Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000029512 (Ulk1)
Chromosomal location
Chr 5: 111213507 - 111239116 (-)
Description
Unc-51 like kinase 1 (C. elegans) Gene [Source:MGI Symbol;Acc:MGI:1270126]
RefSeq_dna
NM_009469 
RefSeq_peptide
NP_033495.2 
UniGene
Mm.271898 
MGI
MGI:1270126 
Uniprot/SWISSPROT
O70405 
Uniprot/SPTREMBL
Q3U0V5 Q3U350 Q80TT3 Q8K0Q7 Q3UFT4 Q6PB82 
Human Ortholog
ENSG00000177169 (ULK1)
Omim not available
UniTrap UNI6681
Vector Insertion
Chr 5: 111238066 - 111238145
Public Clones BGC187 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2404
Vector Insertion
Chr 5: 111228176 - 111238023
Public Clones (sanger) AC0566 (sanger) XT0270 (sanger) D056G04 (ggtc) D052E02 (ggtc)
IST11825E7 (tigm) IST14459D12 (tigm) IST10227E10HMF1 (tigm) IST12461B10 (tigm)
IST12228H8 (tigm) IST11630F9 (tigm) IST11764H3 (tigm) IST11728B12 (tigm)
IST12277A7 (tigm) IST10227E10 (tigm) IST11695D3 (tigm) IST12416D6 (tigm)
IST14872B9 (tigm) IST12777F1 (tigm) IST14771G5 (tigm)
Private Clones OST181589 (lexicon) OST68170 (lexicon)
Severity of mutation (?) Insertion after 8% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5220
Vector Insertion
Chr 5: 111225520 - 111227900
Public Clones YTC051 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 10% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37485
Vector Insertion
Chr 5: 111221415 - 111222133
Public Clones PST18943-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 35% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8599
Vector Insertion
Chr 5: 111220217 - 111220619
Public Clones XF002 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 44% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000031490
Sequence
GCCGGCACCTCGGGCTCCGAGGCCCGGGTGCCGCGGATCTTTTGTTTCCCTGCGGGGCTCCGAGCCGCATCGTCAGTCAGGCCCGGACTTGGAGCTGGAG

TGTGTCAGAGCTGAGTCCCGAGTCGGACCGGGTCCCGACTGTCAGCGCCGGGAGGGTACCGAGGAGGACGCCGAGGGAGCGCGCCCCTCCGTCCGCCGGC

CTGTGGGACTGGGACCCGGCTCAGGCCTGCCCGATGGGGCACGGGGCCCTGGCGATGAGCCCGCGCCTCCGTCCCCGCGTACGCGGCCCGCCGGCCTCCG

CCTGAGCCCAGCGCACCCCGTAGCGCCGCCCCGGGGCCCGAGCCCGGGCTCGCGCCCCCGGCCCGCGCGCGCTATGGAGCCGGGCCGCGGCGGCGTCGAG

ACCGTGGGCAAGTTCGAGTTCTCTCGCAAGGACCTGATTGGACACGGCGCCTTCGCGGTGGTCTTCAAGGGTCGACACCGCGAG AAGCACGACCTGGAG

GTGGCCGTCAAATGCATTAACAAGAAGAACCTTGCCAAGTCCCAAACACTGCTGGGAAAGGAAATCAAAATCCTGAAG - UNI6681 - GAACTAAAG

CACGAAAACATCGTGGCGCTGTATGACTTCCAG - UNI2404 - GAAATGGCTAATTCTGTCTACCTGGTCATGGAG TATTGTAATGGTGGAGACCT

GGCTGACTACCTGCACA - UNI5220 - CTATGCGCACACTGAGTGAAGACACTGTCAGGCTTTTCCTACAGCAGATCGCTGGCGCCATGCGGCTGCT

GCACAGCAAGGGCATCATCCACCGGGACCTGAAGCCCCAAAACATCCTGCTGTCCAACCCTGGGGGCCGCCGGGCCAACCCCAGCAACATCCGAGTCAAG

ATTG CTGACTTTGGATTCGCTCGGTACCTCCAGAGCAACATGATGGCGGCCACACTCTGTGGTTCTCCTATGTACATG GCTCCTGAGGTCATTATGTC

CCAGCACTACGATGGAAAGGCTGACCTGTGGAGCATTGGCACCATTGTCTACCAGTGTCTGACAGGGAAGGCCCCTTTTCAG GCCAGCAGCCCTCAGGA

TTTGCGCCTGTTTTATGAGAAGAACAAGACACTAGTTCCTGC CATCCCCCGGGAGACATCAGCTCCCCTGCGGCAGCTGCTCCTGGCTCTGTTGCAGCG

GAACCACAAGGACCGCATGGACTTTG ATGAATTTTTCCACCACCCTTTCTTGGATGCCAGCACCCCCATCAAGAAAT CCCCACCTGTGCCTGTGCCCT

CATATCCAAGCTCAGGGTCTGGCAGCAGCTCCAGCAGCAGCTCTGCCTCCCACCTGGCCTCTCCACCG TCCCTGGGGGAGATGCCACAGCTACAGAAGA

CCCTTACCTCCCCAGCCGATGCTGCTGGCTTTCTTCAGGGCTCCCGGGACTCTGGTGGCAGCAGCAAAGACTCCTGTGACACAGATGACTTTGTCATGGT

CCCAGCCCAGTTTCCAG GTGATCTAGTTGCTGAGGCAGCCAGTGCCAAGCCCCCACCTGATAGCCTGCTGTGTAGTGG GAGCTCATTGGTGGCCTCTG

CTGGCCTAGAGAGCCACGGCCGTACCCCCTCTCCCTCTCCGACCTGCAGCAGCTCTCCCAGCCCCTCTGG CCGGCCTGGCCCCTTCTCCAGCAACAGGT

ACGGTGCCTCGGTCCCCATTCCTGTCCCCACTCAGGTGCACAATTACCAGCGCATCGAGCAAAACCTGCAATCGCCCACTCAACAGCAGACAGCCAG - 

UNI8599 - GTCCTCTGCCATCCGAAGGTCAGGGAGCACCAGCCCCCTGGGCTTTGGCCGGGCCAGCCCATCACCCCCCTCCCACACCGATGGAGCCAT

GCTGGCCAGGAAGCTGTCACTTGGAGGTGGCCGTCCCTACACACCTTCTCCCCAAG TGGGAACCATCCCAGAGCGACCCAGCTGGAGCAGAGTGCCCTC

CCCACAAGGAGCTGATGTGCGGGTTGGCAGGTCACCACGACCCG GTTCCTCTGTGCCTGAGCACTCTCCAAGAACCACTGGGCTGGGCTGCCGCCTGCA

CAGTGCCCCTAACCTGTCCGACTTCCATGTTGTGCGTCCCAAGCTGCCTAAGCCCCCAACAGACCCACTGGGAGCCACCTTTAGCCCACCCCAGACCAGC

GCACCCCAGCCATGCCCAGGGCTACAGTCTTGCCGGCCACTGCGTGGCTCACCTAAGCTGCCTGACTTCCTACAGCGGAGTCCCCTACCCCCCATCCTAG

GCTCTCCTACCAAG GCCGGGCCCTCCTTTGACTTCCCCAAAACCCCCAGCTCTCAGAATTTGCTGACCCTGTTGGCTAGGCAGGGGGTAGTAATGACAC

CACCTCGGAACCGTACACTGCCTGACCTCTCCGAGGCCAGTCCTTTCCATGGCCAGCAGCTGGGCTCTGGCCTTCGGCCCGCTGAAGACACCCGGGGTCC

CTTTGGACG GTCCTTCAGCACCAGCCGCATTACGGACCTGCTGCTTAAGGCTGCATTTGGGACTCAGGCCTCTGACTCAGGCAGCACAGACAGCCTACA

GGAGAAACCTATGGAGATTG CTCCCTCTGCTGGCTTTGGAGGGACTCTGCATCCAGGAGCTCGTGGTGGAGGGGCCAGCAGCCCAGCACCTGTGGTATT

TACTGTAGGCTCCCCACCCAGTGGTGCCACCCCACCCCAGAGTACCCGTACCAGAATGTTCTCAG TGGGCTCTTCCAGCTCCCTGGGCTCTACTGGCTC

CTCCTCTGCCCGCCACTTAGTGCCTGGGGCCTGTGGAGAGGCCCCGGAGCTTTCTGCCCCAGGCCACTGCTGTAGCCTTGCTGACCCCCTTGCTGCCAAC

TTGGAGGGGGCTGTGACCTTCGAGGCTCCTGACCTCCCAGAGGAGACCCTCATGGAG CAAGAGCACACGGAAACCCTACACAGTCTGCGCTTCACACTA

GCGTTTGCACAGCAAGTTCTGGAGATTGCAGCCCTGAAGGGAAGTGCCAGTGAGGCCGCCGGTGGCCCTGAGTACCAGCTCCAGGAAAGTGTGGTGGCTG

ACCAGATCAGTCAGTTGAGCCGAGAGTGGGG CTTTGCAGAGCAACTGGTTCTGTACTTGAAGGTGGCTGAGCTGCTGTCCTCAGGCCTACAGACTGCCA

TTGACCAGATTCGAGCTGGCAAACTCTGCCTTTCATCTACTGTGAAGCAGG TGGTACGCAGACTAAATGAGCTGTACAAGGCCAGCGTGGTATCCTGCC

AGGGCCTCAGCTTGCGACTTCAGCGCTTCTTTCTGGACAAACAACGGCTGCTGGACGGGATCCATGGTGTCACTGCAGAGCGGCTCATCCTCAGCCATGC

TGTGCAAATG GTACAATCAGCTGCCCTTGATGAGATGTTCCAGCACCGAGAGGGCTGTGTACCGAGATATCACAAAGCCCTGCTATTGCTGGAGGGGTT

GCAGCACACTCTCACGGACCAGGCAGACATTGAGAACATTGCCAAAT GCAAGCTGTGCATTGAGAGGAGACTCTCGGCCCTGCTGAGTGGTGTCTATGC

CTGACTACCTGCTGCCAACCTGCAGGGTAGGGTCTGAGACCTGGCAGACTGTCCTCAACACTGATCAGATCCGATGGTGCTGAGACTGCTGCCAGCCAAC

TCCAGCAGGGATGCTCCACAGTGGACCTGTGCAGACTGGTGCAACTCTTGCTTCCTAGACTGCCAGTCTCTGCTGGCAGGTAGACATCAGAGTGCCAGGG

GTCCCTTGCCCACTGGGACAGGAGTTTCTGAACATATTCTTCCTAGCTGGCTCCCTGGCAAGCAGGTATGGTGCCGAGAAGTGGCACCTGCCACCTGAAG

AGCCCATGGCAGCCCTGTGTCAGGCAAGGGCCTGAGACCGTTGCTGACTCCAAGCCAAAGCAAGCTTTTCCTCACAGTTCACTTGCCCCATTGCTTGTCC

AAGAAAAAAGGGTATGGTCTTCTGGCCCCCTGTTCTCTCTAGGAACTTCTCCCTCTGAGACTACTTACCCAGCTTTGTAAGTCACCGGAGCACTTTATGC

ATACAGAGACTGGAGAACCTAGCCAGCAGTGCAGACTGCTGGGAACCTGCCTCCTGTTCCTGGCTTTCGTCCTCCAAGACGCTGTATAGATGCAGACCAC

ATCTTTGTGTATAAAAAGCCCAGTGTTCACCTCCTCCTGTGTCTGGTCTTTGGAGGAAAGCAACAGGCTTGCCTCCTGAGGGAGAGATAGTCCTCACGTT

TAAATGTTCATTAGGGACAGACAGTTCATTGTGTGAAGCACCACCCATGCTTGTTAAAACTCCTCAACTTCCACACTTTACTCCTAAGATGTGTCTCCAC

CCTCCCAACTCAGTTTTTGTTCATAAAAGGAAACTTCAGATGTTTAAGGATTGAAAGGGCGGAGGCAGGGCAGGCCAGGTATCACACTGGATGTTGTCCT

TGTAGGAGACGGTGCCCGCTGTGTGGCTGAGGCTGTAGCATGTGCCAGAGCGAGTGTGCTGCTGGCTATCTCTATTAACTTTCCCTGGAAGGGCGGCAGA

AAAGGCAGTGCCCAGGTGCCGTCCTCCCTGTGCAGTGGAGGTGTGGGTGAAGAATAACATATGCAAACATGTCCCCTGTGGAGCTTTCCTGTCAGTCTGG

CTCCTGTGCTTGGTGGCCTTCAGGATCTGTGCTGAAGCTCGTCTTCCAGGCTCCAGGGTGGACACATGCTAATACCTTCCCAGCCTCCCTGACCTGCCAG

TCCTTTGTCACGGCTCTGTTCATGCATACTTGAAAGTATCTGAGTGTCCACAAGCTGATGTGGGGTTTCAGAGTTATAGGCCACACACACACACACACAC

ACACGTTTTTCTTTGCAATACTTGAAATATTGCCACTGTGCTTGGTTGTACAAGAGTTGTACAAGAAAGCAGATCTCTAAGACCAGTCTCTTCCTTAGTC

ACCCTATGACCTCCCTTGCATGTAACATGTTGTATTTATTGCTTTGTGGCCAACTGGAACCCAGAGCCACCAGGGAGGCTAGTGCAGGGATTCCTGACCC

ACCACCTGGTTCCTGAAAGGCTCCTGGGTGGCTGTGTGTGTGTGTGGCTGGCTGTGTGTGGTATGAGCCAAACCTGCTCATGAAAGCAGTGCTCAGGCCT

GTCAATTTTAAGATGAATTTTGTGAGTCTCCCCCTTTTGTGTTTCACTGTGTCATATCAGTTTAAGAAAATAAAAATTGGAATTATTT
Translation
MEPGRGGVETVGKFEFSRKDLIGHGAFAVVFKGRHRE KHDLEVAVKCINKKNLAKSQTLLGKEIKILK - UNI6681 - ELKHENIVALYDFQ - U

NI2404 - EMANSVYLVME YCNGGDLADYLHT - UNI5220 - TMRTLSEDTVRLFLQQIAGAMRLLHSKGIIHRDLKPQNILLSNPGGRRANPSN

IRVKIA ADFGFARYLQSNMMAATLCGSPMYM APEVIMSQHYDGKADLWSIGTIVYQCLTGKAPFQ ASSPQDLRLFYEKNKTLVPA AIPRETSAPLR

QLLLALLQRNHKDRMDFD DEFFHHPFLDASTPIKKS SPPVPVPSYPSSGSGSSSSSSSASHLASPP SLGEMPQLQKTLTSPADAAGFLQGSRDSGGS

SKDSCDTDDFVMVPAQFPG GDLVAEAASAKPPPDSLLCSG GSSLVASAGLESHGRTPSPSPTCSSSPSPSG GRPGPFSSNRYGASVPIPVPTQVHNY

QRIEQNLQSPTQQQTAR - UNI8599 - RSSAIRRSGSTSPLGFGRASPSPPSHTDGAMLARKLSLGGGRPYTPSPQV VGTIPERPSWSRVPSPQGA

DVRVGRSPRPG GSSVPEHSPRTTGLGCRLHSAPNLSDFHVVRPKLPKPPTDPLGATFSPPQTSAPQPCPGLQSCRPLRGSPKLPDFLQRSPLPPILGSP

TK AGPSFDFPKTPSSQNLLTLLARQGVVMTPPRNRTLPDLSEASPFHGQQLGSGLRPAEDTRGPFGR RSFSTSRITDLLLKAAFGTQASDSGSTDSLQ

EKPMEIA APSAGFGGTLHPGARGGGASSPAPVVFTVGSPPSGATPPQSTRTRMFSV VGSSSSLGSTGSSSARHLVPGACGEAPELSAPGHCCSLADPL

AANLEGAVTFEAPDLPEETLME QEHTETLHSLRFTLAFAQQVLEIAALKGSASEAAGGPEYQLQESVVADQISQLSREWG GFAEQLVLYLKVAELLSS

GLQTAIDQIRAGKLCLSSTVKQV VVRRLNELYKASVVSCQGLSLRLQRFFLDKQRLLDGIHGVTAERLILSHAVQM VQSAALDEMFQHREGCVPRYHK

ALLLLEGLQHTLTDQADIENIAKC CKLCIERRLSALLSGVYA
Transcript ENSMUST00000112410
Sequence
GCCGGCACCTCGGGCTCCGAGGCCCGGGTGCCGCGGATCTTTTGTTTCCCTGCGGGGCTCCGAGCCGCATCGTCAGTCAGGCCCGGACTTGGAGCTGGAG

TGTGTCAGAGCTGAGTCCCGAGTCGGACCGGGTCCCGACTGTCAGCGCCGGGAGGGTACCGAGGAGGACGCCGAGGGAGCGCGCCCCTCCGTCCGCCGGC

CTGTGGGACTGGGACCCGGCTCAGGCCTGCCCGATGGGGCACGGGGCCCTGGCGATGAGCCCGCGCCTCCGTCCCCGCGTACGCGGCCCGCCGGCCTCCG

CCTGAGCCCAGCGCACCCCGTAGCGCCGCCCCGGGGCCCGAGCCCGGGCTCGCGCCCCCGGCCCGCGCGCGCTATGGAGCCGGGCCGCGGCGGCGTCGAG

ACCGTGGGCAAGTTCGAGTTCTCTCGCAAGGACCTGATTGGACACGGCGCCTTCGCGGTGGTCTTCAAGGGTCGACACCGCGAG AAGCACGACCTGGAG

GTGGCCGTCAAATGCATTAACAAGAAGAACCTTGCCAAGTCCCAAACACTGCTGGGAAAGGAAATCAAAATCCTGAAG - UNI6681 - GAACTAAAG

CACGAAAACATCGTGGCGCTGTATGACTTCCAG - UNI2404 - GAAATGGCTAATTCTGTCTACCTGGTCATGGAG TATTGTAATGGTGGAGACCT

GGCTGACTACCTGCACA - UNI5220 - CTATGCGCACACTGAGTGAAGACACTGTCAGGCTTTTCCTACAGCAGATCGCTGGCGCCATGCGGCTGCT

GCACAGCAAGGGCATCATCCACCGGGACCTGAAGCCCCAAAACATCCTGCTGTCCAACCCTGGGGGCCGCCGGGCCAACCCCAGCAACATCCGAGTCAAG

ATTG CTGACTTTGGATTCGCTCGGTACCTCCAGAGCAACATGATGGCGGCCACACTCTGTGGTTCTCCTATGTACATG GCTCCTGAGGTCATTATGTC

CCAGCACTACGATGGAAAGGCTGACCTGTGGAGCATTGGCACCATTGTCTACCAGTGTCTGACAGGGAAGGCCCCTTTTCAG GCCAGCAGCCCTCAGGA

TTTGCGCCTGTTTTATGAGAAGAACAAGACACTAGTTCCTGC CATCCCCCGGGAGACATCAGCTCCCCTGCGGCAGCTGCTCCTGGCTCTGTTGCAGCG

GAACCACAAGGACCGCATGGACTTTG ATGAATTTTTCCACCACCCTTTCTTGGATGCCAGCACCCCCATCAAGAAAT CCCCACCTGTGCCTGTGCCCT

CATATCCAAGCTCAGGGTCTGGCAGCAGCTCCAGCAGCAGCTCTGCCTCCCACCTGGCCTCTCCACCG TCCCTGGGGGAGATGCCACAGCTACAGAAGA

CCCTTACCTCCCCAGCCGATGCTGCTGGCTTTCTTCAGGGCTCCCGGGACTCTGGTGGCAGCAGCAAAGACTCCTGTGACACAGATGACTTTGTCATGGT

CCCAGCCCAGTTTCCAG GTGATCTAGTTGCTGAGGCAGCCAGTGCCAAGCCCCCACCTGATAGCCTGCTGTGTAGTGG GAGCTCATTGGTGGCCTCTG

CTGGCCTAGAGAGCCACGGCCGTACCCCCTCTCCCTCTCCGACCTGCAGCAGCTCTCCCAGCCCCTCTGG CCGGCCTGGCCCCTTCTCCAGCAACAGGT

ACGGTGCCTCGGTCCCCATTCCTGTCCCCACTCAGGTGCACAATTACCAGCGCATCGAGCAAAACCTGCAATCGCCCACTCAACAGCAGACAGCCAG - 

UNI8599 - GTCCTCTGCCATCCGAAGGTCAGGGAGCACCAGCCCCCTGGGCTTTGGCCGGGCCAGCCCATCACCCCCCTCCCACACCGATGGAGCCAT

GCTGGCCAGGAAGCTGTCACTTGGAGGTGGCCGTCCCTACACACCTTCTCCCCAAG CCACCCTTTTCCTACCAGTGGGAACCATCCCAGAGCGACCCAG

CTGGAGCAGAGTGCCCTCCCCACAAGGAGCTGATGTGCGGGTTGGCAGGTCACCACGACCCG GTTCCTCTGTGCCTGAGCACTCTCCAAGAACCACTGG

GCTGGGCTGCCGCCTGCACAGTGCCCCTAACCTGTCCGACTTCCATGTTGTGCGTCCCAAGCTGCCTAAGCCCCCAACAGACCCACTGGGAGCCACCTTT

AGCCCACCCCAGACCAGCGCACCCCAGCCATGCCCAGGGCTACAGTCTTGCCGGCCACTGCGTGGCTCACCTAAGCTGCCTGACTTCCTACAGCGGAGTC

CCCTACCCCCCATCCTAGGCTCTCCTACCAAG GCCGGGCCCTCCTTTGACTTCCCCAAAACCCCCAGCTCTCAGAATTTGCTGACCCTGTTGGCTAGGC

AGGGGGTAGTAATGACACCACCTCGGAACCGTACACTGCCTGACCTCTCCGAGGCCAGTCCTTTCCATGGCCAGCAGCTGGGCTCTGGCCTTCGGCCCGC

TGAAGACACCCGGGGTCCCTTTGGACG GTCCTTCAGCACCAGCCGCATTACGGACCTGCTGCTTAAGGCTGCATTTGGGACTCAGGCCTCTGACTCAGG

CAGCACAGACAGCCTACAGGAGAAACCTATGGAGATTG CTCCCTCTGCTGGCTTTGGAGGGACTCTGCATCCAGGAGCTCGTGGTGGAGGGGCCAGCAG

CCCAGCACCTGTGGTATTTACTGTAGGCTCCCCACCCAGTGGTGCCACCCCACCCCAGAGTACCCGTACCAGAATGTTCTCAG TGGGCTCTTCCAGCTC

CCTGGGCTCTACTGGCTCCTCCTCTGCCCGCCACTTAGTGCCTGGGGCCTGTGGAGAGGCCCCGGAGCTTTCTGCCCCAGGCCACTGCTGTAGCCTTGCT

GACCCCCTTGCTGCCAACTTGGAGGGGGCTGTGACCTTCGAGGCTCCTGACCTCCCAGAGGAGACCCTCATGGAG CAAGAGCACACGGAAACCCTACAC

AGTCTGCGCTTCACACTAGCGTTTGCACAGCAAGTTCTGGAGATTGCAGCCCTGAAGGGAAGTGCCAGTGAGGCCGCCGGTGGCCCTGAGTACCAGCTCC

AGGAAAGTGTGGTGGCTGACCAGATCAGTCAGTTGAGCCGAGAGTGGGG CTTTGCAGAGCAACTGGTTCTGTACTTGAAGGTGGCTGAGCTGCTGTCCT

CAGGCCTACAGACTGCCATTGACCAGATTCGAGCTGGCAAACTCTGCCTTTCATCTACTGTGAAGCAGG TGGTACGCAGACTAAATGAGCTGTACAAGG

CCAGCGTGGTATCCTGCCAGGGCCTCAGCTTGCGACTTCAGCGCTTCTTTCTGGACAAACAACGGCTGCTGGACGGGATCCATGGTGTCACTGCAGAGCG

GCTCATCCTCAGCCATGCTGTGCAAATG GTACAATCAGCTGCCCTTGATGAGATGTTCCAGCACCGAGAGGGCTGTGTACCGAGATATCACAAAGCCCT

GCTATTGCTGGAGGGGTTGCAGCACACTCTCACGGACCAGGCAGACATTGAGAACATTGCCAAAT GCAAGCTGTGCATTGAGAGGAGACTCTCGGCCCT

GCTGAGTGGTGTCTATGCCTGACTACCTGCTGCCAACCTGCAGGGTAGGGTCTGAGACCTGGCAGACTGTCCTCAACACTGATCAGATCCGATGGTGCTG

AGACTGCTGCCAGCCAACTCCAGCAGGGATGCTCCACAGTGGACCTGTGCAGACTGGTGCAACTCTTGCTTCCTAGACTGCCAGTCTCTGCTGGCAGGTA

GACATCAGAGTGCCAGGGGTCCCTTGCCCACTGGGACAGGAGTTTCTGAACATATTCTTCCTAGCTGGCTCCCTGGCAAGCAGGTATGGTGCCGAGAAGT

GGCACCTGCCACCTGAAGAGCCCATGGCAGCCCTGTGTCAGGCAAGGGCCTGAGACCGTTGCTGACTCCAAGCCAAAGCAAGCTTTTCCTCACAGTTCAC

TTGCCCCATTGCTTGTCCAAGAAAAAAGGGTATGGTCTTCTGGCCCCCTGTTCTCTCTAGGAACTTCTCCCTCTGAGACTACTTACCCAGCTTTGTAAGT

CACCGGAGCACTTTATGCATACAGAGACTGGAGAACCTAGCCAGCAGTGCAGACTGCTGGGAACCTGCCTCCTGTTCCTGGCTTTCGTCCTCCAAGACGC

TGTATAGATGCAGACCACATCTTTGTGTATAAAAAGCCCAGTGTTCACCTCCTCCTGTGTCTGGTCTTTGGAGGAAAGCAACAGGCTTGCCTCCTGAGGG

AGAGATAGTCCTCACGTTTAAATGTTCATTAGGGACAGACAGTTCATTGTGTGAAGCACCACCCATGCTTGTTAAAACTCCTCAACTTCCACACTTTACT

CCTAAGATGTGTCTCCACCCTCCCAACTCAGTTTTTGTTCATAAAAGGAAACTTCAGATGTTTAAGGATTGAAAGGGCGGAGGCAGGGCAGGCCAGGTAT

CACACTGGATGTTGTCCTTGTAGGAGACGGTGCCCGCTGTGTGGCTGAGGCTGTAGCATGTGCCAGAGCGAGTGTGCTGCTGGCTATCTCTATTAACTTT

CCCTGGAAGGGCGGCAGAAAAGGCAGTGCCCAGGTGCCGTCCTCCCTGTGCAGTGGAGGTGTGGGTGAAGAATAACATATGCAAACATGTCCCCTGTGGA

GCTTTCCTGTCAGTCTGGCTCCTGTGCTTGGTGGCCTTCAGGATCTGTGCTGAAGCTCGTCTTCCAGGCTCCAGGGTGGACACATGCTAATACCTTCCCA

GCCTCCCTGACCTGCCAGTCCTTTGTCACGGCTCTGTTCATGCATACTTGAAAGTATCTGAGTGTCCACAAGCTGATGTGGGGTTTCAGAGTTATAGGCC

ACACACACACACACACACACACGTTTTTCTTTGCAATACTTGAAATATTGCCACTGTGCTTGGTTGTACAAGAGTTGTACAAGAAAGCAGATCTCTAAGA

CCAGTCTCTTCCTTAGTCACCCTATGACCTCCCTTGCATGTAACATGTTGTATTTATTGCTTTGTGGCCAACTGGAACCCAGAGCCACCAGGGAGGCTAG

TGCAGGGATTCCTGACCCACCACCTGGTTCCTGAAAGGCTCCTGGGTGGCTGTGTGTGTGTGTGGCTGGCTGTGTGTGGTATGAGCCAAACCTGCTCATG

AAAGCAGTGCTCAGGCCTGTCAATTTTAAGATGAATTTTGTGAGTCTCCCCCTTTTGTGTTTCACTGTGTCATATCAGTTTAAGAAAATAAAAATTGGAA

TTATTT
Translation
MEPGRGGVETVGKFEFSRKDLIGHGAFAVVFKGRHRE KHDLEVAVKCINKKNLAKSQTLLGKEIKILK - UNI6681 - ELKHENIVALYDFQ - U

NI2404 - EMANSVYLVME YCNGGDLADYLHT - UNI5220 - TMRTLSEDTVRLFLQQIAGAMRLLHSKGIIHRDLKPQNILLSNPGGRRANPSN

IRVKIA ADFGFARYLQSNMMAATLCGSPMYM APEVIMSQHYDGKADLWSIGTIVYQCLTGKAPFQ ASSPQDLRLFYEKNKTLVPA AIPRETSAPLR

QLLLALLQRNHKDRMDFD DEFFHHPFLDASTPIKKS SPPVPVPSYPSSGSGSSSSSSSASHLASPP SLGEMPQLQKTLTSPADAAGFLQGSRDSGGS

SKDSCDTDDFVMVPAQFPG GDLVAEAASAKPPPDSLLCSG GSSLVASAGLESHGRTPSPSPTCSSSPSPSG GRPGPFSSNRYGASVPIPVPTQVHNY

QRIEQNLQSPTQQQTAR - UNI8599 - RSSAIRRSGSTSPLGFGRASPSPPSHTDGAMLARKLSLGGGRPYTPSPQA ATLFLPVGTIPERPSWSRV

PSPQGADVRVGRSPRPG GSSVPEHSPRTTGLGCRLHSAPNLSDFHVVRPKLPKPPTDPLGATFSPPQTSAPQPCPGLQSCRPLRGSPKLPDFLQRSPLP

PILGSPTK AGPSFDFPKTPSSQNLLTLLARQGVVMTPPRNRTLPDLSEASPFHGQQLGSGLRPAEDTRGPFGR RSFSTSRITDLLLKAAFGTQASDSG

STDSLQEKPMEIA APSAGFGGTLHPGARGGGASSPAPVVFTVGSPPSGATPPQSTRTRMFSV VGSSSSLGSTGSSSARHLVPGACGEAPELSAPGHCC

SLADPLAANLEGAVTFEAPDLPEETLME QEHTETLHSLRFTLAFAQQVLEIAALKGSASEAAGGPEYQLQESVVADQISQLSREWG GFAEQLVLYLKV

AELLSSGLQTAIDQIRAGKLCLSSTVKQV VVRRLNELYKASVVSCQGLSLRLQRFFLDKQRLLDGIHGVTAERLILSHAVQM VQSAALDEMFQHREGC

VPRYHKALLLLEGLQHTLTDQADIENIAKC CKLCIERRLSALLSGVYA

For any suggestions or comments, please send an email to unitrap@crg.es