Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000029528 (Pxn)
Chromosomal location
Chr 5: 115956721 - 116005988 (+)
Description
paxillin Gene [Source:MGI (curated);Acc:Pxn-001]
RefSeq_dna
NM_011223 NM_133915 
RefSeq_peptide
NP_035353.1 NP_598676.2 
UniGene
Mm.18714 
MGI
MGI:108295 
Uniprot/SWISSPROT
Q8VI36 
Uniprot/SPTREMBL
Q3UG90 Q99LE7 O88294 
Human Ortholog
not available
Omim not available
UniTrap UNI5902
Vector Insertion
Chr 5: 115956816 - 115956878
Public Clones YHD449 (baygenomics) CSD297 (baygenomics) HMA329 (baygenomics) A003A02 (ggtc)
(egtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30050
Vector Insertion
Chr 5: 115956878 - 115993083
Public Clones D138C03 (ggtc) D056C06 (ggtc) D117F02 (ggtc) D075A03 (ggtc) (ggtc)
D082G07 (ggtc) D062B12 (ggtc) IST12079E9 (tigm) IST11619C4 (tigm)
IST10072D5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14468
Vector Insertion
Chr 5: 115993097 - 115994351
Public Clones CMHD-GT_476D10-3 (cmhd) FHCRC-GT-S11-4G1 (fhcrc)
Private Clones not available
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18140
Vector Insertion
Chr 5: 115994579 - 115994889
Public Clones CMHD-GT_411F1-3 (cmhd)
Private Clones OST429389 (lexicon)
Severity of mutation (?) Insertion after 14% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37632
Vector Insertion
Chr 5: 115995006 - 115995380
Public Clones (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 21% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14767
Vector Insertion
Chr 5: 116002031 - 116002112
Public Clones PST15516-NL (escells)
Private Clones not available
Severity of mutation (?) Insertion after 60% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14766
Vector Insertion
Chr 5: 116002287 - 116002772
Public Clones PST15516-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 70% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000067268
Sequence
GGTGGTGGAGGAGGAGGCAGCGCGGCAGCGGGTTCCGTTCCGGGCCGAGGCTGGACGCGGAAAAGTTGCGGGGCGGCGAGGAGCAGCCCGGAGACGGGCA

GCGAGGGCGACATCGAGCCGGGGACTGGCGTCTGAGGACCAGCCATGGACGACCTCG - UNI5902 - - UNI14468 - - UNI30050 - ATGC

CCTGCTGGCAGACTTGGAATCTACCACCTCCCACATCTCCAAACGGCCAGTGTTCTTGTCAGAGGAGCCCCCCTACTCCTACCCAACTGGAAACCACACA

TACCAGGAGATTGCGGTGCCACCTCCGGTCCCACCACCACCGTCCAGCGAGGCCCTCAATGGCACGGTCCTGGACCCTTTAGATCAGTGGCAGCCTAGTG

GTTCCAGATACGCTCACCAGCAG - UNI18140 - CCTCCGTCCCCACTGCCCGTGTACAGCTCCAGTGCTAAAAATTCCAGTGCCTCCAACACCCAG

GACGGCGTGGGCTCCCTTTGTTCCCGAGCAGGCGAGGAAGAGCACGTCTACAG - UNI37632 - CTTCCCCAACAAGCAGAAGTCGGCAGAGCCCTC

ACCTACCGTCATGAGCTCCTCCCTGGGCAGCAACCTCTCTGAACTTGACCGGCTGTTACTGGAGCTGAACGCAGTGCAGCACAGCCCGCCTGGCTTCCCT

GCAG ATGAAGCCGAATCGAGCCCCCCCTTGCCTGGAGCCCTGAGCCCCCTTTATGGCATCCCAGAAAATAACACTCCCTTGGGGGGCAAAGCGGGGCCC

CTGGTGAAAGAGAAGCCAAAGCGAAATGGAGGCCGGGGGCTGGAGGATGTGCGGCCCAGCGTGGAGAGCCTCTTGGATGAACTGGAGAGTTCCGTGCCCA

GCCCTGT CCCGGCCATCACTGTGAACCAGGGAGAGATGAGCAGTCCGCAGCGAGTCACCTCCAGCCAGCAGCAGACCCGGATCTCGGCCTCCTCTGCCA

CCAGGGAGCTGGACGAGCTCATGGCGTCACTGTCAGATTTCAAG TTCATGGCCCAGGGGAAAACTGGGAGCAGCTCACCCCCTGGGGGACTCTCCAAGC

CCGGGAGCCAGCTGGACAGCATGTTGGGGAGTCTGCAGTCCGACCTGAACAAGCTAGGGGTCGCCACCGTTGCCAAAGGGGTCTGTGGAGCCTGCAAGAA

GCCCATCGCCGGGCAG - UNI14767 - GTCGTGACCGCCATGGGGAAGACATGGCACCCCGAGCACTTTGTGTGCACCCACTGCCAGGAGGAGATTG

GATCCCGAAACTTTTTTGAGCGGGACGGACAGCCCTACTGTGAGAAGGACTACCACAGCCTCTTCTCCCCACGCTGCTACTACTGCAACGGACCCATCCT

GGAT - UNI14766 - AAAGTGGTGACAGCGCTGGACCGCACATGGCACCCGGAACACTTCTTCTGTGCCCAGTGTGGAGCCTTCTTTGGTCCAGAAG

 GCTTCCACGAGAAGGACGGCAAAGCGTACTGTCGTAAAGATTACTTCGACATGTTTGCTCCCAAGTGCGGCGGCTGCGCCCGTGCCATCCTGGAGAACT

ACATTTCAGCCCTCAACACCCTCTGGCACCCCGAATGCTTTGTGTGCAGG GAGTGCTTCACACCCTTCGTCAACGGCAGCTTCTTTGAGCACGACGGGC

AGCCGTACTGTGAGGTCCACTACCACGAGCGGCGCGGCTCGCTGTGCTCCGGCTGCCAGAAGCCCATCACGGGCCGCTGCATCACCGCCATGGCCAAGAA

GTTCCACCCCGAGCATTTCGTGTGCGCCTTTTGCCTGAAGCAGCTCAACAAGGGCACCTTCAAGGAGCAGAACGACAAACCCTACTGCCAGAGCTGCTTC

GTGAAGCTCTTCTGCTAGGCCGGTGCCTGCCCTCCCCGCCTTCCCCAGCCAGCCAGTGCCGCCACGCACTGCTCGCTTGGGGCCAATCCACCAATGGAAA

CTGGAACCTCACCCCCTCAGCAGGCACAGGCGCAGGACAGGACTCCGGGTCGGTCCTGCCTGTCTCTCGTCCCTACCACCTGCTAAAGGGGCCTCCTCCC

CCTTCCGTGGCTCTCCTGGGCTCTGTGCACTTCATCTTCCCCAGAGGTGGAAGCTGCTGCCCAGTTGTCCCGTGGATGTCCCTAAGAGCCAGCACCTCAC

ACTGGAGCCTTTGACAGTCACCTTTCCACAGTGTGGTCATTGGGAGGGCAGAGAGGGTCAGCTAGGGGCTCTTTTTATCCTTCTCCAAACCCCTACTGTA

TTGGGGACACCGGGCCCCACTAGACAATGCCAGCATAAAGTCACCCATGGGCCATCAAAGGCACTTTGGGTGCCACCACCCAGTCTCCCAGAGTCTGGGT

GACTGCCCCGTTTGTACCGGCCCCGGGGTCTCTGAGAAAGCCTCCTCCAGCAATAACCTTTTATATAGACACGTGCTTCATCTCTGGGGACGGCGTGAGG

TGGGAGTGTCACCCGCCCACGCCTCAACACTGTACCAAATTTGATAGATTTCTACACTGAGGTTCAACTTCGTATGGCTCAAGTTGCTTTTATGTATCTC

CACAAGATGATTTTGAAGAGATTTAAAGAACTCCCCCTTTTGTACTCTGGTCTGTCCTTGCCGCTGGGTCAGCCCGTGGCATTGGTTTTGGTATGGACTT

TGCTTTGTATGAGGGGGAAATACTTTGTATCTTTATGTTATTTCTTAGCACAATGAGCTGGGAGCGGCCCTTGACGACTTCTGAAACCTCGCAGCTCCCG

GGACTGTTTTTAAACTGCTGTATTTTCAAACCCTTCCCTCACTGCCCAGGCCAACGGGCTCTTCATTAAGAACTACTCTAAGAATGTCCAGCCCTTTGGA

CCTGGAGTTTTGAACCTCACGTGTCCTGTTCCCAAGGCAGGCAAAGGGGAAAGACATATTTGGGGGTCTGCTTCCTGCCTAAGTAAGCCATCTGGAACCA

GCCTCTGCTCCCTGTGAAATTTTTTTTGGCGACAAGGAGAAACCCCTGAATTTTCTCAGCCTCCTCATTGCTTCTCTGGGGCTCGCTCTTCTTCCTTCTC

AGGAAAGCCGGTGTCTGATTTTGACCAGGAAGATGGTAAAGGATCTCTGGTCTCCACTCCACTGGGCGCATCTCTCCCTCCCTCAAACTTCCTGTCAGCT

GACCGGGGCTAAGGCTGTTCCCTTTCACAGGTGGGGTTTGTGTTGGGGGGCTGGGGAAGGGGGTCTGAGAATGCCCCAAGCTGGAACAGGGGAGCCTGGT

AGGAGTTGGGGCAGAGGGACAAGATCCCTATTAGAGTAACGAAAAGTCCCAGAGCTCCCAGTCCAAAGGATGAGATGGGAGCAGCCAGCTTGGAAATGGC

TGGGGAAAAAGGCGTCTGGAAAAGGGATTCCAGACAATTCCATAGGCTGGGGACCTACACCTTACATCAGCTTCCCAGTAGAGGACCAGCGTGATGGGGT

CCCAGACAAGGATCCCCAGTCAAGGTCAGCTCTGGCAGTGGCTGCAGACACCGGCACTTCCACCCACAGGCCTTACTGCTCTGTTTACAGTGACCTGCTC

CAGCCCCCCTCCCCCTCCAAGACGAGGTCGGGGTATCTGGAGGGCCATTCTCTGGGTCAATGGATCTGTGATCATTTGATTCCCCTCCCCCTTATAAACT

TTTAACCTGGCTTTTCTCATTTCAACTCCTGTGATATATGCCAATAAAGTTTGCCATGATTT
Translation
MDDLD - UNI5902 - - UNI14468 - - UNI30050 - DALLADLESTTSHISKRPVFLSEEPPYSYPTGNHTYQEIAVPPPVPPPPSSEALNG

TVLDPLDQWQPSGSRYAHQQ - UNI18140 - PPSPLPVYSSSAKNSSASNTQDGVGSLCSRAGEEEHVYS - UNI37632 - SFPNKQKSAEPSP

TVMSSSLGSNLSELDRLLLELNAVQHSPPGFPAD DEAESSPPLPGALSPLYGIPENNTPLGGKAGPLVKEKPKRNGGRGLEDVRPSVESLLDELESSVP

SPV VPAITVNQGEMSSPQRVTSSQQQTRISASSATRELDELMASLSDFK FMAQGKTGSSSPPGGLSKPGSQLDSMLGSLQSDLNKLGVATVAKGVCGA

CKKPIAGQ - UNI14767 - VVTAMGKTWHPEHFVCTHCQEEIGSRNFFERDGQPYCEKDYHSLFSPRCYYCNGPILD - UNI14766 - KVVTAL

DRTWHPEHFFCAQCGAFFGPEG GFHEKDGKAYCRKDYFDMFAPKCGGCARAILENYISALNTLWHPECFVCR ECFTPFVNGSFFEHDGQPYCEVHYHE

RRGSLCSGCQKPITGRCITAMAKKFHPEHFVCAFCLKQLNKGTFKEQNDKPYCQSCFVKLFC
Transcript ENSMUST00000086523
Sequence
GGCAGCGAGGGCGACATCGAGCCGGGGACTGGCGTCTGAGGACCAGCCATGGACGACCTCG - UNI5902 - - UNI14468 - - UNI30050 - 

ATGCCCTGCTGGCAGACTTGGAATCTACCACCTCCCACATCTCCAAACGGCCAGTGTTCTTGTCAGAGGAGCCCCCCTACTCCTACCCAACTGGAAACCA

CACATACCAGGAGATTGCGGTGCCACCTCCGGTCCCACCACCACCGTCCAGCGAGGCCCTCAATGGCACGGTCCTGGACCCTTTAGATCAGTGGCAGCCT

AGTGGTTCCAGATACGCTCACCAGCAG - UNI18140 - CCTCCGTCCCCACTGCCCGTGTACAGCTCCAGTGCTAAAAATTCCAGTGCCTCCAACAC

CCAGGACGGCGTGGGCTCCCTTTGTTCCCGAGCAGGCGAGGAAGAGCACGTCTACAG - UNI37632 - CTTCCCCAACAAGCAGAAGTCGGCAGAGC

CCTCACCTACCGTCATGAGCTCCTCCCTGGGCAGCAACCTCTCTGAACTTGACCGGCTGTTACTGGAGCTGAACGCAGTGCAGCACAGCCCGCCTGGCTT

CCCTGCAG ATGAAGCCGAATCGAGCCCCCCCTTGCCTGGAGCCCTGAGCCCCCTTTATGGCATCCCAGAAAATAACACTCCCTTGGGGGGCAAAGCGGG

GCCCCTGGTGAAAGAGAAGCCAAAGCGAAATGGAGGCCGGGGGCTGGAGGATGTGCGGCCCAGCGTGGAGAGCCTCTTGGATGAACTGGAGAGTTCCGTG

CCCAGCCCTGT CCCGGCCATCACTGTGAACCAGGGAGAGATGAGCAGTCCGCAGCGAGTCACCTCCAGCCAGCAGCAGACCCGGATCTCGGCCTCCTCT

GCCACCAGGGAGCTGGACGAGCTCATGGCGTCACTGTCAGATTTCAAG ATGCAGGGCCTGGAACAGAGAGTGGATGGAGAGCGGCCGTGGGCAGCCAGC

TGGCCCCCCAGCAGCAGGCAGAGCAGCCCCGAAGGGCAGGACGAGGGAGGG TTCATGGCCCAGGGGAAAACTGGGAGCAGCTCACCCCCTGGGGGACTC

TCCAAGCCCGGGAGCCAGCTGGACAGCATGTTGGGGAGTCTGCAGTCCGACCTGAACAAGCTAGGGGTCGCCACCGTTGCCAAAGGGGTCTGTGGAGCCT

GCAAGAAGCCCATCGCCGGGCAG - UNI14767 - GTCGTGACCGCCATGGGGAAGACATGGCACCCCGAGCACTTTGTGTGCACCCACTGCCAGGAG

GAGATTGGATCCCGAAACTTTTTTGAGCGGGACGGACAGCCCTACTGTGAGAAGGACTACCACAGCCTCTTCTCCCCACGCTGCTACTACTGCAACGGAC

CCATCCTGGAT - UNI14766 - AAAGTGGTGACAGCGCTGGACCGCACATGGCACCCGGAACACTTCTTCTGTGCCCAGTGTGGAGCCTTCTTTGGT

CCAGAAG GCTTCCACGAGAAGGACGGCAAAGCGTACTGTCGTAAAGATTACTTCGACATGTTTGCTCCCAAGTGCGGCGGCTGCGCCCGTGCCATCCTG

GAGAACTACATTTCAGCCCTCAACACCCTCTGGCACCCCGAATGCTTTGTGTGCAGG GAGTGCTTCACACCCTTCGTCAACGGCAGCTTCTTTGAGCAC

GACGGGCAGCCGTACTGTGAGGTCCACTACCACGAGCGGCGCGGCTCGCTGTGCTCCGGCTGCCAGAAGCCCATCACGGGCCGCTGCATCACCGCCATGG

CCAAGAAGTTCCACCCCGAGCATTTCGTGTGCGCCTTTTGCCTGAAGCAGCTCAACAAGGGCACCTTCAAGGAGCAGAACGACAAACCCTACTGCCAGAG

CTGCTTCGTGAAGCTCTTCTGCTAGGCCGGTGCCTGCCCTCCCCGCCTTCCCCAGCCAGCCAGTGCCGCCACGCACTGCTCGCTTGGGGCCAATCCACCA

ATGGAAACTGGAACCTCACCCCCTCAGCAGGCACAGGCGCAGGACAGGACTCCGGGTCGGTCCTGCCTGTCTCTCGTCCCTACCACCTGCTAAAGGGGCC

TCCTCCCCCTTCCGTGGCTCTCCTGGGCTCTGTGCACTTCATCTTCCCCAGAGGTGGAAGCTGCTGCCCAGTTGTCCCGTGGATGTCCCTAAGAGCCAGC

ACCTCACACTGGAGCCTTTGACAGTCACCTTTCCACAGTGTGGTCATTGGGAGGGCAGAGAGGGTCAGCTAGGGGCTCTTTTTATCCTTCTCCAAACCCC

TACTGTATTGGGGACACCGGGCCCCACTAGACAATGCCAGCATAAAGTCACCCATGGGCCATCAAAGGCACTTTGGGTGCCACCACCCAGTCTCCCAGAG

TCTGGGTGACTGCCCCGTTTGTACCGGCCCCGGGGTCTCTGAGAAAGCCTCCTCCAGCAATAACCTTTTATATAGACACGTGCTTCATCTCTGGGGACGG

CGTGAGGTGGGAGTGTCACCCGCCCACGCCTCAACACTGTACCAAATTTGATAGATTTCTACACTGAGGTTCAACTTCGTATGGCTCAAGTTGCTTTTAT

GTATCTCCACAAGATGATTTTGAAGAGATTTAAAGAACTCCCCCTTTTGTACTCTGGTCTGTCCTTGCCGCTGGGTCAGCCCGTGGCATTGGTTTTGGTA

TGGACTTTGCTTTGTATGAGGGGGAAATACTTTGTATCTTTATGTTATTTCTTAGCACAATGAGCTGG
Translation
MDDLD - UNI5902 - - UNI14468 - - UNI30050 - DALLADLESTTSHISKRPVFLSEEPPYSYPTGNHTYQEIAVPPPVPPPPSSEALNG

TVLDPLDQWQPSGSRYAHQQ - UNI18140 - PPSPLPVYSSSAKNSSASNTQDGVGSLCSRAGEEEHVYS - UNI37632 - SFPNKQKSAEPSP

TVMSSSLGSNLSELDRLLLELNAVQHSPPGFPAD DEAESSPPLPGALSPLYGIPENNTPLGGKAGPLVKEKPKRNGGRGLEDVRPSVESLLDELESSVP

SPV VPAITVNQGEMSSPQRVTSSQQQTRISASSATRELDELMASLSDFK MQGLEQRVDGERPWAASWPPSSRQSSPEGQDEGG FMAQGKTGSSSPPG

GLSKPGSQLDSMLGSLQSDLNKLGVATVAKGVCGACKKPIAGQ - UNI14767 - VVTAMGKTWHPEHFVCTHCQEEIGSRNFFERDGQPYCEKDYHS

LFSPRCYYCNGPILD - UNI14766 - KVVTALDRTWHPEHFFCAQCGAFFGPEG GFHEKDGKAYCRKDYFDMFAPKCGGCARAILENYISALNTLW

HPECFVCR ECFTPFVNGSFFEHDGQPYCEVHYHERRGSLCSGCQKPITGRCITAMAKKFHPEHFVCAFCLKQLNKGTFKEQNDKPYCQSCFVKLFC
Transcript ENSMUST00000112060
Sequence
CTCAATGATGTTG - UNI14468 - ATGCCCTGCTGGCAGACTTGGAATCTACCACCTCCCACATCTCCAAACGGCCAGTGTTCTTGTCAGAGGAGCC

CCCCTACTCCTACCCAACTGGAAACCACACATACCAGGAGATTGCGGTGCCACCTCCGGTCCCACCACCACCGTCCAGCGAGGCCCTCAATGGCACGGTC

CTGGACCCTTTAGATCAGTGGCAGCCTAGTGGTTCCAGATACGCTCACCAGCAG - UNI18140 - CCTCCGTCCCCACTGCCCGTGTACAGCTCCAG

TGCTAAAAATTCCAGTGCCTCCAACACCCAGGACGGCGTGGGCTCCCTTTGTTCCCGAGCAGGCGAGGAAGAGCACGTCTACAG - UNI37632 - CT

TCCCCAACAAGCAGAAGTCGGCAGAGCCCTCACCTACCGTCATGAGCTCCTCCCTGGGCAGCAACCTCTCTGAACTTGACCGGCTGTTACTGGAGCTGAA

CGCAGTGCAGCACAGCCCGCCTGGCTTCCCTGCAG ATGAAGCCGAATCGAGCCCCCCCTTGCCTGGAGCCCTGAGCCCCCTTTATGGCATCCCAGAAAA

TAACACTCCCTTGGGGGGCAAAGCGGGGCCCCTGGTGAAAGAGAAGCCAAAGCGAAATGGAGGCCGGGGGCTGGAGGATGTGCGGCCCAGCGTGGAGAGC

CTCTTGGATGAACTGGAGAGTTCCGTGCCCAGCCCTGT CCCGGCCATCACTGTGAACCAGGGAGAGATGAGCAGTCCGCAGCGAGTCACCTCCAGCCAG

CAGCAGACCCGGATCTCGGCCTCCTCTGCCACCAGGGAGCTGGACGAGCTCATGGCGTCACTGTCAGATTTCAAG ATGCAGGGCCTGGAACAGAGAGTG

GATGGAGAGCGGCCGTGGGCAGCCAGCTGGCCCCCCAGCAGCAGGCAGAGCAGCCCCGAAGGGCAGGACGAGGGAGGG TTCATGGCCCAGGGGAAAACT

GGGAGCAGCTCACCCCCTGGGGGACTCTCCAAGCCCGGGAGCCAGCTGGACAGCATGTTGGGGAGTCTGCAGTCCGACCTGAACAAGCTAGGGGTCGCCA

CCGTTGCCAAAGGGGTCTGTGGAGCCTGCAAGAAGCCCATCGCCGGGCAG - UNI14767 - GTCGTGACCGCCATGGGGAAGACATGGCACCCCGAG

CACTTTGTGTGCACCCACTGCCAGGAGGAGATTGGATCCCGAAACTTTTTTGAGCGGGACGGACAGCCCTACTGTGAGAAGGACTACCACAGCCTCTTCT

CCCCACGCTGCTACTACTGCAACGGACCCATCCTGGAT - UNI14766 - AAAGTGGTGACAGCGCTGGACCGCACATGGCACCCGGAACACTTCTTC

TGTGCCCAGTGTGGAGCCTTCTTTGGTCCAGAAG GCTTCCACGAGAAGGACGGCAAAGCGTACTGTCGTAAAGATTACTTCGACATGTTTGCTCCCAAG

TGCGGCGGCTGCGCCCGTGCCATCCTGGAGAACTACATTTCAGCCCTCAACACCCTCTGGCACCCCGAATGCTTTGTGTGCAGG GAGTGCTTCACACCC

TTCGTCAACGGCAGCTTCTTTGAGCACGACGGGCAGCCGTACTGTGAGGTCCACTACCACGAGCGGCGCGGCTCGCTGTGCTCCGGCTGCCAGAAGCCCA

TCACGGGCCGCTGCATCACCGCCATGGCCAAGAAGTTCCACCCCGAGCATTTCGTGTGCGCCTTTTGCCTGAAGCAGCTCAACAAGGGCACCTTCAAGGA

GCAGAACGACAAACCCTACTGCCAGAGCTGCTTCGTGAAGCTCTTCTGCTAGGCCGGTGCCTGCCCTCCCCGCCTTCCCCAGCCAGCCAGTGCCGCCACG

CACTGCTCGCTTGGGGCCAATCCACCAATGGAAACTGGAACCTCACCCCCTCAGCAGGCACAGGCGCAGGACAGGACTCCGGGTCGGTCCTGCCTGTCTC

TCGTCCCTACCACCTGCTAAAGGGGCCTCCTCCCCCTTCCGTGGCTCTCCTGGGCTCTGTGCACTTCATCTTCCCCAGAGGTGGAAGCTGCTGCCCAGTT

GTCCCGTGGATGTCCCTAAGAGCCAGCACCTCACACTGGAGCCTTTGACAGTCACCTTTCCACAGTGTGGTCATTGGGAGGGCAGAGAGGGTCAGCTAGG

GGCTCTTTTTATCCTTCTCCAAACCCCTACTGTATTGGGGACACCGGGCCCCACTAGACAATGCCAGCATAAAGTCACCCATGGGCCATCAAAGGCACTT

TGGGTGCCACCACCCAGTCTCCCAGAGTCTGGGTGACTGCCCCGTTTGTACCGGCCCCGGGGTCTCTGAGAAAGCCTCCTCCAGCAATAACCTTTTATAT

AGACACGTGCTTCATCTCTGGGGACGGCGTGAGGTGGGAGTGTCACCCGCCCACGCCTCAACACTGTACCAAATTTGATAGATTTCTACACTGAGGTTCA

ACTTCGTATGGCTCAAGTTGCTTTTATGTATCTCCACAAGATGATTTTGAAGAGATTTAAAGAACTCCCCCTTTTGTACTCTGGTCTGTCCTTGCCGCTG

GGTCAGCCCGTGGCATTGGTTTTGGTATGGACTTTGCTTTGTATGAGGGGGAAATACTTTGTATCTTTATGTTATTTCTTAGCACAATGAGCTGGGAGCG

GCCCTTGACGACTTCTGAAACCTCGCAGCTCCCGGGACTGTTTTTAAACTGCTGTATTTTCAAACCCTTCCCTCACTGCCCAGGCCAACGGGCTCTTCAT

TAAGAACTACTCTAAGAATGTCCAGCCCTTTGGACCTGGAGTTTTGAACCTCACGTGTCCTGTTCCCAAGGCAGGCAAAGGGGAAAGACATATTTGGGGG

TCTGCTTCCTGCCTAAGTAAGCCATCTGGAACCAGCCTCTGCTCCCTGTGAAATTTTTTTTGGCGACAAGGAGAAACCCCTGAATTTTCTCAGCCTCCTC

ATTGCTTCTCTGGGGCTCGCTCTTCTTCCTTCTCAGGAAAGCCGGTGTCTGATTTTGACCAGGAAGATGGTAAAGGATCTCTGGTCTCCACTCCACTGGG

CGCATCTCTCCCTCCCTCAAACTTCCTGTCAGCTGACCGGGGCTAAGGCTGTTCCCTTTCACAGGTGGGGTTTGTGTTGGGGGGCTGGGGAAGGGGGTCT

GAGAATGCCCCAAGCTGGAACAGGGGAGCCTGGTAGGAGTTGGGGCAGAGGGACAAGATCCCTATTAGAGTAACGAAAAGTCCCAGAGCTCCCAGTCCAA

AGGATGAGATGGGAGCAGCCAGCTTGGAAATGGCTGGGGAAAAAGGCGTCTGGAAAAGGGATTCCAGACAATTCCATAGGCTGGGGACCTACACCTTACA

TCAGCTTCCCAGTAGAGGACCAGCGTGATGGGGTCCCAGACAAGGATCCCCAGTCAAGGTCAGCTCTGGCAGTGGCTGCAGACACCGGCACTTCCACCCA

CAGGCCTTACTGCTCTGTTTACAGTGACCTGCTCCAGCCCCCCTCCCCCTCCAAGACGAGGTCGGGGTATCTGGAGGGCCATTCTCTGGGTCAATGGATC

TGTGATCATTTGATTCCCCTCCCCCTTATAAACTTTTAACCTGGCTTTTCTCATTTCAACTCCTGTGATATATGCCAATAAAGTTTGCCATGATTT
Translation
LNDVD - UNI14468 - DALLADLESTTSHISKRPVFLSEEPPYSYPTGNHTYQEIAVPPPVPPPPSSEALNGTVLDPLDQWQPSGSRYAHQQ - UN

I18140 - PPSPLPVYSSSAKNSSASNTQDGVGSLCSRAGEEEHVYS - UNI37632 - SFPNKQKSAEPSPTVMSSSLGSNLSELDRLLLELNAVQ

HSPPGFPAD DEAESSPPLPGALSPLYGIPENNTPLGGKAGPLVKEKPKRNGGRGLEDVRPSVESLLDELESSVPSPV VPAITVNQGEMSSPQRVTSSQ

QQTRISASSATRELDELMASLSDFK MQGLEQRVDGERPWAASWPPSSRQSSPEGQDEGG FMAQGKTGSSSPPGGLSKPGSQLDSMLGSLQSDLNKLGV

ATVAKGVCGACKKPIAGQ - UNI14767 - VVTAMGKTWHPEHFVCTHCQEEIGSRNFFERDGQPYCEKDYHSLFSPRCYYCNGPILD - UNI1476

6 - KVVTALDRTWHPEHFFCAQCGAFFGPEG GFHEKDGKAYCRKDYFDMFAPKCGGCARAILENYISALNTLWHPECFVCR ECFTPFVNGSFFEHDG

QPYCEVHYHERRGSLCSGCQKPITGRCITAMAKKFHPEHFVCAFCLKQLNKGTFKEQNDKPYCQSCFVKLFC

For any suggestions or comments, please send an email to unitrap@crg.es