Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000029502 (Golga3)
Chromosomal location
Chr 5: 110605720 - 110655489 (+)
Description
golgi autoantigen, golgin subfamily a, 3 Gene [Source:MGI (curated);Acc:Golga3-001]
RefSeq_dna
NM_008146 
RefSeq_peptide
NP_032172.3 
UniGene
Mm.9392 Mm.393008 Mm.409825 
MGI
MGI:96958 
Uniprot/SWISSPROT
P55937 
Uniprot/SPTREMBL
Q3UZV1 
Human Ortholog
ENSG00000090615 (GOLGA3)
Omim not available
UniTrap UNI30147
Vector Insertion
Chr 5: 110605942 - 110610621
Public Clones (sanger) D103C05 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1815
Vector Insertion
Chr 5: 110622129 - 110622637
Public Clones CA0131 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 39% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7134
Vector Insertion
Chr 5: 110622776 - 110630849
Public Clones RRJ519 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 42% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36560
Vector Insertion
Chr 5: 110631012 - 110631587
Public Clones IST10917C12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 45% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI35641
Vector Insertion
Chr 5: 110645993 - 110646829
Public Clones IST12981D12 (tigm) IST14640D7 (tigm) IST14935H3 (tigm) IST14591G11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 83% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34798
Vector Insertion
Chr 5: 110651926 - 110652173
Public Clones IST12520G4 (tigm) IST12248E7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 96% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000112512
Sequence
AAAATTTTAAGTCCACTTTCTGAAGGATATCTCAATCTGTCCGGAGATCCATACCAACCCCAATTTGAAAGTGGCTACTGGCCGCTGAGGGCAGCCTCTC

TTCCGGAACGAAGACCTCGCGGACCGTTTGTTTCCGGGGGGTTGCCCGAGACTGGTACCCTGTTGCGCCCCGCCCCTTGCACAGCCACGTCCTACCGGAG

CCGCAGGGTTGGGCCGGAACCG - UNI30147 - GAATCATGGTTGCTTGGTTTGACTTCAAGCCATTTATGAGACATTAAACCTGAAAATGGAAAAC

AGAGTAAGATCCTCCTTAGAAGCTCTGAGCTGTTGCTAATGGCAAAAAACAAACTTAATCCAGAGTTACTTGTAGCTCCTCAGAGTCTTCTTAGTCTGGG

CTGCCCTGACCATGGATGGAGCATCAGCCAAACAGGATGGCCTCTGGGAAAGCAAGTCCAGCAGTGATGTTTCATCTTGCCCTGAAGCCTCGCTGGAGAT

TGTGGGCTCTCTGGCCCGACTGCCTGATCAACAGGATACAGCTCAGG ATGCCAGTGTTGAGGTAAACAGAGGTTTTAAGGAAGAAGGAAGCCCAGATAG

ATCCAGCCAGGTGGCCATCTGTCAGAATGGGCAGATCCCAGACCTTCAGTTGTCCCTTGATCCCACAACAAGCCCAGTGGGACCTGATGCCTCTACAG G

CTCCACTGCATCTTCATTGCCTTTGGAAAAGGAGGAGCAGGTTCGACTGCAGGCCCGGAAGCGCCTGGAAGAGCAGCTGATGCAGTACCGAGTTAAGCGC

CATCGGGAAAGG TCCAGTCAACCTGCAACTAAAATGAAACTTTTTAGTACACTTGATCCTGAGCTCATGTTAAATCCAGAAAATTTGCCAAGGGCCAGT

ACTGTAGCTGTGACAAAAGAATATTCCTTCCTGCGTACCAGTGTTCCTCGAGGGCCCAAGGTAGGCAGCTTAGGGCTGCTGGCACATTCTAAAGAGAAAA

AGAACTCCAAATCAAGCAAGATTCGGTCTCTGGCTGACTATAGAACTGAAGATCCAAGTGACTCTGGTGGCCTTGGTTCTACTGCTGATGCTGTTGGAAG

TTCCCTGAAACAAAGTAGAAGTAGCACTTCAGTTGTGTCTGAGGTTAGCCCATCATCTGAGACTGATAACCGTGTAGAGAGTGCCTCCATGACTGGGGAT

AGTGTGTCAGAGGCTGATGGAAATGAGAGTGACAGTTCCTCACACAGCAGCCTCTCTGCCCGAGGGGCCTGTGGTGTCCTGGGGAACGTGGGCATGCCAG

GAACAGCTTACATGGTTGATGGCCAGGAGATTTCTGCTGAGGCCCTGGGCCAGTTTCCTTCAATTAAAGACGTACTACAGGCTGCAGCAGCCCAGCACCA

AGATCAGAACCAGGAAGCCAACGGAGAGGTGCGGAGCCGTAGAGACAGCATCTGCAGCAG TGTGTCCATGGAGAGCTCCTTGGCTGAACCACAGGATGA

ATTGTTGCAGATTCTTAAAGATAAAAGGAGGCTTGAAGGACAGGTGGAGGCTTTGTCATTAGAAGCCAGTCAG GCACTTCAAGAGAAGGCTGAGCTACA

GGCCCAGCTTGCTGCCCTGAGCACAAGGCTACAGGCACAGGTGGAACACAGCCACAGCAGCCAGCAGAAGCAAGACTCCCTTAGTTCTGAAGTGGACACT

TTGAAGCAGTCTTGCTGGGATCTAGAGCGGGCCATGACTGACCTGCAGAGCATGCTAGAAGCTAAAAATGCCAGCCTGGCATCCTCAAACAATGACCTAC

AAGTGGCAGAGGAGCAGTATCAGAGACTGATGGCCAAAGTGGAGGACATGCAGAGAAACATCCTCAGCAAGGACAACACAG TGCATGACCTGCGGCAGC

AGATGACAGCGCTACAGAGCCAGCTCCAGCAAGTACAGCTGGAGCGCACAACCCTGACCAGCAAACTACAAGCATCACAGGCTGAGATCACGTCTCTGCA

GCATGCCCGGCAATGGTACCAACAGCAGCTTACTTTGGCCCAGGAGGCCAGGGTCAGGCTGCAAGGAGAGATGGCCCATATCCAG - UNI1815 - GT

TGGACAAATGACCCAGGCAGGCCTTTTGGAGCACCTGAAGCTTGAGAATGTGTCCCTATCGCATCAGCTGACAGAAACTCAGCATCGATCCATCAAGGAG

AAAGAGCGCATAGCTGTTCAGCTCCAGAGCATTGAG - UNI7134 - GCTGACATGTTAGATCAGGAGGCAGCATTTGTACAGATTCGGGAGGCGAAG

ACAATGGTGGAGGAGGACCTCCAAAGGAGGCTGGAAGAATTTGAAGGTGAACGGGAGCAGTTACAGAAAGTGGCAGATGCAGCAGCATCCCTGGAGCAAC

AGTTGGAACAG - UNI36560 - GTGAAGCTGACATTGTTCCAGCGAGATCAGCAGCTTGCAGCACTTCAGCAGGAGCACCTAGATGTGATAAAGCAG

CTTACGTCGACGCAGGAGGCTCTGCAGGCCAAAGGGCAGTCTCTTGATGACCTGCATACACGTTACGATGAGCTACAAGCAAGGCTGGAGGAGCTGCAGA

GAGAGGCCGACTCCAGGGAGGATGCAATTCACTTCTTGCAGAATGAGAAGATTGTCTTGGAAGTGGCTCTACAATCGGCCAAGAGTGACAAGGAGGAACT

TGACAGAGGAGCACGGCGTTTGGAAGAAGATACTGAGGAGACATCAGGACTTTTGGAACAATTGAGACAAGATTTGGCTGTCAAGTCCAACCAG GTGGA

GCACTTGCAGCAGGAGACAGCCACGTTGAGAAAACAGATGCAGAAAGTAAAGGAGCAGTTTGTTCAGCAAAAG GTGATGGTAGAGGCATACCGGCGAGA

TGCTACTTCCAAAGATCAACTCATCAATGAACTGAAAGCCACCAAAAAACGGCTGGACTCTGAGATGAAGGAACTGAGGCAAGAGCTAATCAAGCTGCAG

GGAGAGAAGAAGACTGTGGAAGTAGAGCACTCACGACTGCAGAAGGACATGTCCCTGGTTCACCAGCAGATGGCAGAGCTTGAGGGGCATCTTCAGTCAG

TGCAGAAAGAACGAGATGAAATGGAGATTCACCTGCAG TCTTTGAAGTTTGACAAAGAGCAGATGATAGCCCTTACCGAGGCCAATGAGACACTGAAGA

AACAAATAGAAGAGCTGCAACAAGAGGCCAAGAA GGCCATCACAGAACAGAAGCAGAAGATGAAGAGGCTGGGCTCAGATCTGTCCAGCGCCCAGAAGG

AGATGAAGACTAAGCACAAAGCTTATGAGAATGCTGTGAGCATTCTCAGCCGTCGCCTGCAGGAGGCTCTGGCTTCTAAGGAGGCTACAGATGCAGAGCT

GAACCAGCTCAGAGCTCAGAGCACAGGTGGCAGCAGTGACCCTGTCCTACAT GAGAAGATTCGTGCTCTGGAGGTGGAACTGCAGAATGTTGGCCAAAG

CAAGATACTACTGGAGAAGGAGTTACAGGAGGTGATCACAATGACTAGCCAGGAGCTGGAAGAGTCCCGGGAGAAGGTGCTGGAGCTAGAAGATGAG CT

TCAAGAATCCAGAGGCTTCAGAAGGAAGATAAAACGTCTTGAAGAGTCAAATAAGAAACTAGCTCTGGAGTTAGAGCATGAGCGAGGGAAGCTCACTGGC

CTTGGACAATCTAATGCAGCGCTGCGGGAGCACAACAGCATTCTGGAGACTGCACTAGCCAAGAGGGAAGCTGACCTGGTACAGCTGAATCTGCAG GTG

CAGGCAGTTTTACAGCGCAAAGAGGAGGAGGATCGCCAGATGAAGCAACTTGTCCAAGCCTTACAAGTCTCACTAGAGAAAGAAAAGATGGAAGTGAACA

GCCTGAAGGAACAG ATGGCTGCTGCCAGGATAGAAGCTGGGCACAACCGCCGCCACTTTAAGGCAGCTACTTTGGAGCTGAGTGAGGTGAAGAAAGAAT

TGCAGGCCAAAGAACACCTGGTACAGACATTGCAGGCCGAGGTGGATGAGCTCCA - UNI35641 - GATTCAGGATGGAAAGCATTCTCAAGAAATA

GCACAATTCCAGACTGAGCTGGCAGAAGCTAGAACCCAGCTCCAGCTCCTACAGAAGAAGCTAGATGAGCAGATGAGCCAGCAACCGACAGGGAGCCAAG

AG ATGGAAGATCTCAAATGGGAATTGGATCAGAAAGAACGAGAGATTCAGTCCCTGAAGCAGCAGCTTGACTTGACAGAGCAACAGGGCAAGAAAGAAC

TGGAGGGGACACAGCAGACACTTCAG ACCATCAAGTCTGAGTTGGAAATGGTACAAGAAGATCTGTCTGAGACGCAGAAGGATAAGTTTATGCTTCAAG

CCAAAGTGTCTGAACTGAAGAACAACATGAAGACTCTGCTGCAGCAGAACCAACAGCTCAAGCTGGATCTCCGCCGCGGTGCAGCCAAG AAGAAAGAGC

CAAAAGGTGAGTCCAACTCATCCAGTCCTGCAACACCCATCAAGATACCAGATTGCCCTGTCCCAGCCTCATTGCTAGAGGAGCTGCTGAGGCCCCCACC

CGCTGTGAGCAAGGAACCCCTCAAGAATCTCAACAACTGTTTGCAGCAGCTCAA - UNI34798 - GCAGGAAATGGACAGTCTCCAGCGCCAGATGG

AGGAGCATACCATCACTGTGCATGAGTCCCTGTCCTCGTGGGCTCAGGTGGAAGCTGCCCCAGCAGAGCATGCCCATCCCCGGGGAGACACAAAACTGCA

TAATCAAAACAGTGTTCCCAGAGACGGGCTGGGCCAATGACCACTGTTGTCCTCATCACACAAGTATTTGTGACTGTTGAAGGAATTCTCTTGTCAATAT

TATTTATTTGATCGAATGCTCTGGTGGCTTTCTTTTTTCCTTTTTTAAGAAAGGACATTTAAATTTCCCTTTACTTTTTATCAAGGATTAAAATAACAGA

AAAAAACTGGGAGGTAATGGTACATACTTTTAATCCCAGCACCCAGGAGGCAGATGCAGGCATGATCTCTGTGAGTTTGAGGCCAGCCTGGTCTACAGAT

CAATAGTTTCAGAACAGCCAGGGCTACAAAGAAAGACTCTGTCATAAATAAATAAATAAATGGGATGAGGCAAGGATTAAAAGCATAGTCATTTTAAACC

ACATCTAGCTTTTCCCATGAAATGACCAAATCCTGAAAACATCAGAGTTTGGACTGCTGGTGAAATCTGAGTCTGTCTGTCTGAACAGTCACTTGCAGAA

GGAGGGAAGCTTGCATGTGGCTGTAGACACACACAAGACCTTTACTTTCCTTCATAAATGAGTTTTTATTTACACCTTTTGCTTTTTATTTAATTTGCTT

TTCAAACTGTTCTACCTAAATAGGATGTATATATAAATATTGAAAGTCTTTTGAAAACATATACCTATATTATTTAAGGACCTAATTGTCTTTCTGATTT

CCTTTTTGAAAATTTGCTATTGGGAAACAGTATATATGTAGCTTTAGCGATATCAGTTTAAAAATGTATTTTAAGAAATATAACTTATTTTCTATGCATC

CTAAAACCAAATACTCTTGGCACAGAAAGAGTTGATTAGTTGTAGTCTTTTTATTTCTGAGGTCTTTTCTGCCAGCATTTCCATGAATTAATATCACTGA

CCTCTCAGCCTTCTGTGGTTTTACTCACTTTGGCTTACGAACAGGCAGGGCCAGTCGTCAGGCCTTGCAGTTAACAGGGGACGAAAGGACCTCCAAGGTC

TCCTCATACTCACCTCACCTAACATTTGGAGAACACTGGTGGAGGAAAAGAGCAGGAGAGGAGGCCGCCTTGGTCCTTGTGGGTTAAGGGCTGCATACAC

CGTGTCCCAGAGATGGTGTTTATGAAACACTGTGAATGTCTTTCTGTCTGGTCGTCAGGAACTACCATGGACCTCTGTTGAGTATTTGTGGCACAAGAAG

TCAAGAGTAATACCTGAAAGGAGGTGGGCAACTTTGGTCTTCTGAGACAGGGTCAAGAGACAAAAGCCTTATTTAAAGTCAGCACTAAGTGTGTGATTTA

TTGCTGTCTGCTTCCCAAATCATAATAATGCTTTATATACTGACTAATTAGGAGAGTTGAGGTCTTTAATCTTTGTGAATGCTTGTGAAGAGAATTTAAA

ATAAAGTGGCTTTTTTGACTCGTGACTGTAATCCCAGCACTTGTAGGTAGAGTCAGGAAGAGGATCAGTTCAGGACTGGTTTTCAGCTACACGGCGAGTT

TGAGGCAAGACTGTGTTACATGAAACCATGACTTAAAAAGACAGACAAGCTGGAACAACAACAAAAAAGATGTGAAATATTGTTAGAAGGGAAAGAGAGA

AAGGCCTGAAGAAGGAATCTCTAAGCAGCAGTGATCAGCTAGTTGGTGTCTTTTAGTGGGTTTCTTGTCTATTTTGTGGATAATCGGTTTGGAATTTTTA

ATCTGTGTTCTCTTACAATATCCTATTAGAAGGTTAGCTGATGTGGTTAAAGTAGAACTATCCACAGTGATGTCTGGTGTTTGAAAAATATTCTTTAGCA

AGTATTGGAACTTTAAGATGTGTATATCATTTGTACAGGGTTTATCTTTAAAAAAAACTTTATTATAATTATACCCTTTTAATCTCTAAGTTAGAAATTA

GAAAAGGACGGTAATTTGCATTCTTATTTATTTTGTATTTTTAATGACAAAACCAAGAAATAGCACTTGGTTTGGACTTAGTTCTGCAACAGAGCTAGAT

TCTCCTATGTGAAGAGATCTTCAAGTGAGTTGTGTTGATTGTGTTGTCTGGGAAAGAATGAGTTAATTCTGAACTCATTCAAGTGAAGGTTGGTTTCATG

TCTTAACCCATTTCTTCAGTTGCTTTGCTGTTTCATGTGCACGGACACCCACAGAAACGGCACCTCTTCTAAACTTTATAGTCTGCCTTGTGGGCCCTTG

GCTAGGTTCCTCTTGGCTCCATGAAGGGCCTGGCATGTCTTGGCTTCTTGCTCTGTCTCTTTTTGTGAACCAGTGTGTCTTTTCTCACATTTGCGGTTCA

GAGGACTCTCAGATTGGAGCTGGAGTTCTCTTAGGGTTCTTTAAGTCACCTTGAAGTTGAGTTTTCAAGTTTCCTTGTTTGTTTGTTTGTTTGTTTGTTT

TGGCTTTTTCCCTCCTAAGAGGAATCTAAGGGATTCTATTTTACTTCACCTCCTTGAGCTTATTCTTGAGTGAATATAGCTTGATTACTGTTGCCTCTGC

AGCCGAAACTGGGAATTTTAGGTTTGCTCATGAGCGAGCGCAGGCAGGTCTGGAGGATTGCTTTTTCAGGCAGGCTCACACCATTGTGCGCCGTTTGTGC

GTATATCATACATGCTGCATCGTGCCCTAGACTGGACACCTTGGCTTGCATGATTTGTACTACCAGTTGGTTTTCTTACGTTTAAAAAAATTACCACGAA

ATTTCTATCATTGTTTTTCTGGTAGACGTCCGATTGATCCCATGATTTTAGATTTTTACACCATTGTAGCAGGCAATGATTTTGAGAAGATGTAAGGCTG

ACTTTACATGGACTTTGGGTACAGGGAGAAGGACCTGCTGTCTAAGAAGGTGGTCTTAGTGTATAAATCAGAAAGCTTGGTGAAATTCTTCTCTGTTTCA

AAACAAACTTTACCAGTATGTGAATACTGTAAAAGCCATAGTCTTATAGGTCATTATGATACATATTTTAATACATTTTGAAATAAAAATTGGCAGGTAA

AGATTTTGGATTTAAAAGGGACCATCATATTTGAAAAGAAAACCTCCTGGAGCCTTGGAGGGCCCCAGTGATAAGAATAATACTGTGGTATGAGATATCC

CGAGTCTCATCCTAACATGCTCAGTAGTTGGGCATTCTAGCCCAGTCTACCCTGTAGTGGTCATAGGTTCTGCCAAGATCTCTGGGTCCATGTCCAGTTT

GGAGGGTCCAACATTTCAGTGCTTTTTGAGTTTCTCATTTTTATAAAAAGTTATCTCATAAGGGAGTCAGTCTTCACGTTGGGGCTTTCCCAGGGAAACT

GTCATCACTGGTAACAAACTGTAACTTTAAAGGGCATGTTGTTGCTGTTATTGTTTTGCCTTTTTTTTTTTTTTAATATAAGTGTGCTTGGGAACTCCTT

ACATTTTATGCAATAAACTATTTTTGGTAAA
Translation
 - UNI30147 - MDGASAKQDGLWESKSSSDVSSCPEASLEIVGSLARLPDQQDTAQD DASVEVNRGFKEEGSPDRSSQVAICQNGQIPDLQLSLDP

TTSPVGPDASTG GSTASSLPLEKEEQVRLQARKRLEEQLMQYRVKRHRER SSQPATKMKLFSTLDPELMLNPENLPRASTVAVTKEYSFLRTSVPRGP

KVGSLGLLAHSKEKKNSKSSKIRSLADYRTEDPSDSGGLGSTADAVGSSLKQSRSSTSVVSEVSPSSETDNRVESASMTGDSVSEADGNESDSSSHSSLS

ARGACGVLGNVGMPGTAYMVDGQEISAEALGQFPSIKDVLQAAAAQHQDQNQEANGEVRSRRDSICSS SVSMESSLAEPQDELLQILKDKRRLEGQVEA

LSLEASQ ALQEKAELQAQLAALSTRLQAQVEHSHSSQQKQDSLSSEVDTLKQSCWDLERAMTDLQSMLEAKNASLASSNNDLQVAEEQYQRLMAKVEDM

QRNILSKDNTV VHDLRQQMTALQSQLQQVQLERTTLTSKLQASQAEITSLQHARQWYQQQLTLAQEARVRLQGEMAHIQ - UNI1815 - VGQMTQA

GLLEHLKLENVSLSHQLTETQHRSIKEKERIAVQLQSIE - UNI7134 - ADMLDQEAAFVQIREAKTMVEEDLQRRLEEFEGEREQLQKVADAAASL

EQQLEQ - UNI36560 - VKLTLFQRDQQLAALQQEHLDVIKQLTSTQEALQAKGQSLDDLHTRYDELQARLEELQREADSREDAIHFLQNEKIVLEV

ALQSAKSDKEELDRGARRLEEDTEETSGLLEQLRQDLAVKSNQ VEHLQQETATLRKQMQKVKEQFVQQK VMVEAYRRDATSKDQLINELKATKKRLDS

EMKELRQELIKLQGEKKTVEVEHSRLQKDMSLVHQQMAELEGHLQSVQKERDEMEIHLQ SLKFDKEQMIALTEANETLKKQIEELQQEAKK KAITEQK

QKMKRLGSDLSSAQKEMKTKHKAYENAVSILSRRLQEALASKEATDAELNQLRAQSTGGSSDPVLH EKIRALEVELQNVGQSKILLEKELQEVITMTSQ

ELEESREKVLELEDE LQESRGFRRKIKRLEESNKKLALELEHERGKLTGLGQSNAALREHNSILETALAKREADLVQLNLQ VQAVLQRKEEEDRQMKQ

LVQALQVSLEKEKMEVNSLKEQ MAAARIEAGHNRRHFKAATLELSEVKKELQAKEHLVQTLQAEVDELQ - UNI35641 - QIQDGKHSQEIAQFQT

ELAEARTQLQLLQKKLDEQMSQQPTGSQE MEDLKWELDQKEREIQSLKQQLDLTEQQGKKELEGTQQTLQ TIKSELEMVQEDLSETQKDKFMLQAKVS

ELKNNMKTLLQQNQQLKLDLRRGAAK KKEPKGESNSSSPATPIKIPDCPVPASLLEELLRPPPAVSKEPLKNLNNCLQQLK - UNI34798 - KQEM

DSLQRQMEEHTITVHESLSSWAQVEAAPAEHAHPRGDTKLHNQNSVPRDGLGQ
Transcript ENSMUST00000031477
Sequence
AAAATTTTAAGTCCACTTTCTGAAGGATATCTCAATCTGTCCGGAGATCCATACCAACCCCAATTTGAAAGTGGCTACTGGCCGCTGAGGGCAGCCTCTC

TTCCGGAACGAAGACCTCGCGGACCGTTTGTTTCCGGGGGGTTGCCCGAGACTGGTACCCTGTTGCGCCCCGCCCCTTGCACAGCCACGTCCTACCGGAG

CCGCAGGGTTGGGCCGGAACCG - UNI30147 - GAATCATGGTTGCTTGGTTTGACTTCAAGCCATTTATGAGACATTAAACCTGAAAATGGAAAAC

AGAGTAAGATCCTCCTTAGAAGCTCTGAGCTGTTGCTAATGGCAAAAAACAAACTTAATCCAGAGTTACTTGTAGCTCCTCAGAGTCTTCTTAGTCTGGG

CTGCCCTGACCATGGATGGAGCATCAGCCAAACAGGATGGCCTCTGGGAAAGCAAGTCCAGCAGTGATGTTTCATCTTGCCCTGAAGCCTCGCTGGAGAT

TGTGGGCTCTCTGGCCCGACTGCCTGATCAACAGGATACAGCTCAGG ATGCCAGTGTTGAGGTAAACAGAGGTTTTAAGGAAGAAGGAAGCCCAGATAG

ATCCAGCCAGGTGGCCATCTGTCAGAATGGGCAGATCCCAGACCTTCAGTTGTCCCTTGATCCCACAACAAGCCCAGTGGGACCTGATGCCTCTACAGGT

GTGGATGGTTTCCATGACAACCTAAGGAACTCTCAGGGAACTAGTGCTGAGGGCAGTGTTAGAAAAGAAGCTTTGCAGTCCCTCAGACTCAGTCTTCCCA

TGCAAGAAACGCAACTGT GCTCCACTGCATCTTCATTGCCTTTGGAAAAGGAGGAGCAGGTTCGACTGCAGGCCCGGAAGCGCCTGGAAGAGCAGCTGA

TGCAGTACCGAGTTAAGCGCCATCGGGAAAGG TCCAGTCAACCTGCAACTAAAATGAAACTTTTTAGTACACTTGATCCTGAGCTCATGTTAAATCCAG

AAAATTTGCCAAGGGCCAGTACTGTAGCTGTGACAAAAGAATATTCCTTCCTGCGTACCAGTGTTCCTCGAGGGCCCAAGGTAGGCAGCTTAGGGCTGCT

GGCACATTCTAAAGAGAAAAAGAACTCCAAATCAAGCAAGATTCGGTCTCTGGCTGACTATAGAACTGAAGATCCAAGTGACTCTGGTGGCCTTGGTTCT

ACTGCTGATGCTGTTGGAAGTTCCCTGAAACAAAGTAGAAGTAGCACTTCAGTTGTGTCTGAGGTTAGCCCATCATCTGAGACTGATAACCGTGTAGAGA

GTGCCTCCATGACTGGGGATAGTGTGTCAGAGGCTGATGGAAATGAGAGTGACAGTTCCTCACACAGCAGCCTCTCTGCCCGAGGGGCCTGTGGTGTCCT

GGGGAACGTGGGCATGCCAGGAACAGCTTACATGGTTGATGGCCAGGAGATTTCTGCTGAGGCCCTGGGCCAGTTTCCTTCAATTAAAGACGTACTACAG

GCTGCAGCAGCCCAGCACCAAGATCAGAACCAGGAAGCCAACGGAGAGGTGCGGAGCCGTAGAGACAGCATCTGCAGCAG TGTGTCCATGGAGAGCTCC

TTGGCTGAACCACAGGATGAATTGTTGCAGATTCTTAAAGATAAAAGGAGGCTTGAAGGACAGGTGGAGGCTTTGTCATTAGAAGCCAGTCAG GCACTT

CAAGAGAAGGCTGAGCTACAGGCCCAGCTTGCTGCCCTGAGCACAAGGCTACAGGCACAGGTGGAACACAGCCACAGCAGCCAGCAGAAGCAAGACTCCC

TTAGTTCTGAAGTGGACACTTTGAAGCAGTCTTGCTGGGATCTAGAGCGGGCCATGACTGACCTGCAGAGCATGCTAGAAGCTAAAAATGCCAGCCTGGC

ATCCTCAAACAATGACCTACAAGTGGCAGAGGAGCAGTATCAGAGACTGATGGCCAAAGTGGAGGACATGCAGAGAAACATCCTCAGCAAGGACAACACA

G TGCATGACCTGCGGCAGCAGATGACAGCGCTACAGAGCCAGCTCCAGCAAGTACAGCTGGAGCGCACAACCCTGACCAGCAAACTACAAGCATCACAG

GCTGAGATCACGTCTCTGCAGCATGCCCGGCAATGGTACCAACAGCAGCTTACTTTGGCCCAGGAGGCCAGGGTCAGGCTGCAAGGAGAGATGGCCCATA

TCCAG - UNI1815 - GTTGGACAAATGACCCAGGCAGGCCTTTTGGAGCACCTGAAGCTTGAGAATGTGTCCCTATCGCATCAGCTGACAGAAACTC

AGCATCGATCCATCAAGGAGAAAGAGCGCATAGCTGTTCAGCTCCAGAGCATTGAG - UNI7134 - GCTGACATGTTAGATCAGGAGGCAGCATTTG

TACAGATTCGGGAGGCGAAGACAATGGTGGAGGAGGACCTCCAAAGGAGGCTGGAAGAATTTGAAGGTGAACGGGAGCAGTTACAGAAAGTGGCAGATGC

AGCAGCATCCCTGGAGCAACAGTTGGAACAG - UNI36560 - GTGAAGCTGACATTGTTCCAGCGAGATCAGCAGCTTGCAGCACTTCAGCAGGAGC

ACCTAGATGTGATAAAGCAGCTTACGTCGACGCAGGAGGCTCTGCAGGCCAAAGGGCAGTCTCTTGATGACCTGCATACACGTTACGATGAGCTACAAGC

AAGGCTGGAGGAGCTGCAGAGAGAGGCCGACTCCAGGGAGGATGCAATTCACTTCTTGCAGAATGAGAAGATTGTCTTGGAAGTGGCTCTACAATCGGCC

AAGAGTGACAAGGAGGAACTTGACAGAGGAGCACGGCGTTTGGAAGAAGATACTGAGGAGACATCAGGACTTTTGGAACAATTGAGACAAGATTTGGCTG

TCAAGTCCAACCAG GTGGAGCACTTGCAGCAGGAGACAGCCACGTTGAGAAAACAGATGCAGAAAGTAAAGGAGCAGTTTGTTCAGCAAAAG GTGATG

GTAGAGGCATACCGGCGAGATGCTACTTCCAAAGATCAACTCATCAATGAACTGAAAGCCACCAAAAAACGGCTGGACTCTGAGATGAAGGAACTGAGGC

AAGAGCTAATCAAGCTGCAGGGAGAGAAGAAGACTGTGGAAGTAGAGCACTCACGACTGCAGAAGGACATGTCCCTGGTTCACCAGCAGATGGCAGAGCT

TGAGGGGCATCTTCAGTCAGTGCAGAAAGAACGAGATGAAATGGAGATTCACCTGCAG TCTTTGAAGTTTGACAAAGAGCAGATGATAGCCCTTACCGA

GGCCAATGAGACACTGAAGAAACAAATAGAAGAGCTGCAACAAGAGGCCAAGAA GGCCATCACAGAACAGAAGCAGAAGATGAAGAGGCTGGGCTCAGA

TCTGTCCAGCGCCCAGAAGGAGATGAAGACTAAGCACAAAGCTTATGAGAATGCTGTGAGCATTCTCAGCCGTCGCCTGCAGGAGGCTCTGGCTTCTAAG

GAGGCTACAGATGCAGAGCTGAACCAGCTCAGAGCTCAGAGCACAGGTGGCAGCAGTGACCCTGTCCTACAT GAGAAGATTCGTGCTCTGGAGGTGGAA

CTGCAGAATGTTGGCCAAAGCAAGATACTACTGGAGAAGGAGTTACAGGAGGTGATCACAATGACTAGCCAGGAGCTGGAAGAGTCCCGGGAGAAGGTGC

TGGAGCTAGAAGATGAG CTTCAAGAATCCAGAGGCTTCAGAAGGAAGATAAAACGTCTTGAAGAGTCAAATAAGAAACTAGCTCTGGAGTTAGAGCATG

AGCGAGGGAAGCTCACTGGCCTTGGACAATCTAATGCAGCGCTGCGGGAGCACAACAGCATTCTGGAGACTGCACTAGCCAAGAGGGAAGCTGACCTGGT

ACAGCTGAATCTGCAG GTGCAGGCAGTTTTACAGCGCAAAGAGGAGGAGGATCGCCAGATGAAGCAACTTGTCCAAGCCTTACAAGTCTCACTAGAGAA

AGAAAAGATGGAAGTGAACAGCCTGAAGGAACAG ATGGCTGCTGCCAGGATAGAAGCTGGGCACAACCGCCGCCACTTTAAGGCAGCTACTTTGGAGCT

GAGTGAGGTGAAGAAAGAATTGCAGGCCAAAGAACACCTGGTACAGACATTGCAGGCCGAGGTGGATGAGCTCCA - UNI35641 - GATTCAGGATG

GAAAGCATTCTCAAGAAATAGCACAATTCCAGACTGAGCTGGCAGAAGCTAGAACCCAGCTCCAGCTCCTACAGAAGAAGCTAGATGAGCAGATGAGCCA

GCAACCGACAGGGAGCCAAGAG ATGGAAGATCTCAAATGGGAATTGGATCAGAAAGAACGAGAGATTCAGTCCCTGAAGCAGCAGCTTGACTTGACAGA

GCAACAGGGCAAGAAAGAACTGGAGGGGACACAGCAGACACTTCAG ACCATCAAGTCTGAGTTGGAAATGGTACAAGAAGATCTGTCTGAGACGCAGAA

GGATAAGTTTATGCTTCAAGCCAAAGTGTCTGAACTGAAGAACAACATGAAGACTCTGCTGCAGCAGAACCAACAGCTCAAGCTGGATCTCCGCCGCGGT

GCAGCCAAG AAGAAAGAGCCAAAAGGTGAGTCCAACTCATCCAGTCCTGCAACACCCATCAAGATACCAGATTGCCCTGTCCCAGCCTCATTGCTAGAG

GAGCTGCTGAGGCCCCCACCCGCTGTGAGCAAGGAACCCCTCAAGAATCTCAACAACTGTTTGCAGCAGCTCAA - UNI34798 - GCAGGAAATGGA

CAGTCTCCAGCGCCAGATGGAGGAGCATACCATCACTGTGCATGAGTCCCTGTCCTCGTGGGCTCAGGTGGAAGCTGCCCCAGCAGAGCATGCCCATCCC

CGGGGAGACACAAAACTGCATAATCAAAACAGTGTTCCCAGAGACGGGCTGGGCCAATGACCACTGTTGTCCTCATCACACAAGTATTTGTGACTGTTGA

AGGAATTCTCTTGTCAATATTATTTATTTGATCG
Translation
 - UNI30147 - MDGASAKQDGLWESKSSSDVSSCPEASLEIVGSLARLPDQQDTAQD DASVEVNRGFKEEGSPDRSSQVAICQNGQIPDLQLSLDP

TTSPVGPDASTGVDGFHDNLRNSQGTSAEGSVRKEALQSLRLSLPMQETQLC CSTASSLPLEKEEQVRLQARKRLEEQLMQYRVKRHRER SSQPATKM

KLFSTLDPELMLNPENLPRASTVAVTKEYSFLRTSVPRGPKVGSLGLLAHSKEKKNSKSSKIRSLADYRTEDPSDSGGLGSTADAVGSSLKQSRSSTSVV

SEVSPSSETDNRVESASMTGDSVSEADGNESDSSSHSSLSARGACGVLGNVGMPGTAYMVDGQEISAEALGQFPSIKDVLQAAAAQHQDQNQEANGEVRS

RRDSICSS SVSMESSLAEPQDELLQILKDKRRLEGQVEALSLEASQ ALQEKAELQAQLAALSTRLQAQVEHSHSSQQKQDSLSSEVDTLKQSCWDLER

AMTDLQSMLEAKNASLASSNNDLQVAEEQYQRLMAKVEDMQRNILSKDNTV VHDLRQQMTALQSQLQQVQLERTTLTSKLQASQAEITSLQHARQWYQQ

QLTLAQEARVRLQGEMAHIQ - UNI1815 - VGQMTQAGLLEHLKLENVSLSHQLTETQHRSIKEKERIAVQLQSIE - UNI7134 - ADMLDQEA

AFVQIREAKTMVEEDLQRRLEEFEGEREQLQKVADAAASLEQQLEQ - UNI36560 - VKLTLFQRDQQLAALQQEHLDVIKQLTSTQEALQAKGQSL

DDLHTRYDELQARLEELQREADSREDAIHFLQNEKIVLEVALQSAKSDKEELDRGARRLEEDTEETSGLLEQLRQDLAVKSNQ VEHLQQETATLRKQMQ

KVKEQFVQQK VMVEAYRRDATSKDQLINELKATKKRLDSEMKELRQELIKLQGEKKTVEVEHSRLQKDMSLVHQQMAELEGHLQSVQKERDEMEIHLQ 

SLKFDKEQMIALTEANETLKKQIEELQQEAKK KAITEQKQKMKRLGSDLSSAQKEMKTKHKAYENAVSILSRRLQEALASKEATDAELNQLRAQSTGGS

SDPVLH EKIRALEVELQNVGQSKILLEKELQEVITMTSQELEESREKVLELEDE LQESRGFRRKIKRLEESNKKLALELEHERGKLTGLGQSNAALRE

HNSILETALAKREADLVQLNLQ VQAVLQRKEEEDRQMKQLVQALQVSLEKEKMEVNSLKEQ MAAARIEAGHNRRHFKAATLELSEVKKELQAKEHLVQ

TLQAEVDELQ - UNI35641 - QIQDGKHSQEIAQFQTELAEARTQLQLLQKKLDEQMSQQPTGSQE MEDLKWELDQKEREIQSLKQQLDLTEQQGK

KELEGTQQTLQ TIKSELEMVQEDLSETQKDKFMLQAKVSELKNNMKTLLQQNQQLKLDLRRGAAK KKEPKGESNSSSPATPIKIPDCPVPASLLEELL

RPPPAVSKEPLKNLNNCLQQLK - UNI34798 - KQEMDSLQRQMEEHTITVHESLSSWAQVEAAPAEHAHPRGDTKLHNQNSVPRDGLGQ

For any suggestions or comments, please send an email to unitrap@crg.es