Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000029501 (Ankle2)
Chromosomal location
Chr 5: 110660060 - 110685666 (+)
Description
ankyrin repeat and LEM domain containing 2 Gene [Source:MGI Symbol;Acc:MGI:1261856]
RefSeq_peptide
NP_082198.1 
UniGene
Mm.410532 Mm.288442 
MGI
MGI:1261856 
Uniprot/SWISSPROT
Q6P1H6 
Uniprot/SPTREMBL
Q3UY52 
Human Ortholog
ENSG00000176915 (ANKLE2)
Omim not available
UniTrap UNI11983
Vector Insertion
Chr 5: 110660443 - 110663365
Public Clones (sanger) P014E03 (ggtc) IST10977H5 (tigm)
Private Clones OST203670 (lexicon)
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5456
Vector Insertion
Chr 5: 110663840 - 110665291
Public Clones CSJ252 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 25% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5470
Vector Insertion
Chr 5: 110665499 - 110666673
Public Clones CSJ251 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 33% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2658
Vector Insertion
Chr 5: 110667155 - 110670947
Public Clones AL0586 (sanger) XP0058 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 47% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8241
Vector Insertion
Chr 5: 110671071 - 110673522
Public Clones RRF028 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 52% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12455
Vector Insertion
Chr 5: 110673590 - 110678349
Public Clones F026A07 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 54% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI251
Vector Insertion
Chr 5: 110682934 - 110683319
Public Clones GC0401 (tigem)
Private Clones not available
Severity of mutation (?) Insertion after 92% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000086674
Sequence
CCTGATCGTTGGGAAACGGGACGGCCCGCACTGCGCGCGCAGCCCGCCTGGTCTAACCACGGCCGGGCGGAGGAGGAGGCTTGGGGCAGGCGCGACTCCC

GTGGCGAGGCGAGCGGTCTTCTGAGGGCCGGAGGCGGGAGCGACGCGGGCTGCATTTGCAGCGGCCGCGCTCAAGGCCTCGGCGCCGGCGGTGGCGATGC

TGTGGCAGCGGCTGGCTGTGGTGGAGTGGGCGGCCCTGGCCTGGGAGCTCCTGGGCGCCTCGGTGCTGTTCATCGCCGTGCGCTGGCTGGTCCGCCGGCT

AGAGAAGCGGCCGCGGGACCTGAACCGTTGCGGGACGCTCTCCTCTCCGCCCAGCGCGTCTGAAGCGGTGGCCGCACAGCCAG - UNI11983 - GTG

AAGTGACAATGGATGCCATGATGGCTCGACTGAAACTCTTGAATCCAGATGACCTTAGAAAAGAAGTTATGAAAGCTGGACTTAAATGTGGACCCATTAC

ATCAACAACAAGATTTATTTTTGAGAAGAAATTAGCTCAGGCCTTACTGGAACAAGGTGGATTGCTGACCTCTTCCCTTCCCAAGCCCAGCGCGGTTACT

GCCATGGCATTTATCCAGGGCACCTCAAGGACTCCTCCATCTGTGGACGGGAAACAAACTCAGCAGGCCTGTTTTTCTGAAGACAGAGATTTTGGTTACA

GTGTGGGCTTGAACCCTCCAGAAGAGGAAGCGGTAGCATCCAGTGTCCACCCAGTACCCTTCAGTGCCTCTACCAGGAATGACAACCACAAGGCTGGAGT

GACAGCTCCTAAGGAGCCACTTGTGTACTATGGAGTGTGTCCAGTATATGAGGATGGCCCTGTGAGACATG - UNI5456 - AGAGGATCCATGTTTA

CGAAGATAAAAAGGAAGCTTTACAAGCTGCCAAGTTGATCAAAGGGTCCCGGTTTAAAGCTTTTCGAACAAGAGAAGATGCTGAGAAATTTGCTAGAGGG

ATATGTGATTATTTACCTTCTCCCAACAAAACTACGCCCTTACTGTCTCCTGTGAAGGCAGTGCCCCTCGGTGGCAGTGATGGGCTGAAAG - UNI547

0 - CAGATGGCTTGTGCCTGGCTGAATCAGAAACAGTAAACAAAGAACGAGCAAACAGTTACAAAAACCCCCGTACCCAGGACCTCACGGCCAAGCTGC

GGAAAGCTGTCGAAAACGGGGAGGAACACACCTTTTCTGATCTTATCTGGAGTAATCCTCGATATCTAATTGGTTCTGGGGACAACCCAACCATTGTACA

A GAAGGATGTAGGTACAATGTCATGCATGTTGCTGCCAAAGAGAACCAGGCTTCCATGTGCCAGCTGACATTAGAGACTCTGGAGAACCCTGAGTTTAT

GCGTCTGATGTACCCAGATGACAACATGGACATGCTACAGAAGCGCATCCTCTACGTTGTTGACCTGTATCTTAATACTCCTGACAAAGTG - UNI265

8 - GGCTTTGATACACCACTGCATTTTGCTTGTAAATTTGGAAATGTGGATGTAGTCAATGTGCTTTCTTCACACCCTTTGATTGTGAAAAACCGAAAG

AATAAATATGGTAAAACACCTGAAGAA - UNI8241 - GTAATTTGTGAAAGAAGCCAAAACAAATCTCCAGCACTGAAAGAAAGGATTAGAGAATAC

TTAATGG - UNI12455 - GTCACTACTATGTGCCACTCCTGAGAGCAGAAGACACTTCTCCTGTCATTGGGGAGCTGTGGTCCTCAGACCAGAAAGC

TGAAGCCTCAAATACTGCCCACTGTAGAAGCAGCCCCAGAGATCCTGTGATGACACTGAGAGCTTTCGTGGGACCTCTGAGTCCATCCAAA GCAGAAGA

TTTTCGAAAGCTCTGGAAAACTCCACCTCGAAAGAAAGCAGGCTTCTTCCACAGCATCAGAAAGTCTGACCCAGAACGAGGCATTGAGAGAGTTGGAAG 

GGAGCTAGCTCATGAGCTGGGGTATCCCTGGGTTGAATACTGGGAATTTCTGGGATGTTTTGTTGATCTGTCTTCCCAGGAAGGCTTGCAAAGACTAGAA

GAATACCTTATCCAGAAGGAGTTAAGCAAAAAGGCTCAACAAGAAATACGAGAAAATGAAGGCTGCCTTCAGGACAGAACCTCAGATTTTG GCAGTGGA

AAGAAGTACAGCAACTCCATCTCCGTGGGAGCATTTCTAGATGGGGATGATGACAGTAGTTTGGAAGAAATTAAAAAC ACTCAAGAGTTGAATAAACTG

AATTTGCAAAGCCTGGGAGACAGCCTTCATGAGACACCAGATAAAAACGGGAAACTAGAGGATGAGGTGCTTCCTTCAAGAAAGGGTGCAGCAGACAGTG

ACTTGCTGGCATCTCCTCCTGCCATAGCAAGCCTTGGAAAGAAGCAAGTCAGGACCAACACTGAGGTGTCAGAGGCAATGGCTGAAATGTCTTTGGGCCC

TAAGAGCCCCCAACTTGGAGTTCAGGCTGGTCTGGAACCTATACTCTCATCTGCCACGGTAGATTCCACCAAGAGGCTCTTCCTGTCTGG AGAGGAACC

ATCAAAACTAGATCGAGATGTTTTAGCAGCTCTTGAGTGTGCGAATATTGACCCTGGTCTGTACCCAGCAATCCACAGATGGAAAAGCACTGTCATGTGC

TACTCGCCCTCAGACAGACAGAG - UNI251 - TTGGCCAAGTCCTGCACTCAAAGGGAAGTTCACAACTGAGTTGGTGGATCTCGATTGCTCTCATA

GCTGCTCAGGACGATGCAGTCCAGCTGGTAGCAGCCCCAGTAAGCCTGGCCACACCTCCTCCTCTTCTGGCCTGCACAGCCCTGGACGCTACAGTCCAGC

ACATGGGAGACACTTCCAAAGAGTGGCACACGTGGCCCGACTTGCAGCTCTGTAGAGCCAGCTTACTCCTGGGATTCATTTACTTCTTTGTTTGTAAAAG

AGTAATGTTTATTGGTAAAAATTCCATGAAAGAATGTATCCTGAATAACTTAATCCTCGCTTTGAGGGTACTGGTATTTTAGAAAATACAATGTTCTGAG

TATAATTTGAATGTCTGATATTTTGGAAGAAGTTAATGAAAGCAAACTCAGATACTAATTGTTTGAAAGTGTAGCCGTAATAATGATTCAGACTTTTCAG

GTGGAAACTTCTAATTTTGAAATAGAACAAAGATGCAAAGGCATAGACAAGTGAGGTGTTGCTAATTGGGTTTGTTAGCAGCAACACTGCAGCACGTGCA

CACACCCACTATTTCTGAAACAGATCAATTATGTATTGTCTCTTGGGGGGGTGCAGCTTTTTGATATGCAATGGCAAAACTATGTGTTTGTCATTTCACC

CTAGTTATTCCAACCGAGAGAAAGCAGGTGGCAGAAAAGCAGATGTGCCCTGACTCAGACTTCAGTAACAATGCTCAAAACACTGCCAGAAGTTGGGATG

GGGGGTTAAAGCCATCGAGAATCATGCGAGTAATCATCATAGAAAACTCACCAGCAATAACTAAAACCAAAACTATTTCTCAGTACTTGTCAGTGTAGTA

AGTTGTCTAGAAGTTGTACCCAGGCTGGAGAAATGGCTCAGCGGTTAAGAGCACCGACTGCTCTTCCAATGGTCCTGAGTTCAATTCCCAGCAACCACAT

GGTGGCTCACAACCATCCATAATAAAATCTGATGCCTTCTTTTGGGGTGTCTGAAAACAGATACAGTGTACTTACATATAATAAATACATCTTTTATAAA

AAAAAGAAATTGTTCCCAAGTCTTAAAATTTAGCCTGAGATTTCACTAAGCATGATTACATGACAGATGTATGCCGTATTTTAGAAATTAAAGAGCTTTA

TGCTAGAGTTTAGCACTTGAGATCTGAGTTCATTTCAGTGGCTTGCAGTGTTGACTTTTGGCTATCCCAAGAGATGTGTACCGAGTGGCATTGCACACCC

TAAGGCTCCAAGATAAAACCACCTTGCTGAAGCTGGGTCTCAGCTGTCTGTCAGTTGCTTGCACAGAGCCAGTAGTGTTCTGGAGACACTTGCAGTGCTT

CACCCCAGTACAGAACTATACCACTGATTTTGCCAATTTCAGTGCCTTTTGTGAGTCATTTTGAGATCACATAGTGCTAAATGGGGGCGTTAGATTCTCT

TTTGTTTATAAAAATGTTGACCAGGCAAGCCTTTAAGCCCAGCACTCATTAGGCAGAAGCAGGGGGTTCTCTGAATTTGAGGCCAGCCTGGTCTAGATAG

TGAGTTCCAAGACAGCCAGAACTACACAGAGGATCTTGTCTCAAATTTAAAACAAAAACAAAAACCCACCAAAATGATAATAAAGTAATTCTGAGCTCAA

ATGTTTAGGTCTTTTCTTTTTTCTTTTTTTTTTTTTTTAACTTTTTTAAAGCTTATTTTAATGTGGTAAGAAATACCAGAATTGAGATTTTGGACTTTGG

ATTTAGTTTGTTTTGTTCCCCTTGTAAGCAGCTGAGCTCTAAGTACAAGACAGCCAATCAAGTGACCTGGAAACAATCCCAAAGGGAATCTTTGTTCTCA

AAAGAAACCAAAACCCACACACTATATTCAGCTATGATTTTGTTTTCTCTAAAGTCTTATTGTCCTGTGCGGTTATTTTTGTTGTTTTTTCCATACTCAA

AAACTGAAGTACTAGTTTTGCCCTATTTTAACTTTTTTTTTTTTAAACTCTTCTTTCTTGATATTTACTTAAGACAACTTTTGGGAGTCAGTTCTCAAAC

CATGTAGGTCTCAGGAATCCAACTCCAGTCACTGGAATTGAGTTTTACCCGAGCCATCTTGCTCGCCCATTTTAAACCCTAAGCTGCCTTTGGACTATTT

TTCCACTAGTATGAAGGGTATATACCTGTTAGTAACACCTGTTGATCTATGTCATAAACATTGTTTACTTGATCTTTCGCAAAGTGTTGGGTAGGAAACG

ACTCCTTAATTTGTTATTGGACAGAATCCCCTTCTTAGTAAAACTGTAAGAAATATTTTCATTAAAAAGGACATTGAGTAGC
Translation
MLWQRLAVVEWAALAWELLGASVLFIAVRWLVRRLEKRPRDLNRCGTLSSPPSASEAVAAQPG - UNI11983 - GEVTMDAMMARLKLLNPDDLRKE

VMKAGLKCGPITSTTRFIFEKKLAQALLEQGGLLTSSLPKPSAVTAMAFIQGTSRTPPSVDGKQTQQACFSEDRDFGYSVGLNPPEEEAVASSVHPVPFS

ASTRNDNHKAGVTAPKEPLVYYGVCPVYEDGPVRHE - UNI5456 - ERIHVYEDKKEALQAAKLIKGSRFKAFRTREDAEKFARGICDYLPSPNKTT

PLLSPVKAVPLGGSDGLKA - UNI5470 - ADGLCLAESETVNKERANSYKNPRTQDLTAKLRKAVENGEEHTFSDLIWSNPRYLIGSGDNPTIVQ E

GCRYNVMHVAAKENQASMCQLTLETLENPEFMRLMYPDDNMDMLQKRILYVVDLYLNTPDKV - UNI2658 - GFDTPLHFACKFGNVDVVNVLSSHP

LIVKNRKNKYGKTPEE - UNI8241 - VICERSQNKSPALKERIREYLMG - UNI12455 - GHYYVPLLRAEDTSPVIGELWSSDQKAEASNTAH

CRSSPRDPVMTLRAFVGPLSPSK AEDFRKLWKTPPRKKAGFFHSIRKSDPERGIERVGR RELAHELGYPWVEYWEFLGCFVDLSSQEGLQRLEEYLIQ

KELSKKAQQEIRENEGCLQDRTSDFG GSGKKYSNSISVGAFLDGDDDSSLEEIKN TQELNKLNLQSLGDSLHETPDKNGKLEDEVLPSRKGAADSDLL

ASPPAIASLGKKQVRTNTEVSEAMAEMSLGPKSPQLGVQAGLEPILSSATVDSTKRLFLSG GEEPSKLDRDVLAALECANIDPGLYPAIHRWKSTVMCY

SPSDRQS - UNI251 - SWPSPALKGKFTTELVDLDCSHSCSGRCSPAGSSPSKPGHTSSSSGLHSPGRYSPAHGRHFQRVAHVARLAAL
Transcript ENSMUST00000031474
Sequence
CCTGATCGTTGGGAAACGGGACGGCCCGCACTGCGCGCGCAGCCCGCCTGGTCTAACCACGGCCGGGCGGAGGAGGAGGCTTGGGGCAGGCGCGACTCCC

GTGGCGAGGCGAGCGGTCTTCTGAGGGCCGGAGGCGGGAGCGACGCGGGCTGCATTTGCAGCGGCCGCGCTCAAGGCCTCGGCGCCGGCGGTGGCGATGC

TGTGGCAGCGGCTGGCTGTGGTGGAGTGGGCGGCCCTGGCCTGGGAGCTCCTGGGCGCCTCGGTGCTGTTCATCGCCGTGCGCTGGCTGGTCCGCCGGCT

AGAGAAGCGGCCGCGGGACCTGAACCGTTGCGGGACGCTCTCCTCTCCGCCCAGCGCGTCTGAAGCGGTGGCCGCACAGCCAG - UNI11983 - GTG

AAGTGACAATGGATGCCATGATGGCTCGACTGAAACTCTTGAATCCAGATGACCTTAGAAAAGAAGTTATGAAAGCTGGACTTAAATGTGGACCCATTAC

ATCAACAACAAGATTTATTTTTGAGAAGAAATTAGCTCAGGCCTTACTGGAACAAGGTGGATTGCTGACCTCTTCCCTTCCCAAGCCCAGCGCGGTTACT

GCCATGGCATTTATCCAGGGCACCTCAAGGACTCCTCCATCTGTGGACGGGAAACAAACTCAGCAGGCCTGTTTTTCTGAAGACAGAGATTTTGGTTACA

GTGTGGGCTTGAACCCTCCAGAAGAGGAAGCGGTAGCATCCAGTGTCCACCCAGTACCCTTCAGTGCCTCTACCAGGAATGACAACCACAAGGCTGGAGT

GACAGCTCCTAAGGAGCCACTTGTGTACTATGGAGTGTGTCCAGTATATGAGGATGGCCCTGTGAGACATG - UNI5456 - AGAGGATCCATGTTTA

CGAAGATAAAAAGGAAGCTTTACAAGCTGCCAAGTTGATCAAAGGGTCCCGGTTTAAAGCTTTTCGAACAAGAGAAGATGCTGAGAAATTTGCTAGAGGG

ATATGTGATTATTTACCTTCTCCCAACAAAACTACGCCCTTACTGTCTCCTGTGAAGGCAGTGCCCCTCGGTGGCAGTGATGGGCTGAAAG - UNI547

0 - CAGATGGCTTGTGCCTGGCTGAATCAGAAACAGTAAACAAAGAACGAGCAAACAGTTACAAAAACCCCCGTACCCAGGACCTCACGGCCAAGCTGC

GGAAAGCTGTCGAAAACGGGGAGGAACACACCTTTTCTGATCTTATCTGGAGTAATCCTCGATATCTAATTGGTTCTGGGGACAACCCAACCATTGTACA

A GAAGGATGTAGGTACAATGTCATGCATGTTGCTGCCAAAGAGAACCAGGCTTCCATGTGCCAGCTGACATTAGAGACTCTGGAGAACCCTGAGTTTAT

GCGTCTGATGTACCCAGATGACAACATGGACATGCTACAGAAGCGCATCCTCTACGTTGTTGACCTGTATCTTAATACTCCTGACAAAGTG - UNI265

8 - GGCTTTGATACACCACTGCATTTTGCTTGTAAATTTGGAAATGTGGATGTAGTCAATGTGCTTTCTTCACACCCTTTGATTGTGAAAAACCGAAAG

AATAAATATGGTAAAACACCTGAAGAA - UNI8241 - GTAATTTGTGAAAGAAGCCAAAACAAATCTCCAGCACTGAAAGAAAGGATTAGAGAATAC

TTAATGG - UNI12455 - GTCACTACTATGTGCCACTCCTGAGAGCAGAAGACACTTCTCCTGTCATTGGGGAGCTGTGGTCCTCAGACCAGAAAGC

TGAAGCCTCAAATACTGCCCACTGTAGAAGCAGCCCCAGAGATCCTGTGATGACACTGAGAGCTTTCGTGGGACCTCTGAGTCCATCCAAA GCAGAAGA

TTTTCGAAAGCTCTGGAAAACTCCACCTCGAAAGAAAGCAGGCTTCTTCCACAGCATCAGAAAGTCTGACCCAGAACGAGGCATTGAGAGAGTTGGAAG 

GGAGCTAGCTCATGAGCTGGGGTATCCCTGGGTTGAATACTGGGAATTTCTGGGATGTTTTGTTGATCTGTCTTCCCAGGAAGGCTTGCAAAGACTAGAA

GAATACCTTATCCAGAAGGAGTTAAGCAAAAAGGCTCAACAAGAAATACGAGAAAATGAAGGCTGCCTTCAGGACAGAACCTCAGATTTTG GCAGTGGA

AAGAAGTACAGCAACTCCATCTCCGTGGGAGCATTTCTAGATGGGGATGATGACAGTAGTTTGGAAGAAATTAAAAACCAGCAAAATACAGTTCCAAGTC

AGAGTCAGCCCACAACTGATAAGTTCCAAACCTCTAAAAGTGGTTCCCTTCCCTTGGGACAGAAGGTCGACCCTGGAGAAACCTCAGTTGGAACTTACCC

AGATAAAGGCAGAAATGGGTTTTGTCACCCTCTAAACCACAGGACTGCAGATGGAAGGGGACTAGAGGCCACCAATGGGGAGGAGGCCCTTCCACCACCT

GTTTCTGTTTTGACTCAAGAGTTGAATAAACTGAATTTGCAAAGCCTGGGAGACAGCCTTCATGAGACACCAGATAAAAACGGGAAACTAGAGGATGAGG

TGCTTCCTTCAAGAAAGGGTGCAGCAGACAGTGACTTGCTGGCATCTCCTCCTGCCATAGCAAGCCTTGGAAAGAAGCAAGTCAGGACCAACACTGAGGT

GTCAGAGGCAATGGCTGAAATGTCTTTGGGCCCTAAGAGCCCCCAACTTGGAGTTCAGGCTGGTCTGGAACCTATACTCTCATCTGCCACGGTAGATTCC

ACCAAGAGGCTCTTCCTGTCTGG AGAGGAACCATCAAAACTAGATCGAGATGTTTTAGCAGCTCTTGAGTGTGCGAATATTGACCCTGGTCTGTACCCA

GCAATCCACAGATGGAAAAGCACTGTCATGTGCTACTCGCCCTCAGACAGACAGAG - UNI251 - TTGGCCAAGTCCTGCACTCAAAGGGAAGTTCA

CAACTGAGTTGGTGGATCTCGATTGCTCTCATAGCTGCTCAGGACGATGCAGTCCAGCTGGTAGCAGCCCCAGTAAGCCTGGCCACACCTCCTCCTCTTC

TGGCCTGCACAGCCCTGGACGCTACAGTCCAGCACATGGGAGACACTTCCAAAGAGTGGCACACGTGGCCCGACTTGCAGCTCTGTAGAGCCAGCTTACT

CCTGGGATTCATTTACTTCTTTGTTTGTAAAAGAGTAATGTTTATTGGTAAAAATTCCATGAAAGAATGTATCCTGAATAACTTAATCCTCGCTTTGAGG

GTACTGGTATTTTAGAAAATACAATGTTCTGAGTATAATTTGAATGTCTGATATTTTGGAAGAAGTTAATGAAAGCAAACTCAGATACTAATTGTTTGAA

AGTGTAGCCGTAATAATGATTCAGACTTTTCAGGTGGAAACTTCTAATTTTGAAATAGAACAAAGATGCAAAGGCATAGACAAGTGAGGTGTTGCTAATT

GGGTTTGTTAGCAGCAACACTGCAGCACGTGCACACACCCACTATTTCTGAAACAGATCAATTATGTATTGTCTCTTGGGGGGGTGCAGCTTTTTGATAT

GCAATGGCAAAACTATGTGTTTGTCATTTCACCCTAGTTATTCCAACCGAGAGAAAGCAGGTGGCAGAAAAGCAGATGTGCCCTGACTCAGACTTCAGTA

ACAATGCTCAAAACACTGCCAGAAGTTGGGATGGGGGGTTAAAGCCATCGAGAATCATGCGAGTAATCATCATAGAAAACTCACCAGCAATAACTAAAAC

CAAAACTATTTCTCAGTACTTGTCAGTGTAGTAAGTTGTCTAGAAGTTGTACCCAGGCTGGAGAAATGGCTCAGCGGTTAAGAGCACCGACTGCTCTTCC

AATGGTCCTGAGTTCAATTCCCAGCAACCACATGGTGGCTCACAACCATCCATAATAAAATCTGATGCCTTCTTTTGGGGTGTCTGAAAACAGATACAGT

GTACTTACATATAATAAATACATCTTTTATAAAAAAAAGAAATTGTTCCCAAGTCTTAAAATTTAGCCTGAGATTTCACTAAGCATGATTACATGACAGA

TGTATGCCGTATTTTAGAAATTAAAGAGCTTTATGCTAGAGTTTAGCACTTGAGATCTGAGTTCATTTCAGTGGCTTGCAGTGTTGACTTTTGGCTATCC

CAAGAGATGTGTACCGAGTGGCATTGCACACCCTAAGGCTCCAAGATAAAACCACCTTGCTGAAGCTGGGTCTCAGCTGTCTGTCAGTTGCTTGCACAGA

GCCAGTAGTGTTCTGGAGACACTTGCAGTGCTTCACCCCAGTACAGAACTATACCACTGATTTTGCCAATTTCAGTGCCTTTTGTGAGTCATTTTGAGAT

CACATAGTGCTAAATGGGGGCGTTAGATTCTCTTTTGTTTATAAAAATGTTGACCAGGCAAGCCTTTAAGCCCAGCACTCATTAGGCAGAAGCAGGGGGT

TCTCTGAATTTGAGGCCAGCCTGGTCTAGATAGTGAGTTCCAAGACAGCCAGAACTACACAGAGGATCTTGTCTCAAATTTAAAACAAAAACAAAAACCC

ACCAAAATGATAATAAAGTAATTCTGAGCTCAAATGTTTAGGTCTTTTCTTTTTTCTTTTTTTTTTTTTTTAACTTTTTTAAAGCTTATTTTAATGTGGT

AAGAAATACCAGAATTGAGATTTTGGACTTTGGATTTAGTTTGTTTTGTTCCCCTTGTAAGCAGCTGAGCTCTAAGTACAAGACAGCCAATCAAGTGACC

TGGAAACAATCCCAAAGGGAATCTTTGTTCTCAAAAGAAACCAAAACCCACACACTATATTCAGCTATGATTTTGTTTTCTCTAAAGTCTTATTGTCCTG

TGCGGTTATTTTTGTTGTTTTTTCCATACTCAAAAACTGAAGTACTAGTTTTGCCCTATTTTAACTTTTTTTTTTTTAAACTCTTCTTTCTTGATATTTA

CTTAAGACAACTTTTGGGAGTCAGTTCTCAAACCATGTAGGTCTCAGGAATCCAACTCCAGTCACTGGAATTGAGTTTTACCCGAGCCATCTTGCTCGCC

CATTTTAAACCCTAAGCTGCCTTTGGACTATTTTTCCACTAGTATGAAGGGTATATACCTGTTAGTAACACCTGTTGATCTATGTCATAAACATTGTTTA

CTTGATCTTTCGCAAAGTGTTGGGTAGGAAACGACTCCTTAATTTGTTATTGGACAGAATCCCCTTCTTAGTAAAACTGTAAGAAATATTTTCATTAAAA

AGGACATTGAGTAGC
Translation
MLWQRLAVVEWAALAWELLGASVLFIAVRWLVRRLEKRPRDLNRCGTLSSPPSASEAVAAQPG - UNI11983 - GEVTMDAMMARLKLLNPDDLRKE

VMKAGLKCGPITSTTRFIFEKKLAQALLEQGGLLTSSLPKPSAVTAMAFIQGTSRTPPSVDGKQTQQACFSEDRDFGYSVGLNPPEEEAVASSVHPVPFS

ASTRNDNHKAGVTAPKEPLVYYGVCPVYEDGPVRHE - UNI5456 - ERIHVYEDKKEALQAAKLIKGSRFKAFRTREDAEKFARGICDYLPSPNKTT

PLLSPVKAVPLGGSDGLKA - UNI5470 - ADGLCLAESETVNKERANSYKNPRTQDLTAKLRKAVENGEEHTFSDLIWSNPRYLIGSGDNPTIVQ E

GCRYNVMHVAAKENQASMCQLTLETLENPEFMRLMYPDDNMDMLQKRILYVVDLYLNTPDKV - UNI2658 - GFDTPLHFACKFGNVDVVNVLSSHP

LIVKNRKNKYGKTPEE - UNI8241 - VICERSQNKSPALKERIREYLMG - UNI12455 - GHYYVPLLRAEDTSPVIGELWSSDQKAEASNTAH

CRSSPRDPVMTLRAFVGPLSPSK AEDFRKLWKTPPRKKAGFFHSIRKSDPERGIERVGR RELAHELGYPWVEYWEFLGCFVDLSSQEGLQRLEEYLIQ

KELSKKAQQEIRENEGCLQDRTSDFG GSGKKYSNSISVGAFLDGDDDSSLEEIKNQQNTVPSQSQPTTDKFQTSKSGSLPLGQKVDPGETSVGTYPDKG

RNGFCHPLNHRTADGRGLEATNGEEALPPPVSVLTQELNKLNLQSLGDSLHETPDKNGKLEDEVLPSRKGAADSDLLASPPAIASLGKKQVRTNTEVSEA

MAEMSLGPKSPQLGVQAGLEPILSSATVDSTKRLFLSG GEEPSKLDRDVLAALECANIDPGLYPAIHRWKSTVMCYSPSDRQS - UNI251 - SWPS

PALKGKFTTELVDLDCSHSCSGRCSPAGSSPSKPGHTSSSSGLHSPGRYSPAHGRHFQRVAHVARLAAL

For any suggestions or comments, please send an email to unitrap@crg.es