHDSARPVLPRPPISNPPPLISSAKHPGVLERQLGAISQ QGMSVQLRVPHSEHAKAPMGPLTMGLPLAVDPKKLG GTA

LGSATSGSITKGLPSTRAADGPSYRGSITH - UNI1593 - GTPADVLYKGTISRIVGEDSPSRLDRAREDTLPKGHVIYEGKKGHVLSYEG GGMSV

SQCSKEDGRSSSGPPHETAAPKRTYDMMEGRVGRTVTSASIEG GLMGRAIPEQHSPHLKEQHHIRGSITQG GIPRSYVEAQEDYLRREAKLLKREGTP

PPPPPPRDLTETYKPRPLDPLGPLKLKPTHEGVVATVKEAGRSIHEIPREELRRTPELPLAPRPLKEGSITQ GTPLKYDSGAPSTGTKKHDVRSIIGSP

GRPFPALHPLDIMADARALERACYEESLKSRSGTSSGAGGSITRGAPVVVPELGKPRQSPLTYEDHGAPFTSHLPRGSPVTTREPTPRLQEG GSLLSSK

ASQDRKLTSTPREIAKSPHSTVPEHHPHPISPYEHLLRGVTGVDLYRGHIPLAFDPTSIPRGIPLEAA AAAAYYLPRHLAPSPTYPHLYPPYLIRGYPD

TAALENRQTIINDYITSQQMHHNAASAMAQRADMLRGLSPRESSLALNYAAGPRG GIIDLSQVPHLPVLVPPTPGTPATAIDRLAYLPTAPPPFSSRHS

SSPLSPG GGPTHLAKPTATSSSERERERERERDKSILTSTTTVEHAPIWRPG - UNI67 - GTEQSSGAGGSSRPASHTHQHSPISPRTQDALQQRP

SVLHNTSMKGVVTSVEPGTPTVLRWAR RSTSTSSPVRPAATFPPATHCPLGGTLEGVYPTLMEPVLLPKETSRVARPERPRVDAGHAFLTKPPAREPAS

SPSKSSEPRSLAPPSSSHTAIARTPAKNLAPHHASPDPPAPTSASDLHREKTQSKPFSIQELELRSLG GYHSGAGYSPDGVEPISPVSSPSLTHDKGLS

KPLEELEKSHLEGELRHKQPG GPMKLSAEAAHLPHLRPLPESQPSSSPLLQTAPGIKGHQRVVTLAQHIS EVITQDYTRHHPQQLSGPLPAPLYSFPG

ASCPVLDLRRPPSDLYLPPPDHGTPARGSPHSEGGKR RSPEPSKTSVLGSSEDAIEPVSPPEGMTEPGHARSTAYPLLYRDGEQGEPR RMGSKSPGNT

SQPPAFFSKLTESNSAMVKSKKQEINKKLNTHNRNEPEYN NIGQPGTEIFNMPAITGAG - UNI668 - GLMTCRSQAVQEHASTNMGLEAIIRKAL

MGKYDQWEEPPPLGANAFNPLNASASLPAAAMPITTADGRSDHALTSPG GGGGKAKVSGRPSSRKAKSPAPGLASGDRPPSVSSVHSEGDCNRRTPLTN

RVWEDRPSSAG GSTPFPYNPLIMRLQAGVMASPPPPGLAAGSGPLAGPHHAWDEEPKPLLCSQYETLSDSE
Transcript ENSMUST00000086083
Sequence
CTCGAGCCCGATCGGCGCCGTAGCCCGGCGCCAGCGCCCGGTGCCGCCGCCGGCGAG - UNI17689 - - UNI18902 - - UNI30560 - GCA

CCTGTGACGAGGTCACCTGCCAGCAGATGACCGAGACCAGCCCTTAGTCCTAGGTGTGGTCAAGAGTGTCTTGGGCTCCAAAGCCTACCTGGACCCTACC

ACCATGTCAGGATCCACACAGCCTGTGGCACAGACATGGCGGGCTGCTGAGCCCCGCTACCCACCCCATGGCATCTCCTACCCGGTGCAGATAGCCCGGT

CCCACACG - UNI17689 - - UNI25772 - - UNI25795 - - UNI30560 - GACGTGGGGCTGCTTGAGTACCAACACCACCCCCGTGAC

TACACCTCACACCTGTCACCCGGTTCCATCATCCAGCCACAGAGGAGGCGGCCCTCACTGCTGTCAGAGTTCCAGCCTGGGAGTGAACG - UNI2098 

- - UNI25772 - GTCTCAGGAGCTCCACCTGCGCCCTGAGTCCCGCACGTTCCTGCCTGAGCTGGGCAAGCCCGACATAGAATTCACCGAGAGCAAG

CGCCCCCGCCTGGAGCTACTACCCGATACCCTGCTGCGCCCATCACCCCTGCTGGCCACTGGGCAGCCGAGTGGGTCTGAAGACCTTACCAAG - UNI2

098 - GACCGTAGCCTGGCAGGCAAGCTGGAGCCTGTGTCACCTCCCAGTCCCCCGCACGCTGACCCTGAGCTAGAGCTGGCGCCATCTCGACTGTCCA

AGGAGGAGCTGATCCAGAACATGGACCGCGTGGACCGTGAGATCACCATGGTAGAGCAGCAGATCTCCAAGCTGAAGAAGAAGCAG CAACAGTTGGAGG

AGGAGGCCGCCAAGCCGCCCGAACCCGAGAAGCCTGTGTCGCCACCACCCATAGAATCAAAGCACCGAAGCCTGGTCCAGATCATCTACGATGAGAACCG

G AAGAAAGCCGAAGCCGCACACCGGATCCTAGAAGGCCTGGGGCCCCAGGTGGAGCTG CCTCTGTACAACCAGCCGTCTGACACACGCCAGTACCATG

AAAACATCAAAAT AAACCAGGCGATGCGGAAGAAGCTGATCTTGTACTTTAAGCGGAGGAACCACGCGCGCAAGCAGTGG - UNI7790 - GAACAG

CGCTTCTGCCAGCGCTATGACCAGCTCATGGAGGCGTGGGAGAAGAAGGTAGAGCGCATAGAGAACAATCCGCGAAGGAGGGCCAAGGAGAGCAAGGTGA

GGGAGTACTACGAGAAACAGTTCCCGGAGATCCGCAAGCAGCGGGAGCTGCAGGAGCGCATGCAGAG CAGGGTGGGCCAGCGTGGCAGTGGGCTCTCCA

TGTCGGCTGCCCGCAGTGAGCATGAGGTTTCTGAGATCATTGATGGCTTGTCTGAGCAGGAG AATCTGGAGAAGCAGATGCGCCAGCTGGCCGTGATCC

CGCCCATGTTGTACGACGCGGACCAGCAGAGGATCAAGTTCATCAACATGAATGGACTCATGGATGACCCCATGAAGGTCTACAAGGACCGTCAGGTTAC

CAACATGTGGAGCGAGCAGGAGAGGGACACCTTCCGTGAGAA GTTTATGCAGCACCCTAAGAACTTTGGCCTGATTGCCTCATTCCTGGAGAGAAAG A

CGGTCGCTGAGTGTGTCCTCTATTACTACCTGACCAAGAAGAATGAAAATTACAAGAGCTTGGTGAGGCGGAGCTATCGGCGCCGTGGCAAGAGCCAG C

AGCAGCAGCAGCAGCAACAACAGCAGCAGCAGCAGCAGATGGCACGGAGCAGCCAGGAGGAGAAGGAGGAGAAGGAGAAGGAGAAGGAGGCCGACAAGGA

GGAAGAGAAGCAGGATGCGGAGAACGAGAAGGAAGAACTCAGCAA - UNI12291 - GGAGAAGACAGACGACACTTCTGGCGAGGACAACGATGAGA

AAGAGGCCGTGGCCTCCAAAGGCCGCAAAACTGCCAACAGCCAAGGCCGCCGCAAAGGCCGTATCACGCGCTCCATGGCCAACGAGGCCAACCATGAGGA

GACAGCCACCCCACAGCAAAGTTCAGAGCTGG CTTCCATGGAGATGAACGAGAGTTCTCGCTGGACTGAGGAAGAGATGGAGACAGCAAAGAAAG - U

NI6109 - GCCTCCTGGAACATGGGAGGAACTGGTCAGCCATTGCCCGTATGGTGGGCTCCAAGACCGTGTCCCAGTGTAAGAACTTCTACTTCAACTA

CAAGAAGAGGCAGAACCTGGACGAAATCCTTCAGCAGCACAAGCTAAAGATG GAGAAGGAGAGGAACGCTCGGAGGAAGAAGAAGAAGACCCCAGCTGC

GGCGAGCGAGGAGACAGCCTTCCCACCTGCCGCTGAGGACGAAGAGATGGAAGCATCAGGCGCAAGTGCCAATGAGGAAGAGCTGGCGGAGGAGGCAGAA

G - UNI6062 - CCTCACAGGCCTCTGGGAATGAGGTTCCCAGAGTTGGGGAGTGCAGTGGCCCAG CTGCTGTCAACAACAGCTCTGATACTGAGAG

TGTCCCATCCCCGCGTTCAGAAGCCACGAAGGACACTGGGCCTAAACCCACTGGCACTGAAGCATTGCCCGCTGCCACCCAGCCACCTGTTCCTCCTCCA

GAAGAACCGGCAGTAGCCCCTGCTGAGCCCTCCCCAGTCCCTGATGCCAGTGGCCCACCATCCCCAGAGCCTTCCCCATCACCTGCCGCACCCCCGGCTA

CTGTGGACAAGGATGAACAAGAAGCCCCGGCTGCTCCAGCTCCCCAGACAGAGGATGCCAAGGAGCAGAAGTCTGAGGCCGAGGAGATCGATGTGGGAAA

GCCAGAGGAGCCCGAGGCCTCTGAGGAGCCCCCGGAGAGTGTAAAGAGTGACCACAAGGAGGAGACCGAGGAAGAGCCTGAAGACAAAGCCAAGGGCACA

GAGGCCATTGAAACTGTGTCTGAGGCACCACTTAAGGTGGAGGAGGCTGGTAGCAAGGCAGCTGTGACCAAGGGTTCCAGCTCAGGTGCCACCCAGGACA

GTGACTCCAGTGCCACCTGCAGTGCCGATGAGGTGGACGAACCCGAAGGAGGTGACAAGGGCAG GCTGCTGTCACCAAGGCCCAGCCTCCTCACCCCGG

CTGGAGATCCCCGGGCCAGTACCTCGCCCCAGAAGCCGCTGGACCTGAAGCAGCTGAAGCAGCGAGCAGCCGCCATCCCCCCTATC GTCACCAAGGTCC

ATGAGCCCCCCCGGGAGGACACAGTACCCCCAAAGCCAGTTCCCCCTGTGCCTCCACCCACGCAGCACCTACAGCCAGAGGGTGACGTGTCTCAGCAGTC

GGGAGGAAGTCCACGTGGCAAGTCCCGCAGCCCAGTGCCTCCTGCCGAGAAAGAGG CAGAGAAACCCGCATTCTTTCCGGCTTTCCCAACTGAGGGCCC

AAAGCTACCGACTGAGCCCCCACGCTGGTCATCGGGCCTGCCCTTCCCCATCCCTCCACGGGAGGTGATCAAGACTTCCCCACACGCCGCTGACCCCTCT

GCCTTCTCCTACACACCCCCCG GTCACCCGCTGCCTCTGGGCCTCCACGATAGTGCCCGGCCCGTCCTGCCACGTCCCCCCATCTCTAACCCCCCACCC

CTCATCTCCTCTGCCAAGCATCCCGGCGTACTTGAGAGGCAGCTGGGTGCCATCTCCCAG GGGATGTCAGTCCAGCTTCGTGTGCCTCACTCAGAGCAT

GCCAAGGCCCCCATGGGCCCTCTCACCATGGGGCTGCCCCTTGCCGTGGACCCTAAGAAGCTGG GGACAGCACTGGGTTCCGCCACCAGTGGAAGCATC

ACCAAGGGCCTCCCCAGTACCCGGGCTGCAGACGGCCCCAGCTACAGAGGCTCTATCACCCAC - UNI1593 - GGCACGCCCGCAGACGTCCTCTAC

AAGGGTACCATCAGCAGGATCGTCGGTGAGGACAGCCCAAGTCGCCTTGACCGGGCACGAGAGGACACCCTGCCCAAGGGCCATGTCATCTATGAGGGCA

AGAAAGGCCACGTCCTATCCTATGAAG GTGGTATGTCCGTGTCACAGTGCTCTAAGGAGGATGGAAGGAGCAGCTCGGGCCCACCCCATGAGACTGCCG

CCCCTAAACGCACCTATGACATGATGGAGGGCCGTGTAGGCAGGACTGTCACCTCAGCCAGCATAGAGG GACTCATGGGCCGCGCCATCCCTGAGCAGC

ACAGCCCCCACCTCAAGGAGCAGCATCACATCCGAGGCTCCATCACGCAAG GCATCCCGAGGTCCTATGTGGAGGCGCAGGAGGACTACTTACGGCGGG

AGGCCAAGCTCTTGAAGCGAGAAGGGACACCACCACCCCCACCACCACCTCGGGACCTGACTGAGACCTACAAGCCCCGGCCCCTGGACCCTCTGGGTCC

CCTGAAGCTGAAGCCGACTCACGAGGGTGTGGTAGCAACTGTGAAGGAGGCGGGCCGCTCTATCCATGAGATCCCGAGAGAGGAGCTGCGCCGCACACCT

GAGCTACCCCTGGCACCACGGCCTCTGAAGGAGGGTTCCATCACCCAG GGCACCCCACTCAAGTACGACTCTGGGGCACCCTCCACTGGCACCAAGAAA

CACGACGTGCGCTCCATCATCGGCAGCCCCGGCCGGCCTTTCCCTGCCCTGCACCCGCTGGACATAATGGCTGACGCCCGGGCACTGGAGCGTGCCTGCT

ATGAAGAGAGTCTGAAGAGCCGGTCAGGGACCAGCAGTGGTGCAGGGGGCTCCATCACACGTGGGGCTCCAGTCGTCGTGCCTGAACTGGGCAAGCCACG

GCAAAGCCCACTGACTTACGAAGACCACGGGGCACCCTTCACCAGTCACCTGCCACGTGGCTCCCCTGTGACCACGAGGGAGCCCACGCCACGCCTTCAG

GAAG GCAGCCTCCTATCCAGCAAGGCGTCCCAGGACCGGAAGCTGACATCTACACCCCGGGAGATCGCCAAGTCCCCACACAGCACTGTGCCCGAGCAC

CACCCTCACCCCATCTCCCCCTATGAGCACTTGCTCCGGGGCGTGACTGGTGTGGACCTGTACCGTGGTCACATCCCATTGGCCTTTGACCCCACCTCCA

TACCCCGAGGGATCCCTCTGGAAGCAG CAGCCGCAGCCTACTACCTGCCCCGGCACTTGGCCCCCAGCCCCACCTACCCACACCTGTACCCACCTTACC

TCATCCGCGGCTACCCTGACACGGCGGCCCTGGAGAACCGCCAGACCATCATCAATGACTACATCACCTCGCAGCAGATGCACCACAACGCTGCCTCCGC

CATGGCCCAGCGTGCTGACATGCTGAGGGGTCTGTCACCGCGAGAGTCCTCGCTGGCCCTCAATTATGCCGCTGGCCCAAGAG GCATTATCGACCTGTC

CCAAGTGCCACACCTGCCCGTGCTGGTGCCACCAACGCCAGGCACCCCTGCCACCGCCATCGACCGCCTTGCCTACCTCCCCACTGCGCCCCCACCCTTC

AGCAGCCGCCACAGTAGCTCACCGCTGTCCCCAG GAGGCCCCACTCACCTAGCTAAACCAACTGCCACATCTTCATCGGAGCGGGAACGGGAACGTGAG

CGGGAACGAGACAAGTCCATCCTCACGTCTACCACTACAGTGGAGCATGCACCCATCTGGAGACCTG - UNI67 - GTACGGAGCAGAGCAGCGGGGC

TGGGGGCAGCAGCCGCCCCGCCTCCCACACCCACCAGCACTCGCCCATCTCCCCCCGGACCCAGGACGCCTTGCAGCAGAGGCCCAGTGTGCTGCACAAC

ACGAGCATGAAGGGCGTGGTCACCTCCGTGGAACCCGGCACGCCCACGGTCCTGAG GTCCACCTCCACCTCTTCGCCTGTCCGCCCAGCTGCCACATTC

CCACCTGCCACCCACTGCCCACTTGGTGGCACCCTTGAAGGGGTCTACCCTACCCTCATGGAGCCCGTCCTGTTACCCAAGGAGACCTCTCGGGTCGCCC

GGCCCGAGCGGCCCCGTGTGGACGCTGGCCATGCCTTCCTCACCAAACCCCCGGCCCGGGAGCCCGCCTCCTCACCCAGCAAGAGCTCCGAGCCCCGATC

CCTAGCACCCCCCAGCTCCAGCCACACAGCCATCGCCCGCACCCCAGCAAAGAACCTTGCACCCCACCATGCCAGTCCGGACCCGCCGGCGCCCACCTCG

GCCTCAGATCTGCACCGAGAAAAGACTCAAAGTAAACCCTTTTCCATCCAGGAATTGGAACTCCGTTCTCTGG GTTACCACAGTGGAGCTGGCTACAGC

CCCGATGGGGTGGAGCCCATCAGCCCGGTGAGCTCCCCCAGCCTGACCCACGACAAGGGGCTCTCCAAACCTCTGGAAGAGCTAGAGAAGAGCCACTTGG

AAGGGGAGCTGCGGCACAAGCAGCCAG GCCCCATGAAGCTCAGCGCGGAGGCTGCCCATCTCCCACATCTGCGGCCACTGCCCGAGAGCCAGCCCTCAT

CTAGCCCACTCCTCCAGACTGCCCCAGGCATCAAAGGTCACCAGAGGGTGGTCACCTTGGCTCAGCACATCAGT GAGGTCATTACGCAGGACTACACGC

GCCACCACCCGCAGCAGCTCAGTGGCCCCCTTCCCGCCCCTCTCTACTCCTTTCCCGGAGCCAGCTGCCCTGTCCTGGATCTTCGCCGCCCACCCAGTGA

CCTCTACCTCCCACCCCCCGACCATGGCACCCCAGCCCGGGGATCCCCCCACAGTGAAGGGGGCAAAAG GTCCCCAGAACCCAGCAAAACATCGGTCCT

GGGCAGCAGCGAGGATGCCATTGAGCCTGTGTCCCCACCAGAGGGCATGACTGAGCCAGGACATGCTCGGAGCACTGCGTACCCACTGCTGTATCGAGAC

GGGGAACAGGGCGAGCCCAG GATGGGCTCTAAGTCTCCAGGCAACACCAGCCAGCCGCCAGCCTTCTTCAGTAAGCTGACTGAGAGCAACTCCGCCATG

GTGAAGTCGAAGAAGCAGGAGATCAACAAGAAACTCAACACCCACAACCGGAACGAGCCAGAATACA ATATTGGCCAGCCTGGGACGGAAATCTTCAAC

ATGCCCGCCATCACTGGAGCAG - UNI668 - GCCTTATGACCTGTAGAAGCCAGGCGGTGCAAGAACACGCCAGCACCAACATGGGGCTAGAGGCCA

TTATTAGAAAGGCACTCATGGGTAAATATGATCAGTGGGAAGAGCCCCCGCCGCTCGGCGCCAATGCTTTTAACCCTCTGAATGCCAGCGCCAGTCTGCC

CGCTGCTGCTATGCCCATAACCACTGCTGACGGACGGAGTGACCACGCACTCACCTCGCCAG GTGGAGGTGGGAAAGCCAAGGTCTCTGGCAGACCTAG

CAGCCGAAAAGCCAAGTCGCCAGCACCAGGCCTAGCGTCCGGAGACCGACCCCCTTCTGTCTCCTCAGTACACTCAGAGGGGGACTGCAATCGCCGAACA

CCACTCACCAACCGTGTGTGGGAGGACCGGCCCTCATCTGCAG GGTCCACGCCATTCCCCTACAACCCTTTGATTATGAGGCTACAGGCAGGTGTCATG

GCCTCCCCGCCCCCACCTGGCCTTGCGGCAGGCAGCGGGCCCCTAGCTGGTCCCCACCACGCCTGGGATGAGGAGCCCAAGCCACTGCTGTGTTCACAGT

ATGAGACACTCTCGGACAGCGAGTGACCACGGATTGGGGGGGAGCGGTGCCAGGTCCCCGCACAAGGCAGAAGCAGCCCAGCATGGAGCAGACAGCTGCT

GACTCCCGAGACTGAGGAAGGAGCCCCTGAGTCTGCCTGCGCGTCCATCCGTCCGTCCGTCCACTCATCTGTCCATCCAGAGCTGGCATCCTGCCTGTCT

AAAGCCTTAACTAAGACTCCCACCCCGGGCTGGCCCTGCGCAGTGACCTTACACTCAGGGGATGTTTACCTGGTGCTCGAGAGGGGAGTGGACAGGAGGG

GAGGGACAGCGGGCCAGGAGGGGGGGGGACAGCAATCGTGTGTCAGTCGCACTCGTGCATCTGGGGCAGCGGGGACCCACCACAGGCTGACCAGGCACCT

CCATGCCACCGCCTCGCCCCTTACCGCATTTGGAACCAAAGTCTAAGCTGAACTCTCGCGTGGTCCTGCCCCTCCCTCTGCCCCCAGCCCGCTTGCGCTC

TGGACAGACAGACGTTCCCAGCTTATCCTGCCCTAATGCTGTCATCATCGCAGTCTCCAAAGGCCACCCAGCCCACAAGACTGGGAGCCCATCAGACCAG

GTGGGTGCACAAGGGGCCAGGCCTGGCCTGGGGCACGGATGCTTGCAGGAACTGGACCGTTTCCCGGCCTGTTGCTGTGGCAACGGGAGGGAAGGCACGT

GTAAATGGTGTTGGCTTACAGGGTATATTTTTGATACCTTCAATGAGTTAATTCAGACGTCTCACACAAGGAAGGACTCGCCCGTGTTTCTGCCGCTGTG

CTTTGGTCTCTACCTACTGTTTCAGAGGCACGTGCCAGCCAAGGCGGTGGCCCCACCATACGCAGGACTTGGGGGTCAGGGGCTCCGGCACACGGCACTG

TGCCCTTCCCCCCCACCCCCTTCCTTGGGCAAAATGGACTTGATGCGTATTCTGTGGCCGCTCTCTGTGCACGGCGGCATTCTGTCATTTACACATGTTG

TTCCAATTAGAAAGCAAATATACTCAAGTGA
Translation
 - UNI17689 - - UNI18902 - - UNI30560 - MSGSTQPVAQTWRAAEPRYPPHGISYPVQIARSHT - UNI17689 - - UNI25772 

- - UNI25795 - - UNI30560 - DVGLLEYQHHPRDYTSHLSPGSIIQPQRRRPSLLSEFQPGSER - UNI2098 - - UNI25772 - RSQ

ELHLRPESRTFLPELGKPDIEFTESKRPRLELLPDTLLRPSPLLATGQPSGSEDLTK - UNI2098 - DRSLAGKLEPVSPPSPPHADPELELAPSRL

SKEELIQNMDRVDREITMVEQQISKLKKKQ QQLEEEAAKPPEPEKPVSPPPIESKHRSLVQIIYDENR KKAEAAHRILEGLGPQVEL PLYNQPSDTR

QYHENIKI INQAMRKKLILYFKRRNHARKQW - UNI7790 - EQRFCQRYDQLMEAWEKKVERIENNPRRRAKESKVREYYEKQFPEIRKQRELQER

MQS SRVGQRGSGLSMSAARSEHEVSEIIDGLSEQE NLEKQMRQLAVIPPMLYDADQQRIKFINMNGLMDDPMKVYKDRQVTNMWSEQERDTFREK KF

MQHPKNFGLIASFLERK TVAECVLYYYLTKKNENYKSLVRRSYRRRGKSQ QQQQQQQQQQQQQMARSSQEEKEEKEKEKEADKEEEKQDAENEKEELS

K - UNI12291 - KEKTDDTSGEDNDEKEAVASKGRKTANSQGRRKGRITRSMANEANHEETATPQQSSELA ASMEMNESSRWTEEEMETAKKG - 

UNI6109 - GLLEHGRNWSAIARMVGSKTVSQCKNFYFNYKKRQNLDEILQQHKLKM EKERNARRKKKKTPAAASEETAFPPAAEDEEMEASGASANE

EELAEEAEA - UNI6062 - ASQASGNEVPRVGECSGPA AAVNNSSDTESVPSPRSEATKDTGPKPTGTEALPAATQPPVPPPEEPAVAPAEPSPVP

DASGPPSPEPSPSPAAPPATVDKDEQEAPAAPAPQTEDAKEQKSEAEEIDVGKPEEPEASEEPPESVKSDHKEETEEEPEDKAKGTEAIETVSEAPLKVE

EAGSKAAVTKGSSSGATQDSDSSATCSADEVDEPEGGDKGR RLLSPRPSLLTPAGDPRASTSPQKPLDLKQLKQRAAAIPPI VTKVHEPPREDTVPPK

PVPPVPPPTQHLQPEGDVSQQSGGSPRGKSRSPVPPAEKEA AEKPAFFPAFPTEGPKLPTEPPRWSSGLPFPIPPREVIKTSPHAADPSAFSYTPPG G

HPLPLGLHDSARPVLPRPPISNPPPLISSAKHPGVLERQLGAISQ GMSVQLRVPHSEHAKAPMGPLTMGLPLAVDPKKLG GTALGSATSGSITKGLPS

TRAADGPSYRGSITH - UNI1593 - GTPADVLYKGTISRIVGEDSPSRLDRAREDTLPKGHVIYEGKKGHVLSYEG GGMSVSQCSKEDGRSSSGPP

HETAAPKRTYDMMEGRVGRTVTSASIEG GLMGRAIPEQHSPHLKEQHHIRGSITQG GIPRSYVEAQEDYLRREAKLLKREGTPPPPPPPRDLTETYKP

RPLDPLGPLKLKPTHEGVVATVKEAGRSIHEIPREELRRTPELPLAPRPLKEGSITQ GTPLKYDSGAPSTGTKKHDVRSIIGSPGRPFPALHPLDIMAD

ARALERACYEESLKSRSGTSSGAGGSITRGAPVVVPELGKPRQSPLTYEDHGAPFTSHLPRGSPVTTREPTPRLQEG GSLLSSKASQDRKLTSTPREIA

KSPHSTVPEHHPHPISPYEHLLRGVTGVDLYRGHIPLAFDPTSIPRGIPLEAA AAAAYYLPRHLAPSPTYPHLYPPYLIRGYPDTAALENRQTIINDYI

TSQQMHHNAASAMAQRADMLRGLSPRESSLALNYAAGPRG GIIDLSQVPHLPVLVPPTPGTPATAIDRLAYLPTAPPPFSSRHSSSPLSPG GGPTHLA

KPTATSSSERERERERERDKSILTSTTTVEHAPIWRPG - UNI67 - GTEQSSGAGGSSRPASHTHQHSPISPRTQDALQQRPSVLHNTSMKGVVTSV

EPGTPTVLR RSTSTSSPVRPAATFPPATHCPLGGTLEGVYPTLMEPVLLPKETSRVARPERPRVDAGHAFLTKPPAREPASSPSKSSEPRSLAPPSSSH

TAIARTPAKNLAPHHASPDPPAPTSASDLHREKTQSKPFSIQELELRSLG GYHSGAGYSPDGVEPISPVSSPSLTHDKGLSKPLEELEKSHLEGELRHK

QPG GPMKLSAEAAHLPHLRPLPESQPSSSPLLQTAPGIKGHQRVVTLAQHIS EVITQDYTRHHPQQLSGPLPAPLYSFPGASCPVLDLRRPPSDLYLP

PPDHGTPARGSPHSEGGKR RSPEPSKTSVLGSSEDAIEPVSPPEGMTEPGHARSTAYPLLYRDGEQGEPR RMGSKSPGNTSQPPAFFSKLTESNSAMV

KSKKQEINKKLNTHNRNEPEYN NIGQPGTEIFNMPAITGAG - UNI668 - GLMTCRSQAVQEHASTNMGLEAIIRKALMGKYDQWEEPPPLGANAF

NPLNASASLPAAAMPITTADGRSDHALTSPG GGGGKAKVSGRPSSRKAKSPAPGLASGDRPPSVSSVHSEGDCNRRTPLTNRVWEDRPSSAG GSTPFP

YNPLIMRLQAGVMASPPPPGLAAGSGPLAGPHHAWDEEPKPLLCSQYETLSDSE
Transcript ENSMUST00000055256
Sequence
CCAAAGCCTACCTGGACCCTACCACCATGTCAGGATCCACACAGCCTGTGGCACAGACATGGCGGGCTGCTGAGCCCCGCTACCCACCCCATGGCATCTC

CTACCCGGTGCAGATAGCCCGGTCCCACACG - UNI17689 - - UNI25772 - - UNI25795 - - UNI30560 - GACGTGGGGCTGCTTG

AGTACCAACACCACCCCCGTGACTACACCTCACACCTGTCACCCGGTTCCATCATCCAGCCACAGAGGAGGCGGCCCTCACTGCTGTCAGAGTTCCAGCC

TGGGAGTGAACG - UNI2098 - - UNI25772 - GTCTCAGGAGCTCCACCTGCGCCCTGAGTCCCGCACGTTCCTGCCTGAGCTGGGCAAGCCCG

ACATAGAATTCACCGAGAGCAAGCGCCCCCGCCTGGAGCTACTACCCGATACCCTGCTGCGCCCATCACCCCTGCTGGCCACTGGGCAGCCGAGTGGGTC

TGAAGACCTTACCAAG - UNI2098 - GACCGTAGCCTGGCAGGCAAGCTGGAGCCTGTGTCACCTCCCAGTCCCCCGCACGCTGACCCTGAGCTAGA

GCTGGCGCCATCTCGACTGTCCAAGGAGGAGCTGATCCAGAACATGGACCGCGTGGACCGTGAGATCACCATGGTAGAGCAGCAGATCTCCAAGCTGAAG

AAGAAGCAG CAACAGTTGGAGGAGGAGGCCGCCAAGCCGCCCGAACCCGAGAAGCCTGTGTCGCCACCACCCATAGAATCAAAGCACCGAAGCCTGGTC

CAGATCATCTACGATGAGAACCGG AAGAAAGCCGAAGCCGCACACCGGATCCTAGAAGGCCTGGGGCCCCAGGTGGAGCTG CCTCTGTACAACCAGCC

GTCTGACACACGCCAGTACCATGAAAACATCAAAAT AAACCAGGCGATGCGGAAGAAGCTGATCTTGTACTTTAAGCGGAGGAACCACGCGCGCAAGCA

GTGG - UNI7790 - GAACAGCGCTTCTGCCAGCGCTATGACCAGCTCATGGAGGCGTGGGAGAAGAAGGTAGAGCGCATAGAGAACAATCCGCGAAG

GAGGGCCAAGGAGAGCAAGGTGAGGGAGTACTACGAGAAACAGTTCCCGGAGATCCGCAAGCAGCGGGAGCTGCAGGAGCGCATGCAGAG CAGGGTGGG

CCAGCGTGGCAGTGGGCTCTCCATGTCGGCTGCCCGCAGTGAGCATGAGGTTTCTGAGATCATTGATGGCTTGTCTGAGCAGGAG AATCTGGAGAAGCA

GATGCGCCAGCTGGCCGTGATCCCGCCCATGTTGTACGACGCGGACCAGCAGAGGATCAAGTTCATCAACATGAATGGACTCATGGATGACCCCATGAAG

GTCTACAAGGACCGTCAGGTTACCAACATGTGGAGCGAGCAGGAGAGGGACACCTTCCGTGAGAA GTTTATGCAGCACCCTAAGAACTTTGGCCTGATT

GCCTCATTCCTGGAGAGAAAG ACGGTCGCTGAGTGTGTCCTCTATTACTACCTGACCAAGAAGAATGAAAATTACAAGAGCTTGGTGAGGCGGAGCTAT

CGGCGCCGTGGCAAGAGCCAG CAGCAGCAGCAGCAGCAACAACAGCAGCAGCAGCAGCAGATGGCACGGAGCAGCCAGGAGGAGAAGGAGGAGAAGGAG

AAGGAGAAGGAGGCCGACAAGGAGGAAGAGAAGCAGGATGCGGAGAACGAGAAGGAAGAACTCAGCAA - UNI12291 - GGAGAAGACAGACGACAC

TTCTGGCGAGGACAACGATGAGAAAGAGGCCGTGGCCTCCAAAGGCCGCAAAACTGCCAACAGCCAAGGCCGCCGCAAAGGCCGTATCACGCGCTCCATG

GCCAACGAGGCCAACCATGAGGAGACAGCCACCCCACAGCAAAGTTCAGAGCTGG CTTCCATGGAGATGAACGAGAGTTCTCGCTGGACTGAGGAAGAG

ATGGAGACAGCAAAGAAAG - UNI6109 - GCCTCCTGGAACATGGGAGGAACTGGTCAGCCATTGCCCGTATGGTGGGCTCCAAGACCGTGTCCCAG

TGTAAGAACTTCTACTTCAACTACAAGAAGAGGCAGAACCTGGACGAAATCCTTCAGCAGCACAAGCTAAAGATG GAGAAGGAGAGGAACGCTCGGAGG

AAGAAGAAGAAGACCCCAGCTGCGGCGAGCGAGGAGACAGCCTTCCCACCTGCCGCTGAGGACGAAGAGATGGAAGCATCAGGCGCAAGTGCCAATGAGG

AAGAGCTGGCGGAGGAGGCAGAAG - UNI6062 - CCTCACAGGCCTCTGGGAATGAGGTTCCCAGAGTTGGGGAGTGCAGTGGCCCAG CTGCTGTC

AACAACAGCTCTGATACTGAGAGTGTCCCATCCCCGCGTTCAGAAGCCACGAAGGACACTGGGCCTAAACCCACTGGCACTGAAGCATTGCCCGCTGCCA

CCCAGCCACCTGTTCCTCCTCCAGAAGAACCGGCAGTAGCCCCTGCTGAGCCCTCCCCAGTCCCTGATGCCAGTGGCCCACCATCCCCAGAGCCTTCCCC

ATCACCTGCCGCACCCCCGGCTACTGTGGACAAGGATGAACAAGAAGCCCCGGCTGCTCCAGCTCCCCAGACAGAGGATGCCAAGGAGCAGAAGTCTGAG

GCCGAGGAGATCGATGTGGGAAAGCCAGAGGAGCCCGAGGCCTCTGAGGAGCCCCCGGAGAGTGTAAAGAGTGACCACAAGGAGGAGACCGAGGAAGAGC

CTGAAGACAAAGCCAAGGGCACAGAGGCCATTGAAACTGTGTCTGAGGCACCACTTAAGGTGGAGGAGGCTGGTAGCAAGGCAGCTGTGACCAAGGGTTC

CAGCTCAGGTGCCACCCAGGACAGTGACTCCAGTGCCACCTGCAGTGCCGATGAGGTGGACGAACCCGAAGGAGGTGACAAGGGCAG GCTGCTGTCACC

AAGGCCCAGCCTCCTCACCCCGGCTGGAGATCCCCGGGCCAGTACCTCGCCCCAGAAGCCGCTGGACCTGAAGCAGCTGAAGCAGCGAGCAGCCGCCATC

CCCCCTATC CAGGTCACCAAGGTCCATGAGCCCCCCCGGGAGGACACAGTACCCCCAAAGCCAGTTCCCCCTGTGCCTCCACCCACGCAGCACCTACAG

CCAGAGGGTGACGTGTCTCAGCAGTCGGGAGGAAGTCCACGTGGCAAGTCCCGCAGCCCAGTGCCTCCTGCCGAGAAAGAGG CAGAGAAACCCGCATTC

TTTCCGGCTTTCCCAACTGAGGGCCCAAAGCTACCGACTGAGCCCCCACGCTGGTCATCGGGCCTGCCCTTCCCCATCCCTCCACGGGAGGTGATCAAGA

CTTCCCCACACGCCGCTGACCCCTCTGCCTTCTCCTACACACCCCCCG GTCACCCGCTGCCTCTGGGCCTCCACGATAGTGCCCGGCCCGTCCTGCCAC

GTCCCCCCATCTCTAACCCCCCACCCCTCATCTCCTCTGCCAAGCATCCCGGCGTACTTGAGAGGCAGCTGGGTGCCATCTCCCAG CAGGGGATGTCAG

TCCAGCTTCGTGTGCCTCACTCAGAGCATGCCAAGGCCCCCATGGGCCCTCTCACCATGGGGCTGCCCCTTGCCGTGGACCCTAAGAAGCTGG GGACAG

CACTGGGTTCCGCCACCAGTGGAAGCATCACCAAGGGCCTCCCCAGTACCCGGGCTGCAGACGGCCCCAGCTACAGAGGCTCTATCACCCAC - UNI15

93 - GGCACGCCCGCAGACGTCCTCTACAAGGGTACCATCAGCAGGATCGTCGGTGAGGACAGCCCAAGTCGCCTTGACCGGGCACGAGAGGACACCCT

GCCCAAGGGCCATGTCATCTATGAGGGCAAGAAAGGCCACGTCCTATCCTATGAAG GTGGTATGTCCGTGTCACAGTGCTCTAAGGAGGATGGAAGGAG

CAGCTCGGGCCCACCCCATGAGACTGCCGCCCCTAAACGCACCTATGACATGATGGAGGGCCGTGTAGGCAGGACTGTCACCTCAGCCAGCATAGAGG G

ACTCATGGGCCGCGCCATCCCTGAGCAGCACAGCCCCCACCTCAAGGAGCAGCATCACATCCGAGGCTCCATCACGCAAG GCATCCCGAGGTCCTATGT

GGAGGCGCAGGAGGACTACTTACGGCGGGAGGCCAAGCTCTTGAAGCGAGAAGGGACACCACCACCCCCACCACCACCTCGGGACCTGACTGAGACCTAC

AAGCCCCGGCCCCTGGACCCTCTGGGTCCCCTGAAGCTGAAGCCGACTCACGAGGGTGTGGTAGCAACTGTGAAGGAGGCGGGCCGCTCTATCCATGAGA

TCCCGAGAGAGGAGCTGCGCCGCACACCTGAGCTACCCCTGGCACCACGGCCTCTGAAGGAGGGTTCCATCACCCAG GGCACCCCACTCAAGTACGACT

CTGGGGCACCCTCCACTGGCACCAAGAAACACGACGTGCGCTCCATCATCGGCAGCCCCGGCCGGCCTTTCCCTGCCCTGCACCCGCTGGACATAATGGC

TGACGCCCGGGCACTGGAGCGTGCCTGCTATGAAGAGAGTCTGAAGAGCCGGTCAGGGACCAGCAGTGGTGCAGGGGGCTCCATCACACGTGGGGCTCCA

GTCGTCGTGCCTGAACTGGGCAAGCCACGGCAAAGCCCACTGACTTACGAAGACCACGGGGCACCCTTCACCAGTCACCTGCCACGTGGCTCCCCTGTGA

CCACGAGGGAGCCCACGCCACGCCTTCAGGAAG GCAGCCTCCTATCCAGCAAGGCGTCCCAGGACCGGAAGCTGACATCTACACCCCGGGAGATCGCCA

AGTCCCCACACAGCACTGTGCCCGAGCACCACCCTCACCCCATCTCCCCCTATGAGCACTTGCTCCGGGGCGTGACTGGTGTGGACCTGTACCGTGGTCA

CATCCCATTGGCCTTTGACCCCACCTCCATACCCCGAGGGATCCCTCTGGAAGCAG CAGCCGCAGCCTACTACCTGCCCCGGCACTTGGCCCCCAGCCC

CACCTACCCACACCTGTACCCACCTTACCTCATCCGCGGCTACCCTGACACGGCGGCCCTGGAGAACCGCCAGACCATCATCAATGACTACATCACCTCG

CAGCAGATGCACCACAACGCTGCCTCCGCCATGGCCCAGCGTGCTGACATGCTGAGGGGTCTGTCACCGCGAGAGTCCTCGCTGGCCCTCAATTATGCCG

CTGGCCCAAGAG GCATTATCGACCTGTCCCAAGTGCCACACCTGCCCGTGCTGGTGCCACCAACGCCAGGCACCCCTGCCACCGCCATCGACCGCCTTG

CCTACCTCCCCACTGCGCCCCCACCCTTCAGCAGCCGCCACAGTAGCTCACCGCTGTCCCCAG GAGGCCCCACTCACCTAGCTAAACCAACTGCCACAT

CTTCATCGGAGCGGGAACGGGAACGTGAGCGGGAACGAGACAAGTCCATCCTCACGTCTACCACTACAGTGGAGCATGCACCCATCTGGAGACCTG - U

NI67 - GTACGGAGCAGAGCAGCGGGGCTGGGGGCAGCAGCCGCCCCGCCTCCCACACCCACCAGCACTCGCCCATCTCCCCCCGGACCCAGGACGCCT

TGCAGCAGAGGCCCAGTGTGCTGCACAACACGAGCATGAAGGGCGTGGTCACCTCCGTGGAACCCGGCACGCCCACGGTCCTGAGGTGGGCCAG GTCCA

CCTCCACCTCTTCGCCTGTCCGCCCAGCTGCCACATTCCCACCTGCCACCCACTGCCCACTTGGTGGCACCCTTGAAGGGGTCTACCCTACCCTCATGGA

GCCCGTCCTGTTACCCAAGGAGACCTCTCGGGTCGCCCGGCCCGAGCGGCCCCGTGTGGACGCTGGCCATGCCTTCCTCACCAAACCCCCGGCCCGGGAG

CCCGCCTCCTCACCCAGCAAGAGCTCCGAGCCCCGATCCCTAGCACCCCCCAGCTCCAGCCACACAGCCATCGCCCGCACCCCAGCAAAGAACCTTGCAC

CCCACCATGCCAGTCCGGACCCGCCGGCGCCCACCTCGGCCTCAGATCTGCACCGAGAAAAGACTCAAAGTAAACCCTTTTCCATCCAGGAATTGGAACT

CCGTTCTCTGG GTTACCACAGTGGAGCTGGCTACAGCCCCGATGGGGTGGAGCCCATCAGCCCGGTGAGCTCCCCCAGCCTGACCCACGACAAGGGGCT

CTCCAAACCTCTGGAAGAGCTAGAGAAGAGCCACTTGGAAGGGGAGCTGCGGCACAAGCAGCCAG GCCCCATGAAGCTCAGCGCGGAGGCTGCCCATCT

CCCACATCTGCGGCCACTGCCCGAGAGCCAGCCCTCATCTAGCCCACTCCTCCAGACTGCCCCAGGCATCAAAGGTCACCAGAGGGTGGTCACCTTGGCT

CAGCACATCAGT GAGGTCATTACGCAGGACTACACGCGCCACCACCCGCAGCAGCTCAGTGGCCCCCTTCCCGCCCCTCTCTACTCCTTTCCCGGAGCC

AGCTGCCCTGTCCTGGATCTTCGCCGCCCACCCAGTGACCTCTACCTCCCACCCCCCGACCATGGCACCCCAGCCCGGGGATCCCCCCACAGTGAAGGGG

GCAAAAG GTCCCCAGAACCCAGCAAAACATCGGTCCTGGGCAGCAGCGAGGATGCCATTGAGCCTGTGTCCCCACCAGAGGGCATGACTGAGCCAGGAC

ATGCTCGGAGCACTGCGTACCCACTGCTGTATCGAGACGGGGAACAGGGCGAGCCCAG GATGGGCTCTAAGTCTCCAGGCAACACCAGCCAGCCGCCAG

CCTTCTTCAGTAAGCTGACTGAGAGCAACTCCGCCATGGTGAAGTCGAAGAAGCAGGAGATCAACAAGAAACTCAACACCCACAACCGGAACGAGCCAGA

ATACA ATATTGGCCAGCCTGGGACGGAAATCTTCAACATGCCCGCCATCACTGGAGCAG - UNI668 - GCCTTATGACCTGTAGAAGCCAGGCGGT

GCAAGAACACGCCAGCACCAACATGGGGCTAGAGGCCATTATTAGAAAGGCACTCATGGGTAAATATGATCAGTGGGAAGAGCCCCCGCCGCTCGGCGCC

AATGCTTTTAACCCTCTGAATGCCAGCGCCAGTCTGCCCGCTGCTGCTATGCCCATAACCACTGCTGACGGACGGAGTGACCACGCACTCACCTCGCCAG

 GTGGAGGTGGGAAAGCCAAGGTCTCTGGCAGACCTAGCAGCCGAAAAGCCAAGTCGCCAGCACCAGGCCTAGCGTCCGGAGACCGACCCCCTTCTGTCT

CCTCAGTACACTCAGAGGGGGACTGCAATCGCCGAACACCACTCACCAACCGTGTGTGGGAGGACCGGCCCTCATCTGCAG GGTCCACGCCATTCCCCT

ACAACCCTTTGATTATGAGGCTACAGGCAGGTGTCATGGCCTCCCCGCCCCCACCTGGCCTTGCGGCAGGCAGCGGGCCCCTAGCTGGTCCCCACCACGC

CTGGGATGAGGAGCCCAAGCCACTGCTGTGTTCACAGTATGAGACACTCTCGGACAGCGAGTGACCACGGATTGGGGGGGAGCGGTGCCAGGTCCCCGCA

CAAGGCAGAAGCAGCCCAGCATGGAGCAGACAGCTGCTGACTCCCGAGACTGAGGAAGGAGCCCCTGAGTCTGCCTGCGCGTCCATCCGTCCGTCCGTCC

ACTCATCTGTCCATCCAGAGCTGGCATCCTGCCTGTCTAAAGCCTTAACTAAGACTCCCACCCCGGGCTGGCCCTGCGCAGTGACCTTACACTCAGGGGA

TGTTTACCTGGTGCTCGAGAGGGGAGTGGACAGGAGGGGAGGGACAGCGGGCCAGGAGGGGGGGGGACAGCAATCGTGTGTCAGTCGCACTCGTGC
Translation
MSGSTQPVAQTWRAAEPRYPPHGISYPVQIARSHT - UNI17689 - - UNI25772 - - UNI25795 - - UNI30560 - DVGLLEYQHHPR

DYTSHLSPGSIIQPQRRRPSLLSEFQPGSER - UNI2098 - - UNI25772 - RSQELHLRPESRTFLPELGKPDIEFTESKRPRLELLPDTLLRP

SPLLATGQPSGSEDLTK - UNI2098 - DRSLAGKLEPVSPPSPPHADPELELAPSRLSKEELIQNMDRVDREITMVEQQISKLKKKQ QQLEEEAAK

PPEPEKPVSPPPIESKHRSLVQIIYDENR KKAEAAHRILEGLGPQVEL PLYNQPSDTRQYHENIKI INQAMRKKLILYFKRRNHARKQW - UNI77

90 - EQRFCQRYDQLMEAWEKKVERIENNPRRRAKESKVREYYEKQFPEIRKQRELQERMQS SRVGQRGSGLSMSAARSEHEVSEIIDGLSEQE NLE

KQMRQLAVIPPMLYDADQQRIKFINMNGLMDDPMKVYKDRQVTNMWSEQERDTFREK KFMQHPKNFGLIASFLERK TVAECVLYYYLTKKNENYKSLV

RRSYRRRGKSQ QQQQQQQQQQQQQMARSSQEEKEEKEKEKEADKEEEKQDAENEKEELSK - UNI12291 - KEKTDDTSGEDNDEKEAVASKGRKT

ANSQGRRKGRITRSMANEANHEETATPQQSSELA ASMEMNESSRWTEEEMETAKKG - UNI6109 - GLLEHGRNWSAIARMVGSKTVSQCKNFYFN

YKKRQNLDEILQQHKLKM EKERNARRKKKKTPAAASEETAFPPAAEDEEMEASGASANEEELAEEAEA - UNI6062 - ASQASGNEVPRVGECSGP

A AAVNNSSDTESVPSPRSEATKDTGPKPTGTEALPAATQPPVPPPEEPAVAPAEPSPVPDASGPPSPEPSPSPAAPPATVDKDEQEAPAAPAPQTEDAK

EQKSEAEEIDVGKPEEPEASEEPPESVKSDHKEETEEEPEDKAKGTEAIETVSEAPLKVEEAGSKAAVTKGSSSGATQDSDSSATCSADEVDEPEGGDKG

R RLLSPRPSLLTPAGDPRASTSPQKPLDLKQLKQRAAAIPPI QVTKVHEPPREDTVPPKPVPPVPPPTQHLQPEGDVSQQSGGSPRGKSRSPVPPAEK

EA AEKPAFFPAFPTEGPKLPTEPPRWSSGLPFPIPPREVIKTSPHAADPSAFSYTPPG GHPLPLGLHDSARPVLPRPPISNPPPLISSAKHPGVLERQ

LGAISQ QGMSVQLRVPHSEHAKAPMGPLTMGLPLAVDPKKLG GTALGSATSGSITKGLPSTRAADGPSYRGSITH - UNI1593 - GTPADVLYKG

TISRIVGEDSPSRLDRAREDTLPKGHVIYEGKKGHVLSYEG GGMSVSQCSKEDGRSSSGPPHETAAPKRTYDMMEGRVGRTVTSASIEG GLMGRAIPE

QHSPHLKEQHHIRGSITQG GIPRSYVEAQEDYLRREAKLLKREGTPPPPPPPRDLTETYKPRPLDPLGPLKLKPTHEGVVATVKEAGRSIHEIPREELR

RTPELPLAPRPLKEGSITQ GTPLKYDSGAPSTGTKKHDVRSIIGSPGRPFPALHPLDIMADARALERACYEESLKSRSGTSSGAGGSITRGAPVVVPEL

GKPRQSPLTYEDHGAPFTSHLPRGSPVTTREPTPRLQEG GSLLSSKASQDRKLTSTPREIAKSPHSTVPEHHPHPISPYEHLLRGVTGVDLYRGHIPLA

FDPTSIPRGIPLEAA AAAAYYLPRHLAPSPTYPHLYPPYLIRGYPDTAALENRQTIINDYITSQQMHHNAASAMAQRADMLRGLSPRESSLALNYAAGP

RG GIIDLSQVPHLPVLVPPTPGTPATAIDRLAYLPTAPPPFSSRHSSSPLSPG GGPTHLAKPTATSSSERERERERERDKSILTSTTTVEHAPIWRPG

 - UNI67 - GTEQSSGAGGSSRPASHTHQHSPISPRTQDALQQRPSVLHNTSMKGVVTSVEPGTPTVLRWAR RSTSTSSPVRPAATFPPATHCPLGG

TLEGVYPTLMEPVLLPKETSRVARPERPRVDAGHAFLTKPPAREPASSPSKSSEPRSLAPPSSSHTAIARTPAKNLAPHHASPDPPAPTSASDLHREKTQ

SKPFSIQELELRSLG GYHSGAGYSPDGVEPISPVSSPSLTHDKGLSKPLEELEKSHLEGELRHKQPG GPMKLSAEAAHLPHLRPLPESQPSSSPLLQT

APGIKGHQRVVTLAQHIS EVITQDYTRHHPQQLSGPLPAPLYSFPGASCPVLDLRRPPSDLYLPPPDHGTPARGSPHSEGGKR RSPEPSKTSVLGSSE

DAIEPVSPPEGMTEPGHARSTAYPLLYRDGEQGEPR RMGSKSPGNTSQPPAFFSKLTESNSAMVKSKKQEINKKLNTHNRNEPEYN NIGQPGTEIFNM

PAITGAG - UNI668 - GLMTCRSQAVQEHASTNMGLEAIIRKALMGKYDQWEEPPPLGANAFNPLNASASLPAAAMPITTADGRSDHALTSPG GGG

GKAKVSGRPSSRKAKSPAPGLASGDRPPSVSSVHSEGDCNRRTPLTNRVWEDRPSSAG GSTPFPYNPLIMRLQAGVMASPPPPGLAAGSGPLAGPHHAW

DEEPKPLLCSQYETLSDSE
Transcript ENSMUST00000111394
Sequence
CGCGGGCAGCGCAGGCCGGGCCGCATCCCCGTCCCCGCGCCAGCCGCCCGCGCCCGCCATGCGCGCCCCGCAGCGGCCCGCGCGTCCGGGCCCCGCGTCG

TAGCGCGGCGGGCGGAGACCGCAGGCTCTCAGCCCGGACCCGCCGCATCCTCGAGCCCGATCGGCGCCGTAGCCCGGCGCCAGCGCCCGGTGCCGCCGCC

GGCGAG - UNI18902 - - UNI30560 - TGCTCCTGAGTCTTTGAGGAACACAGCCTCCTGGTGGAAGTTCGTG - UNI17689 - - UNI30

560 - GCACCTGTGACGAGGTCACCTGCCAGCAGATGACCGAGACCAGCCCTTAGTCCTAGGTGTGGTCAAGAGTGTCTTGGGCTCCAAAGCCTACCTG

GACCCTACCACCATGTCAGGATCCACACAGCCTGTGGCACAGACATGGCGGGCTGCTGAGCCCCGCTACCCACCCCATGGCATCTCCTACCCGGTGCAGA

TAGCCCGGTCCCACACG - UNI2098 - - UNI17689 - - UNI25772 - - UNI25795 - - UNI30560 - CCTCTGTACAACCAGCCG

TCTGACACACGCCAGTACCATGAAAACATCAAAAT AAACCAGGCGATGCGGAAGAAGCTGATCTTGTACTTTAAGCGGAGGAACCACGCGCGCAAGCAG

TGG - UNI7790 - GAACAGCGCTTCTGCCAGCGCTATGACCAGCTCATGGAGGCGTGGGAGAAGAAGGTAGAGCGCATAGAGAACAATCCGCGAAGG

AGGGCCAAGGAGAGCAAGGTGAGGGAGTACTACGAGAAACAGTTCCCGGAGATCCGCAAGCAGCGGGAGCTGCAGGAGCGCATGCAGAG CAGGGTGGGC

CAGCGTGGCAGTGGGCTCTCCATGTCGGCTGCCCGCAGTGAGCATGAGGTTTCTGAGATCATTGATGGCTTGTCTGAGCAGGAG AATCTGGAGAAGCAG

ATGCGCCAGCTGGCCGTGATCCCGCCCATGTTGTACGACGCGGACCAGCAGAGGATCAAGTTCATCAACATGAATGGACTCATGGATGACCCCATGAAGG

TCTACAAGGACCGTCAGGTTACCAACATGTGGAGCGAGCAGGAGAGGGACACCTTCCGTGAGAA GTTTATGCAGCACCCTAAGAACTTTGGCCTGATTG

CCTCATTCCTGGAGAGAAAG ACGGTCGCTGAGTGTGTCCTCTATTACTACCTGACCAAGAAGAATGAAAATTACAAGAGCTTGGTGAGGCGGAGCTATC

GGCGCCGTGGCAAGAGCCAG CAGCAGCAGCAGCAGCAACAACAGCAGCAGCAGCAGCAGATGGCACGGAGCAGCCAGGAGGAGAAGGAGGAGAAGGAGA

AGGAGAAGGAGGCCGACAAGGAGGAAGAGAAGCAGGATGCGGAGAACGAGAAGGAAGAACTCAGCAA - UNI12291 - GGAGAAGACAGACGACACT

TCTGGCGAGGACAACGATGAGAAAGAGGCCGTGGCCTCCAAAGGCCGCAAAACTGCCAACAGCCAAGGCCGCCGCAAAGGCCGTATCACGCGCTCCATGG

CCAACGAGGCCAACCATGAGGAGACAGCCACCCCACAGCAAAGTTCAGAGCTGG CTTCCATGGAGATGAACGAGAGTTCTCGCTGGACTGAGGAAGAGA

TGGAGACAGCAAAGAAAG - UNI6109 - GCCTCCTGGAACATGGGAGGAACTGGTCAGCCATTGCCCGTATGGTGGGCTCCAAGACCGTGTCCCAGT

GTAAGAACTTCTACTTCAACTACAAGAAGAGGCAGAACCTGGACGAAATCCTTCAGCAGCACAAGCTAAAGATG GAGAAGGAGAGGAACGCTCGGAGGA

AGAAGAAGAAGACCCCAGCTGCGGCGAGCGAGGAGACAGCCTTCCCACCTGCCGCTGAGGACGAAGAGATGGAAGCATCAGGCGCAAGTGCCAATGAGGA

AGAGCTGGCGGAGGAGGCAGAAG - UNI6062 - CCTCACAGGCCTCTGGGAATGAGGTTCCCAGAGTTGGGGAGTGCAGTGGCCCAG CTGCTGTCA

ACAACAGCTCTGATACTGAGAGTGTCCCATCCCCGCGTTCAGAAGCCACGAAGGACACTGGGCCTAAACCCACTGGCACTGAAGCATTGCCCGCTGCCAC

CCAGCCACCTGTTCCTCCTCCAGAAGAACCGGCAGTAGCCCCTGCTGAGCCCTCCCCAGTCCCTGATGCCAGTGGCCCACCATCCCCAGAGCCTTCCCCA

TCACCTGCCGCACCCCCGGCTACTGTGGACAAGGATGAACAAGAAGCCCCGGCTGCTCCAGCTCCCCAGACAGAGGATGCCAAGGAGCAGAAGTCTGAGG

CCGAGGAGATCGATGTGGGAAAGCCAGAGGAGCCCGAGGCCTCTGAGGAGCCCCCGGAGAGTGTAAAGAGTGACCACAAGGAGGAGACCGAGGAAGAGCC

TGAAGACAAAGCCAAGGGCACAGAGGCCATTGAAACTGTGTCTGAGGCACCACTTAAGGTGGAGGAGGCTGGTAGCAAGGCAGCTGTGACCAAGGGTTCC

AGCTCAGGTGCCACCCAGGACAGTGACTCCAGTGCCACCTGCAGTGCCGATGAGGTGGACGAACCCGAAGGAGGTGACAAGGGCAG GCTGCTGTCACCA

AGGCCCAGCCTCCTCACCCCGGCTGGAGATCCCCGGGCCAGTACCTCGCCCCAGAAGCCGCTGGACCTGAAGCAGCTGAAGCAGCGAGCAGCCGCCATCC

CCCCTATC GTCACCAAGGTCCATGAGCCCCCCCGGGAGGACACAGTACCCCCAAAGCCAGTTCCCCCTGTGCCTCCACCCACGCAGCACCTACAGCCAG

AGGGTGACGTGTCTCAGCAGTCGGGAGGAAGTCCACGTGGCAAGTCCCGCAGCCCAGTGCCTCCTGCCGAGAAAGAGG CAGAGAAACCCGCATTCTTTC

CGGCTTTCCCAACTGAGGGCCCAAAGCTACCGACTGAGCCCCCACGCTGGTCATCGGGCCTGCCCTTCCCCATCCCTCCACGGGAGGTGATCAAGACTTC

CCCACACGCCGCTGACCCCTCTGCCTTCTCCTACACACCCCCCG GTCACCCGCTGCCTCTGGGCCTCCACGATAGTGCCCGGCCCGTCCTGCCACGTCC

CCCCATCTCTAACCCCCCACCCCTCATCTCCTCTGCCAAGCATCCCGGCGTACTTGAGAGGCAGCTGGGTGCCATCTCCCAG CAGGGGATGTCAGTCCA

GCTTCGTGTGCCTCACTCAGAGCATGCCAAGGCCCCCATGGGCCCTCTCACCATGGGGCTGCCCCTTGCCGTGGACCCTAAGAAGCTGG GGACAGCACT

GGGTTCCGCCACCAGTGGAAGCATCACCAAGGGCCTCCCCAGTACCCGGGCTGCAGACGGCCCCAGCTACAGAGGCTCTATCACCCAC - UNI1593 -

 GGCACGCCCGCAGACGTCCTCTACAAGGGTACCATCAGCAGGATCGTCGGTGAGGACAGCCCAAGTCGCCTTGACCGGGCACGAGAGGACACCCTGCCC

AAGGGCCATGTCATCTATGAGGGCAAGAAAGGCCACGTCCTATCCTATGAAG GTGGTATGTCCGTGTCACAGTGCTCTAAGGAGGATGGAAGGAGCAGC

TCGGGCCCACCCCATGAGACTGCCGCCCCTAAACGCACCTATGACATGATGGAGGGCCGTGTAGGCAGGACTGTCACCTCAGCCAGCATAGAGG GACTC

ATGGGCCGCGCCATCCCTGAGCAGCACAGCCCCCACCTCAAGGAGCAGCATCACATCCGAGGCTCCATCACGCAAG GCATCCCGAGGTCCTATGTGGAG

GCGCAGGAGGACTACTTACGGCGGGAGGCCAAGCTCTTGAAGCGAGAAGGGACACCACCACCCCCACCACCACCTCGGGACCTGACTGAGACCTACAAGC

CCCGGCCCCTGGACCCTCTGGGTCCCCTGAAGCTGAAGCCGACTCACGAGGGTGTGGTAGCAACTGTGAAGGAGGCGGGCCGCTCTATCCATGAGATCCC

GAGAGAGGAGCTGCGCCGCACACCTGAGCTACCCCTGGCACCACGGCCTCTGAAGGAGGGTTCCATCACCCAG GGCACCCCACTCAAGTACGACTCTGG

GGCACCCTCCACTGGCACCAAGAAACACGACGTGCGCTCCATCATCGGCAGCCCCGGCCGGCCTTTCCCTGCCCTGCACCCGCTGGACATAATGGCTGAC

GCCCGGGCACTGGAGCGTGCCTGCTATGAAGAGAGTCTGAAGAGCCGGTCAGGGACCAGCAGTGGTGCAGGGGGCTCCATCACACGTGGGGCTCCAGTCG

TCGTGCCTGAACTGGGCAAGCCACGGCAAAGCCCACTGACTTACGAAGACCACGGGGCACCCTTCACCAGTCACCTGCCACGTGGCTCCCCTGTGACCAC

GAGGGAGCCCACGCCACGCCTTCAGGAAG GCAGCCTCCTATCCAGCAAGGCGTCCCAGGACCGGAAGCTGACATCTACACCCCGGGAGATCGCCAAGTC

CCCACACAGCACTGTGCCCGAGCACCACCCTCACCCCATCTCCCCCTATGAGCACTTGCTCCGGGGCGTGACTGGTGTGGACCTGTACCGTGGTCACATC

CCATTGGCCTTTGACCCCACCTCCATACCCCGAGGGATCCCTCTGGAAGCAG CAGCCGCAGCCTACTACCTGCCCCGGCACTTGGCCCCCAGCCCCACC

TACCCACACCTGTACCCACCTTACCTCATCCGCGGCTACCCTGACACGGCGGCCCTGGAGAACCGCCAGACCATCATCAATGACTACATCACCTCGCAGC

AGATGCACCACAACGCTGCCTCCGCCATGGCCCAGCGTGCTGACATGCTGAGGGGTCTGTCACCGCGAGAGTCCTCGCTGGCCCTCAATTATGCCGCTGG

CCCAAGAG GCATTATCGACCTGTCCCAAGTGCCACACCTGCCCGTGCTGGTGCCACCAACGCCAGGCACCCCTGCCACCGCCATCGACCGCCTTGCCTA

CCTCCCCACTGCGCCCCCACCCTTCAGCAGCCGCCACAGTAGCTCACCGCTGTCCCCAG GAGGCCCCACTCACCTAGCTAAACCAACTGCCACATCTTC

ATCGGAGCGGGAACGGGAACGTGAGCGGGAACGAGACAAGTCCATCCTCACGTCTACCACTACAGTGGAGCATGCACCCATCTGGAGACCTG - UNI67

 - GTACGGAGCAGAGCAGCGGGGCTGGGGGCAGCAGCCGCCCCGCCTCCCACACCCACCAGCACTCGCCCATCTCCCCCCGGACCCAGGACGCCTTGCA

GCAGAGGCCCAGTGTGCTGCACAACACGAGCATGAAGGGCGTGGTCACCTCCGTGGAACCCGGCACGCCCACGGTCCTGAGGTGGGCCAG GTCCACCTC

CACCTCTTCGCCTGTCCGCCCAGCTGCCACATTCCCACCTGCCACCCACTGCCCACTTGGTGGCACCCTTGAAGGGGTCTACCCTACCCTCATGGAGCCC

GTCCTGTTACCCAAGGAGACCTCTCGGGTCGCCCGGCCCGAGCGGCCCCGTGTGGACGCTGGCCATGCCTTCCTCACCAAACCCCCGGCCCGGGAGCCCG

CCTCCTCACCCAGCAAGAGCTCCGAGCCCCGATCCCTAGCACCCCCCAGCTCCAGCCACACAGCCATCGCCCGCACCCCAGCAAAGAACCTTGCACCCCA

CCATGCCAGTCCGGACCCGCCGGCGCCCACCTCGGCCTCAGATCTGCACCGAGAAAAGACTCAAAGTAAACCCTTTTCCATCCAGGAATTGGAACTCCGT

TCTCTGG GTTACCACAGTGGAGCTGGCTACAGCCCCGATGGGGTGGAGCCCATCAGCCCGGTGAGCTCCCCCAGCCTGACCCACGACAAGGGGCTCTCC

AAACCTCTGGAAGAGCTAGAGAAGAGCCACTTGGAAGGGGAGCTGCGGCACAAGCAGCCAG GCCCCATGAAGCTCAGCGCGGAGGCTGCCCATCTCCCA

CATCTGCGGCCACTGCCCGAGAGCCAGCCCTCATCTAGCCCACTCCTCCAGACTGCCCCAGGCATCAAAGGTCACCAGAGGGTGGTCACCTTGGCTCAGC

ACATCAGT GAGGTCATTACGCAGGACTACACGCGCCACCACCCGCAGCAGCTCAGTGGCCCCCTTCCCGCCCCTCTCTACTCCTTTCCCGGAGCCAGCT

GCCCTGTCCTGGATCTTCGCCGCCCACCCAGTGACCTCTACCTCCCACCCCCCGACCATGGCACCCCAGCCCGGGGATCCCCCCACAGTGAAGGGGGCAA

AAG GTCCCCAGAACCCAGCAAAACATCGGTCCTGGGCAGCAGCGAGGATGCCATTGAGCCTGTGTCCCCACCAGAGGGCATGACTGAGCCAGGACATGC

TCGGAGCACTGCGTACCCACTGCTGTATCGAGACGGGGAACAGGGCGAGCCCAG GATGGGCTCTAAGTCTCCAGGCAACACCAGCCAGCCGCCAGCCTT

CTTCAGTAAGCTGACTGAGAGCAACTCCGCCATGGTGAAGTCGAAGAAGCAGGAGATCAACAAGAAACTCAACACCCACAACCGGAACGAGCCAGAATAC

A ATATTGGCCAGCCTGGGACGGAAATCTTCAACATGCCCGCCATCACTGGAGCAG - UNI668 - GCCTTATGACCTGTAGAAGCCAGGCGGTGCAA

GAACACGCCAGCACCAACATGGGGCTAGAGGCCATTATTAGAAAGGCACTCATGGGTAAATATGATCAGTGGGAAGAGCCCCCGCCGCTCGGCGCCAATG

CTTTTAACCCTCTGAATGCCAGCGCCAGTCTGCCCGCTGCTGCTATGCCCATAACCACTGCTGACGGACGGAGTGACCACGCACTCACCTCGCCAG GTG

GAGGTGGGAAAGCCAAGGTCTCTGGCAGACCTAGCAGCCGAAAAGCCAAGTCGCCAGCACCAGGCCTAGCGTCCGGAGACCGACCCCCTTCTGTCTCCTC

AGTACACTCAGAGGGGGACTGCAATCGCCGAACACCACTCACCAACCGTGTGTGGGAGGACCGGCCCTCATCTGCAG GGTCCACGCCATTCCCCTACAA

CCCTTTGATTATGAGGCTACAGGCAGGTGTCATGGCCTCCCCGCCCCCACCTGGCCTTGCGGCAGGCAGCGGGCCCCTAGCTGGTCCCCACCACGCCTGG

GATGAGGAGCCCAAGCCACTGCTGTGTTCACAGTATGAGACACTCTCGGACAGCGAGTGACCACGGATTGGGGGGGAGCGGTGCCAGGTCCCCGCACAAG

GCAGAAGCAGCCCAGCATGGAGCAGACAGCTGCTGACTCCCGAGACTGAGGAAGGAGCCCCTGAGTCTGCCTGCGCGTCCATCCGTCCGTCCGTCCACTC

ATCTGTCCATCCAGAGCTGGCATCCTGCCTGTCTAAAGCCTTAACTAAGACTCCCACCCCGGGCTGGCCCTGCGCAGTGACCTTACACTCAGGGGATGTT

TACCTGGTGCTCGAGAGGGGAGTGGACAGGAGGGGAGGGACAGCGGGCCAGGAGGGGGGGGGACAGCAATCGTGTGTCAGTCGCACTCGTGC
Translation
 - UNI18902 - - UNI30560 -  - UNI17689 - - UNI30560 - MSGSTQPVAQTWRAAEPRYPPHGISYPVQIARSHT - UNI2098 

- - UNI17689 - - UNI25772 - - UNI25795 - - UNI30560 - PLYNQPSDTRQYHENIKI INQAMRKKLILYFKRRNHARKQW - U

NI7790 - EQRFCQRYDQLMEAWEKKVERIENNPRRRAKESKVREYYEKQFPEIRKQRELQERMQS SRVGQRGSGLSMSAARSEHEVSEIIDGLSEQE

 NLEKQMRQLAVIPPMLYDADQQRIKFINMNGLMDDPMKVYKDRQVTNMWSEQERDTFREK KFMQHPKNFGLIASFLERK TVAECVLYYYLTKKNENY

KSLVRRSYRRRGKSQ QQQQQQQQQQQQQMARSSQEEKEEKEKEKEADKEEEKQDAENEKEELSK - UNI12291 - KEKTDDTSGEDNDEKEAVASK

GRKTANSQGRRKGRITRSMANEANHEETATPQQSSELA ASMEMNESSRWTEEEMETAKKG - UNI6109 - GLLEHGRNWSAIARMVGSKTVSQCKN

FYFNYKKRQNLDEILQQHKLKM EKERNARRKKKKTPAAASEETAFPPAAEDEEMEASGASANEEELAEEAEA - UNI6062 - ASQASGNEVPRVGE

CSGPA AAVNNSSDTESVPSPRSEATKDTGPKPTGTEALPAATQPPVPPPEEPAVAPAEPSPVPDASGPPSPEPSPSPAAPPATVDKDEQEAPAAPAPQT

EDAKEQKSEAEEIDVGKPEEPEASEEPPESVKSDHKEETEEEPEDKAKGTEAIETVSEAPLKVEEAGSKAAVTKGSSSGATQDSDSSATCSADEVDEPEG

GDKGR RLLSPRPSLLTPAGDPRASTSPQKPLDLKQLKQRAAAIPPI VTKVHEPPREDTVPPKPVPPVPPPTQHLQPEGDVSQQSGGSPRGKSRSPVPP

AEKEA AEKPAFFPAFPTEGPKLPTEPPRWSSGLPFPIPPREVIKTSPHAADPSAFSYTPPG GHPLPLGLHDSARPVLPRPPISNPPPLISSAKHPGVL

ERQLGAISQ QGMSVQLRVPHSEHAKAPMGPLTMGLPLAVDPKKLG GTALGSATSGSITKGLPSTRAADGPSYRGSITH - UNI1593 - GTPADVL

YKGTISRIVGEDSPSRLDRAREDTLPKGHVIYEGKKGHVLSYEG GGMSVSQCSKEDGRSSSGPPHETAAPKRTYDMMEGRVGRTVTSASIEG GLMGRA

IPEQHSPHLKEQHHIRGSITQG GIPRSYVEAQEDYLRREAKLLKREGTPPPPPPPRDLTETYKPRPLDPLGPLKLKPTHEGVVATVKEAGRSIHEIPRE

ELRRTPELPLAPRPLKEGSITQ GTPLKYDSGAPSTGTKKHDVRSIIGSPGRPFPALHPLDIMADARALERACYEESLKSRSGTSSGAGGSITRGAPVVV

PELGKPRQSPLTYEDHGAPFTSHLPRGSPVTTREPTPRLQEG GSLLSSKASQDRKLTSTPREIAKSPHSTVPEHHPHPISPYEHLLRGVTGVDLYRGHI

PLAFDPTSIPRGIPLEAA AAAAYYLPRHLAPSPTYPHLYPPYLIRGYPDTAALENRQTIINDYITSQQMHHNAASAMAQRADMLRGLSPRESSLALNYA

AGPRG GIIDLSQVPHLPVLVPPTPGTPATAIDRLAYLPTAPPPFSSRHSSSPLSPG GGPTHLAKPTATSSSERERERERERDKSILTSTTTVEHAPIW

RPG - UNI67 - GTEQSSGAGGSSRPASHTHQHSPISPRTQDALQQRPSVLHNTSMKGVVTSVEPGTPTVLRWAR RSTSTSSPVRPAATFPPATHCP

LGGTLEGVYPTLMEPVLLPKETSRVARPERPRVDAGHAFLTKPPAREPASSPSKSSEPRSLAPPSSSHTAIARTPAKNLAPHHASPDPPAPTSASDLHRE

KTQSKPFSIQELELRSLG GYHSGAGYSPDGVEPISPVSSPSLTHDKGLSKPLEELEKSHLEGELRHKQPG GPMKLSAEAAHLPHLRPLPESQPSSSPL

LQTAPGIKGHQRVVTLAQHIS EVITQDYTRHHPQQLSGPLPAPLYSFPGASCPVLDLRRPPSDLYLPPPDHGTPARGSPHSEGGKR RSPEPSKTSVLG

SSEDAIEPVSPPEGMTEPGHARSTAYPLLYRDGEQGEPR RMGSKSPGNTSQPPAFFSKLTESNSAMVKSKKQEINKKLNTHNRNEPEYN NIGQPGTEI

FNMPAITGAG - UNI668 - GLMTCRSQAVQEHASTNMGLEAIIRKALMGKYDQWEEPPPLGANAFNPLNASASLPAAAMPITTADGRSDHALTSPG 

GGGGKAKVSGRPSSRKAKSPAPGLASGDRPPSVSSVHSEGDCNRRTPLTNRVWEDRPSSAG GSTPFPYNPLIMRLQAGVMASPPPPGLAAGSGPLAGPH

HAWDEEPKPLLCSQYETLSDSE
Transcript ENSMUST00000111393
Sequence
GCATCCCCGTCCCCGCGCCAGCCGCCCGCGCCCGCCATGCGCGCCCCGCAGCGGCCCGCGCGTCCGGGCCCCGCGTCGTAGCGCGGCGGGCGGAGACCGC

AGGCTCTCAGCCCGGACCCGCCGCATCCTCGAGCCCGATCGGCGCCGTAGCCCGGCGCCAGCGCCCGGTGCCGCCGCCGGCGAG - UNI18902 - - 

UNI30560 - TGCTCCTGAGTCTTTGAGGAACACAGCCTCCTGGTGGAAGTTCGTG - UNI17689 - - UNI25772 - - UNI25795 - - U

NI30560 - GACGTGGGGCTGCTTGAGTACCAACACCACCCCCGTGACTACACCTCACACCTGTCACCCGGTTCCATCATCCAGCCACAGAGGAGGCGG

CCCTCACTGCTGTCAGAGTTCCAGCCTGGGAGTGAACG - UNI2098 - - UNI25772 - GTCTCAGGAGCTCCACCTGCGCCCTGAGTCCCGCAC

GTTCCTGCCTGAGCTGGGCAAGCCCGACATAGAATTCACCGAGAGCAAGCGCCCCCGCCTGGAGCTACTACCCGATACCCTGCTGCGCCCATCACCCCTG

CTGGCCACTGGGCAGCCGAGTGGGTCTGAAGACCTTACCAAG - UNI2098 - GACCGTAGCCTGGCAGGCAAGCTGGAGCCTGTGTCACCTCCCAGT

CCCCCGCACGCTGACCCTGAGCTAGAGCTGGCGCCATCTCGACTGTCCAAGGAGGAGCTGATCCAGAACATGGACCGCGTGGACCGTGAGATCACCATGG

TAGAGCAGCAGATCTCCAAGCTGAAGAAGAAGCAG CAACAGTTGGAGGAGGAGGCCGCCAAGCCGCCCGAACCCGAGAAGCCTGTGTCGCCACCACCCA

TAGAATCAAAGCACCGAAGCCTGGTCCAGATCATCTACGATGAGAACCGG AAGAAAGCCGAAGCCGCACACCGGATCCTAGAAGGCCTGGGGCCCCAGG

TGGAGCTG CCTCTGTACAACCAGCCGTCTGACACACGCCAGTACCATGAAAACATCAAAAT AAACCAGGCGATGCGGAAGAAGCTGATCTTGTACTTT

AAGCGGAGGAACCACGCGCGCAAGCAGTGG - UNI7790 - GAACAGCGCTTCTGCCAGCGCTATGACCAGCTCATGGAGGCGTGGGAGAAGAAGGTA

GAGCGCATAGAGAACAATCCGCGAAGGAGGGCCAAGGAGAGCAAGGTGAGGGAGTACTACGAGAAACAGTTCCCGGAGATCCGCAAGCAGCGGGAGCTGC

AGGAGCGCATGCAGAG CAGGGTGGGCCAGCGTGGCAGTGGGCTCTCCATGTCGGCTGCCCGCAGTGAGCATGAGGTTTCTGAGATCATTGATGGCTTGT

CTGAGCAGGAG AATCTGGAGAAGCAGATGCGCCAGCTGGCCGTGATCCCGCCCATGTTGTACGACGCGGACCAGCAGAGGATCAAGTTCATCAACATGA

ATGGACTCATGGATGACCCCATGAAGGTCTACAAGGACCGTCAGGTTACCAACATGTGGAGCGAGCAGGAGAGGGACACCTTCCGTGAGAA GTTTATGC

AGCACCCTAAGAACTTTGGCCTGATTGCCTCATTCCTGGAGAGAAAG ACGGTCGCTGAGTGTGTCCTCTATTACTACCTGACCAAGAAGAATGAAAATT

ACAAGAGCTTGGTGAGGCGGAGCTATCGGCGCCGTGGCAAGAGCCAG CAGCAGCAGCAGCAGCAACAACAGCAGCAGCAGCAGCAGATGGCACGGAGCA

GCCAGGAGGAGAAGGAGGAGAAGGAGAAGGAGAAGGAGGCCGACAAGGAGGAAGAGAAGCAGGATGCGGAGAACGAGAAGGAAGAACTCAGCAA - UNI

12291 - GGAGAAGACAGACGACACTTCTGGCGAGGACAACGATGAGAAAGAGGCCGTGGCCTCCAAAGGCCGCAAAACTGCCAACAGCCAAGGCCGCC

GCAAAGGCCGTATCACGCGCTCCATGGCCAACGAGGCCAACCATGAGGAGACAGCCACCCCACAGCAAAGTTCAGAGCTGG CTTCCATGGAGATGAACG

AGAGTTCTCGCTGGACTGAGGAAGAGATGGAGACAGCAAAGAAAG - UNI6109 - GCCTCCTGGAACATGGGAGGAACTGGTCAGCCATTGCCCGTA

TGGTGGGCTCCAAGACCGTGTCCCAGTGTAAGAACTTCTACTTCAACTACAAGAAGAGGCAGAACCTGGACGAAATCCTTCAGCAGCACAAGCTAAAGAT

G GAGAAGGAGAGGAACGCTCGGAGGAAGAAGAAGAAGACCCCAGCTGCGGCGAGCGAGGAGACAGCCTTCCCACCTGCCGCTGAGGACGAAGAGATGGA

AGCATCAGGCGCAAGTGCCAATGAGGAAGAGCTGGCGGAGGAGGCAGAAG - UNI6062 - CCTCACAGGCCTCTGGGAATGAGGTTCCCAGAGTTGG

GGAGTGCAGTGGCCCAG CTGCTGTCAACAACAGCTCTGATACTGAGAGTGTCCCATCCCCGCGTTCAGAAGCCACGAAGGACACTGGGCCTAAACCCAC

TGGCACTGAAGCATTGCCCGCTGCCACCCAGCCACCTGTTCCTCCTCCAGAAGAACCGGCAGTAGCCCCTGCTGAGCCCTCCCCAGTCCCTGATGCCAGT

GGCCCACCATCCCCAGAGCCTTCCCCATCACCTGCCGCACCCCCGGCTACTGTGGACAAGGATGAACAAGAAGCCCCGGCTGCTCCAGCTCCCCAGACAG

AGGATGCCAAGGAGCAGAAGTCTGAGGCCGAGGAGATCGATGTGGGAAAGCCAGAGGAGCCCGAGGCCTCTGAGGAGCCCCCGGAGAGTGTAAAGAGTGA

CCACAAGGAGGAGACCGAGGAAGAGCCTGAAGACAAAGCCAAGGGCACAGAGGCCATTGAAACTGTGTCTGAGGCACCACTTAAGGTGGAGGAGGCTGGT

AGCAAGGCAGCTGTGACCAAGGGTTCCAGCTCAGGTGCCACCCAGGACAGTGACTCCAGTGCCACCTGCAGTGCCGATGAGGTGGACGAACCCGAAGGAG

GTGACAAGGGCAG GCTGCTGTCACCAAGGCCCAGCCTCCTCACCCCGGCTGGAGATCCCCGGGCCAGTACCTCGCCCCAGAAGCCGCTGGACCTGAAGC

AGCTGAAGCAGCGAGCAGCCGCCATCCCCCCTATC GTCACCAAGGTCCATGAGCCCCCCCGGGAGGACACAGTACCCCCAAAGCCAGTTCCCCCTGTGC

CTCCACCCACGCAGCACCTACAGCCAGAGGGTGACGTGTCTCAGCAGTCGGGAGGAAGTCCACGTGGCAAGTCCCGCAGCCCAGTGCCTCCTGCCGAGAA

AGAGG CAGAGAAACCCGCATTCTTTCCGGCTTTCCCAACTGAGGGCCCAAAGCTACCGACTGAGCCCCCACGCTGGTCATCGGGCCTGCCCTTCCCCAT

CCCTCCACGGGAGGTGATCAAGACTTCCCCACACGCCGCTGACCCCTCTGCCTTCTCCTACACACCCCCCG GTCACCCGCTGCCTCTGGGCCTCCACGA

TAGTGCCCGGCCCGTCCTGCCACGTCCCCCCATCTCTAACCCCCCACCCCTCATCTCCTCTGCCAAGCATCCCGGCGTACTTGAGAGGCAGCTGGGTGCC

ATCTCCCAG CAGGGGATGTCAGTCCAGCTTCGTGTGCCTCACTCAGAGCATGCCAAGGCCCCCATGGGCCCTCTCACCATGGGGCTGCCCCTTGCCGTG

GACCCTAAGAAGCTGG CCCCCTTCAGTGGAGTGAAGCAGGAACAGTTGTCCCCTCGGGGTCAGGCTGGGCCACCTGAAAGTCTGGGAGTGCCCACTGCT

CAGGAGACCTCTGTGCTGAGAG GGACAGCACTGGGTTCCGCCACCAGTGGAAGCATCACCAAGGGCCTCCCCAGTACCCGGGCTGCAGACGGCCCCAGC

TACAGAGGCTCTATCACCCAC - UNI1593 - GGCACGCCCGCAGACGTCCTCTACAAGGGTACCATCAGCAGGATCGTCGGTGAGGACAGCCCAAGT

CGCCTTGACCGGGCACGAGAGGACACCCTGCCCAAGGGCCATGTCATCTATGAGGGCAAGAAAGGCCACGTCCTATCCTATGAAG GTGGTATGTCCGTG

TCACAGTGCTCTAAGGAGGATGGAAGGAGCAGCTCGGGCCCACCCCATGAGACTGCCGCCCCTAAACGCACCTATGACATGATGGAGGGCCGTGTAGGCA

GGACTGTCACCTCAGCCAGCATAGAGG GACTCATGGGCCGCGCCATCCCTGAGCAGCACAGCCCCCACCTCAAGGAGCAGCATCACATCCGAGGCTCCA

TCACGCAAG GCATCCCGAGGTCCTATGTGGAGGCGCAGGAGGACTACTTACGGCGGGAGGCCAAGCTCTTGAAGCGAGAAGGGACACCACCACCCCCAC

CACCACCTCGGGACCTGACTGAGACCTACAAGCCCCGGCCCCTGGACCCTCTGGGTCCCCTGAAGCTGAAGCCGACTCACGAGGGTGTGGTAGCAACTGT

GAAGGAGGCGGGCCGCTCTATCCATGAGATCCCGAGAGAGGAGCTGCGCCGCACACCTGAGCTACCCCTGGCACCACGGCCTCTGAAGGAGGGTTCCATC

ACCCAG GGCACCCCACTCAAGTACGACTCTGGGGCACCCTCCACTGGCACCAAGAAACACGACGTGCGCTCCATCATCGGCAGCCCCGGCCGGCCTTTC

CCTGCCCTGCACCCGCTGGACATAATGGCTGACGCCCGGGCACTGGAGCGTGCCTGCTATGAAGAGAGTCTGAAGAGCCGGTCAGGGACCAGCAGTGGTG

CAGGGGGCTCCATCACACGTGGGGCTCCAGTCGTCGTGCCTGAACTGGGCAAGCCACGGCAAAGCCCACTGACTTACGAAGACCACGGGGCACCCTTCAC

CAGTCACCTGCCACGTGGCTCCCCTGTGACCACGAGGGAGCCCACGCCACGCCTTCAGGAAG GCAGCCTCCTATCCAGCAAGGCGTCCCAGGACCGGAA

GCTGACATCTACACCCCGGGAGATCGCCAAGTCCCCACACAGCACTGTGCCCGAGCACCACCCTCACCCCATCTCCCCCTATGAGCACTTGCTCCGGGGC

GTGACTGGTGTGGACCTGTACCGTGGTCACATCCCATTGGCCTTTGACCCCACCTCCATACCCCGAGGGATCCCTCTGGAAGCAG CAGCCGCAGCCTAC

TACCTGCCCCGGCACTTGGCCCCCAGCCCCACCTACCCACACCTGTACCCACCTTACCTCATCCGCGGCTACCCTGACACGGCGGCCCTGGAGAACCGCC

AGACCATCATCAATGACTACATCACCTCGCAGCAGATGCACCACAACGCTGCCTCCGCCATGGCCCAGCGTGCTGACATGCTGAGGGGTCTGTCACCGCG

AGAGTCCTCGCTGGCCCTCAATTATGCCGCTGGCCCAAGAG GCATTATCGACCTGTCCCAAGTGCCACACCTGCCCGTGCTGGTGCCACCAACGCCAGG

CACCCCTGCCACCGCCATCGACCGCCTTGCCTACCTCCCCACTGCGCCCCCACCCTTCAGCAGCCGCCACAGTAGCTCACCGCTGTCCCCAG GAGGCCC

CACTCACCTAGCTAAACCAACTGCCACATCTTCATCGGAGCGGGAACGGGAACGTGAGCGGGAACGAGACAAGTCCATCCTCACGTCTACCACTACAGTG

GAGCATGCACCCATCTGGAGACCTG - UNI67 - GTACGGAGCAGAGCAGCGGGGCTGGGGGCAGCAGCCGCCCCGCCTCCCACACCCACCAGCACTC

GCCCATCTCCCCCCGGACCCAGGACGCCTTGCAGCAGAGGCCCAGTGTGCTGCACAACACGAGCATGAAGGGCGTGGTCACCTCCGTGGAACCCGGCACG

CCCACGGTCCTGAGGTGGGCCAG GTCCACCTCCACCTCTTCGCCTGTCCGCCCAGCTGCCACATTCCCACCTGCCACCCACTGCCCACTTGGTGGCACC

CTTGAAGGGGTCTACCCTACCCTCATGGAGCCCGTCCTGTTACCCAAGGAGACCTCTCGGGTCGCCCGGCCCGAGCGGCCCCGTGTGGACGCTGGCCATG

CCTTCCTCACCAAACCCCCGGCCCGGGAGCCCGCCTCCTCACCCAGCAAGAGCTCCGAGCCCCGATCCCTAGCACCCCCCAGCTCCAGCCACACAGCCAT

CGCCCGCACCCCAGCAAAGAACCTTGCACCCCACCATGCCAGTCCGGACCCGCCGGCGCCCACCTCGGCCTCAGATCTGCACCGAGAAAAGACTCAAAGT

AAACCCTTTTCCATCCAGGAATTGGAACTCCGTTCTCTGG GTTACCACAGTGGAGCTGGCTACAGCCCCGATGGGGTGGAGCCCATCAGCCCGGTGAGC

TCCCCCAGCCTGACCCACGACAAGGGGCTCTCCAAACCTCTGGAAGAGCTAGAGAAGAGCCACTTGGAAGGGGAGCTGCGGCACAAGCAGCCAG GCCCC

ATGAAGCTCAGCGCGGAGGCTGCCCATCTCCCACATCTGCGGCCACTGCCCGAGAGCCAGCCCTCATCTAGCCCACTCCTCCAGACTGCCCCAGGCATCA

AAGGTCACCAGAGGGTGGTCACCTTGGCTCAGCACATCAGT GAGGTCATTACGCAGGACTACACGCGCCACCACCCGCAGCAGCTCAGTGGCCCCCTTC

CCGCCCCTCTCTACTCCTTTCCCGGAGCCAGCTGCCCTGTCCTGGATCTTCGCCGCCCACCCAGTGACCTCTACCTCCCACCCCCCGACCATGGCACCCC

AGCCCGGGGATCCCCCCACAGTGAAGGGGGCAAAAG GTCCCCAGAACCCAGCAAAACATCGGTCCTGGGCAGCAGCGAGGATGCCATTGAGCCTGTGTC

CCCACCAGAGGGCATGACTGAGCCAGGACATGCTCGGAGCACTGCGTACCCACTGCTGTATCGAGACGGGGAACAGGGCGAGCCCAG GATGGGCTCTAA

GTCTCCAGGCAACACCAGCCAGCCGCCAGCCTTCTTCAGTAAGCTGACTGAGAGCAACTCCGCCATGGTGAAGTCGAAGAAGCAGGAGATCAACAAGAAA

CTCAACACCCACAACCGGAACGAGCCAGAATACA ATATTGGCCAGCCTGGGACGGAAATCTTCAACATGCCCGCCATCACTGGAGCAG - UNI668 -

 GCCTTATGACCTGTAGAAGCCAGGCGGTGCAAGAACACGCCAGCACCAACATGGGGCTAGAGGCCATTATTAGAAAGGCACTCATGGGTAAATATGATC

AGTGGGAAGAGCCCCCGCCGCTCGGCGCCAATGCTTTTAACCCTCTGAATGCCAGCGCCAGTCTGCCCGCTGCTGCTATGCCCATAACCACTGCTGACGG

ACGGAGTGACCACGCACTCACCTCGCCAG GTGGAGGTGGGAAAGCCAAGGTCTCTGGCAGACCTAGCAGCCGAAAAGCCAAGTCGCCAGCACCAGGCCT

AGCGTCCGGAGACCGACCCCCTTCTGTCTCCTCAGTACACTCAGAGGGGGACTGCAATCGCCGAACACCACTCACCAACCGTGTGTGGGAGGACCGGCCC

TCATCTGCAG GGTCCACGCCATTCCCCTACAACCCTTTGATTATGAGGCTACAGGCAGGTGTCATGGCCTCCCCGCCCCCACCTGGCCTTGCGGCAGGC

AGCGGGCCCCTAGCTGGTCCCCACCACGCCTGGGATGAGGAGCCCAAGCCACTGCTGTGTTCACAGTATGAGACACTCTCGGACAGCGAGTGACCACGGA

TTGGGGGGGAGCGGTGCCAGGTCCCCGCACAAGGCAGAAGCAGCCCAGCATGGAGCAGACAGCTGCTGACTCCCGAGACTGAGGAAGGAGCCCCTGAGTC

TGCCTGCGCGTCCATCCGTCCGTCCGTCCACTCATCTGTCCATCCAGAGCTGGCATCCTGCCTGTCTAAAGCCTTAACTAAGACTCCCACCCCGGGCTGG

CCCTGCGCAGTGACCTTACACTCAGGGGATGTTTACCTGGTGCTCGAGAGGGGAGTGGACAGGAGGGGAGGGACAGCGGGCCAGGAGGGGGGGGGACAGC

AATCGTGTGTCAGTCGCACTCGTGCATCTGGGGCAGCGGGGACCCACCACAGGCTGACCAGGCACCTCCATGCCACCGCCTCGCCCCTTACCGCATTTGG

AACCAAAGTCTAAGCTGAACTCTCGCGTGGTCCTGCCCCTCCCTCTGCCCCCAGCCCGCTTGCGCTCTGGACAGACAGACGTTCCCAGCTTATCCTGCCC

TAATGCTGTCATCATCGCAGTCTCCAAAGGCCACCCAGCCCACAAGACTGGGAGCCCATCAGACCAGGTGGGTGCACAAGGGGCCAGGCCTGGCCTGGGG

CACGGATGCTTGCAGGAACTGGACCGTTTCCCGGCCTGTTGCTGTGGCAACGGGAGGGAAGGCACGTGTAAATGGTGTTGGCTTACAGGGTATATTTTTG

ATACCTTCAATGAGTTAATTCAGACGTCTCACACAAGGAAGGACTCGCCCGTGTTTCTGCCGCTGTGCTTTGGTCTCTACCTACTGTTTCAGAGGCACGT

GCCAGCCAAGGCGGTGGCCCCACCATACGCAGGACTTGGGGGTCAGGGGCTCCGGCACACGGCACTGTGCCCTTCCCCCCCACCCCCTTCCTTGGGCAAA

ATGGACTTGATGCGTATTCTGTGGCCGCTCTCTGTGCACGGCGGCATTCTGTCATTTACACATGTTGTTCCAATTAGAAAGCAAATATACTCAAGTGACA

ACGTT
Translation
 - UNI18902 - - UNI30560 -  - UNI17689 - - UNI25772 - - UNI25795 - - UNI30560 -  - UNI2098 - - UNI25

772 -  - UNI2098 - MDRVDREITMVEQQISKLKKKQ QQLEEEAAKPPEPEKPVSPPPIESKHRSLVQIIYDENR KKAEAAHRILEGLGPQVEL

 PLYNQPSDTRQYHENIKI INQAMRKKLILYFKRRNHARKQW - UNI7790 - EQRFCQRYDQLMEAWEKKVERIENNPRRRAKESKVREYYEKQFP

EIRKQRELQERMQS SRVGQRGSGLSMSAARSEHEVSEIIDGLSEQE NLEKQMRQLAVIPPMLYDADQQRIKFINMNGLMDDPMKVYKDRQVTNMWSEQ

ERDTFREK KFMQHPKNFGLIASFLERK TVAECVLYYYLTKKNENYKSLVRRSYRRRGKSQ QQQQQQQQQQQQQMARSSQEEKEEKEKEKEADKEEEK

QDAENEKEELSK - UNI12291 - KEKTDDTSGEDNDEKEAVASKGRKTANSQGRRKGRITRSMANEANHEETATPQQSSELA ASMEMNESSRWTEE

EMETAKKG - UNI6109 - GLLEHGRNWSAIARMVGSKTVSQCKNFYFNYKKRQNLDEILQQHKLKM EKERNARRKKKKTPAAASEETAFPPAAEDE

EMEASGASANEEELAEEAEA - UNI6062 - ASQASGNEVPRVGECSGPA AAVNNSSDTESVPSPRSEATKDTGPKPTGTEALPAATQPPVPPPEEP

AVAPAEPSPVPDASGPPSPEPSPSPAAPPATVDKDEQEAPAAPAPQTEDAKEQKSEAEEIDVGKPEEPEASEEPPESVKSDHKEETEEEPEDKAKGTEAI

ETVSEAPLKVEEAGSKAAVTKGSSSGATQDSDSSATCSADEVDEPEGGDKGR RLLSPRPSLLTPAGDPRASTSPQKPLDLKQLKQRAAAIPPI VTKVH

EPPREDTVPPKPVPPVPPPTQHLQPEGDVSQQSGGSPRGKSRSPVPPAEKEA AEKPAFFPAFPTEGPKLPTEPPRWSSGLPFPIPPREVIKTSPHAADP

SAFSYTPPG GHPLPLGLHDSARPVLPRPPISNPPPLISSAKHPGVLERQLGAISQ QGMSVQLRVPHSEHAKAPMGPLTMGLPLAVDPKKLA APFSGV

KQEQLSPRGQAGPPESLGVPTAQETSVLRG GTALGSATSGSITKGLPSTRAADGPSYRGSITH - UNI1593 - GTPADVLYKGTISRIVGEDSPSR

LDRAREDTLPKGHVIYEGKKGHVLSYEG GGMSVSQCSKEDGRSSSGPPHETAAPKRTYDMMEGRVGRTVTSASIEG GLMGRAIPEQHSPHLKEQHHIR

GSITQG GIPRSYVEAQEDYLRREAKLLKREGTPPPPPPPRDLTETYKPRPLDPLGPLKLKPTHEGVVATVKEAGRSIHEIPREELRRTPELPLAPRPLK

EGSITQ GTPLKYDSGAPSTGTKKHDVRSIIGSPGRPFPALHPLDIMADARALERACYEESLKSRSGTSSGAGGSITRGAPVVVPELGKPRQSPLTYEDH

GAPFTSHLPRGSPVTTREPTPRLQEG GSLLSSKASQDRKLTSTPREIAKSPHSTVPEHHPHPISPYEHLLRGVTGVDLYRGHIPLAFDPTSIPRGIPLE

AA AAAAYYLPRHLAPSPTYPHLYPPYLIRGYPDTAALENRQTIINDYITSQQMHHNAASAMAQRADMLRGLSPRESSLALNYAAGPRG GIIDLSQVPH

LPVLVPPTPGTPATAIDRLAYLPTAPPPFSSRHSSSPLSPG GGPTHLAKPTATSSSERERERERERDKSILTSTTTVEHAPIWRPG - UNI67 - GT

EQSSGAGGSSRPASHTHQHSPISPRTQDALQQRPSVLHNTSMKGVVTSVEPGTPTVLRWAR RSTSTSSPVRPAATFPPATHCPLGGTLEGVYPTLMEPV

LLPKETSRVARPERPRVDAGHAFLTKPPAREPASSPSKSSEPRSLAPPSSSHTAIARTPAKNLAPHHASPDPPAPTSASDLHREKTQSKPFSIQELELRS

LG GYHSGAGYSPDGVEPISPVSSPSLTHDKGLSKPLEELEKSHLEGELRHKQPG GPMKLSAEAAHLPHLRPLPESQPSSSPLLQTAPGIKGHQRVVTL

AQHIS EVITQDYTRHHPQQLSGPLPAPLYSFPGASCPVLDLRRPPSDLYLPPPDHGTPARGSPHSEGGKR RSPEPSKTSVLGSSEDAIEPVSPPEGMT

EPGHARSTAYPLLYRDGEQGEPR RMGSKSPGNTSQPPAFFSKLTESNSAMVKSKKQEINKKLNTHNRNEPEYN NIGQPGTEIFNMPAITGAG - UNI

668 - GLMTCRSQAVQEHASTNMGLEAIIRKALMGKYDQWEEPPPLGANAFNPLNASASLPAAAMPITTADGRSDHALTSPG GGGGKAKVSGRPSSRK

AKSPAPGLASGDRPPSVSSVHSEGDCNRRTPLTNRVWEDRPSSAG GSTPFPYNPLIMRLQAGVMASPPPPGLAAGSGPLAGPHHAWDEEPKPLLCSQYE

TLSDSE

For any suggestions or comments, please send an email to unitrap@crg.es