Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000029534 (St7)
Chromosomal location
Chr 6: 17643947 - 17893022 (+)
Description
Suppression of tumorigenicity 7 Gene [Source:MGI (curated);Acc:St7-011]
RefSeq_dna
NM_001083315 NM_022332 
RefSeq_peptide
NP_001076784.1 NP_071727.2 
MGI
MGI:1927450 
Uniprot/SWISSPROT
Q99M96 
Uniprot/SPTREMBL
Q99M95 
Human Ortholog
ENSG00000004866 (ST7)
Omim not available
UniTrap UNI32194
Vector Insertion
Chr 6: 17769333 - 17784616
Public Clones IST12517H8 (tigm) IST12518E8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33542
Vector Insertion
Chr 6: 17784777 - 17794908
Public Clones IST12440H12 (tigm) IST12256H11 (tigm) IST12256A11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 17% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2153
Vector Insertion
Chr 6: 17805029 - 17836003
Public Clones XT0692 (sanger) IST13646C10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 50% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28112
Vector Insertion
Chr 6: 17872140 - 17880765
Public Clones not available
Private Clones OST39814 (lexicon)
Severity of mutation (?) Insertion after 79% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000115417
Sequence
GAGGACTGCAGTCTCTGCTGCTGCTCGCAGACCTGCCCTGCGCTAGCTACCTAGCCCTGCCTCACTGCATCCCTCAAGAGCCGCGGCAGCCTTTCCTTGC

CTGCTGGATTTTGAGAAGCAGCTCTTCGATTTGGGCTGGTGTAGGAGCCCTGGCTTTCCATTCTCGAGAGAAAGCTGAAGCGCTCAGAGGAGAATCTGGC

AGCTGGACATAGCTCGGACTGCATTGTCTGGCTTCATGACCCCTGCTGTGTAGCCGGCTCATCTCTTTGCTCTCAGGAGCACATGCACATCTTACATTTT

CCTACTTCCTTTTTCTTTTTCTTTCCCTTCTTCTAATTTTTTTTTAAAGCACCTTCTGGAGCCAGCCATGTTTGGTACTGAATCTTCAT TGAGCATGTT

TTTGAACACGTTAACCCCAAAGTTCTACGTGGCCCTGACAGGCACTTCCTCGCTAATATCGGGACTTATTTTG - UNI32194 - ATATTTGAATGGT

GGTATTTTCGCAAGTATGGAACATCTTTCATTGAACAAGTCTCCGTAAGCCACTTGCGCCCCCTTCTGGGAGGGGTTGACAACAACTCTTCCAATAATTC

TAATTCCAGTAATGGAGACTCAGATTCCAACAGACAAAGTGTCTCAG - UNI33542 - AATGCAAAGTATGGCGAAATCCACTGAATCTGTTTAGGG

GTGCGGAATATAATCG GTACACTTGGGTCACAGGACGAGAGCCTCTGACCTACTATGACATGAACCTCTCTGCCCAGGACCACCAGACATTCTTTACTT

GTGATTCAGATCATCTTCGCCCTGCAGATGCAA TAATGCAAAAAGCTTGGAGAGAAAGGAACCCTCAAGCCAGGATTTCTGCAGCTCATGAAGCCTTGG

AGATAAACGA GTGTGCAACTGCGTACATTCTCTTGGCGGAAGAAGAAGCGACAACTATTGCTGAAGCAGAAAAACTCTTTAAGCAGGCCCTGAAGGCTG

GAGATGGTTGTTACCGGCGCTCTCAGCAGCTACAACATCATGGGTCCCAGTATGAAGCTCAACACA GACGAGACACCAATGTCTTAGTCTATATCAAAA

GAAGGCTGGCGATGTGTGCCCGGAGACTTGGAAGGACCAGAGAAGCAGTGAAGATGATGAGAGAT - UNI2153 - TTAATGAAGGAGTTTCCCCTCC

TAAGCATGTTCAATATCCATGAGAACCTTCTAGAAGCTCTTCTGGAACTCCAAGCTTATGCTGATGTTCAGGCAGTCTTAGCAAAGTATGATG ATATAA

GCTTACCAAAGTCGGCGACAATATGCTACACAGCCGCCCTGCTCAAAGCAAGAGCTGTCTCTGACAA ATTCTCTCCAGAGGCTGCGTCTCGGAGGGGGC

TGAGCACAGCAGAGATGAATGCAGTAGAAGCCATCCACAGAGCTGTGGAATTTAATCCACACGTGCCAAAA TATCTACTAGAAATGAAAAGCTTAATCC

TCCCACCAGAACACATCCTGAAGAGAGGAGACAGTGAAGCGATAGCATATGCATTCTTTCATCTTGCACACTGGAAGAGGGTGGAAGGGGCTTTGAATCT

CTTGCATTGTACGTGGGAAGGCA - UNI28112 - CTTTCCGGATGATCCCGTATCCCCTGGAGAAGGGACACCTATTTTATCCATACCCAATCTGTA

CAGAAACAGCTGACCGGGAGCTGCTTCCCT CTTTCCATGAAGTCTCAGTTTACCCAAAGAAGGAACTTCCCTTCTTCATCCTCTTCACTGCTGGACTGT

GCTCCTTCACAGCCATGCTGGCCCTCCTGACACATCAGTTTCCGGAACTTATGGGAGTCTTCGCAAAAGCT TTCCTCAGCACTTTGTTTGCCCCCTTGA

ACTTTGTTATGGAGAAAGTGGAAAGCATCCTCCCCTCCAGTTTGTGGCATCAGCTGACACGGATCTGAGGGAGCCTCCCATCCTTCACTTTCCACACCAT

CCACCATCTCTTCTGTGCCAACCTCTCATGGACCGCAAGAAAGCATGACTTTGAAAAAGGGAAACCATTCTGAGATTTTAAACTGCTCATGGACTATCAG

TTCCTTATTAAAGGCTGGTTTTGTTGTACAAAATTTATTGATGTTCAGTTCTATTTTATTTTGCCTTCAAAACTGACTGATCAAAAAGTAAAAAAAATAA

ATAAATAAACTTTTGTGTATTGC
Translation
MFGTESSL LSMFLNTLTPKFYVALTGTSSLISGLIL - UNI32194 - IFEWWYFRKYGTSFIEQVSVSHLRPLLGGVDNNSSNNSNSSNGDSDSNR

QSVSE - UNI33542 - ECKVWRNPLNLFRGAEYNR RYTWVTGREPLTYYDMNLSAQDHQTFFTCDSDHLRPADAI IMQKAWRERNPQARISAAHE

ALEINE ECATAYILLAEEEATTIAEAEKLFKQALKAGDGCYRRSQQLQHHGSQYEAQHR RRDTNVLVYIKRRLAMCARRLGRTREAVKMMRD - UNI

2153 - LMKEFPLLSMFNIHENLLEALLELQAYADVQAVLAKYDD DISLPKSATICYTAALLKARAVSDK KFSPEAASRRGLSTAEMNAVEAIHRAV

EFNPHVPK YLLEMKSLILPPEHILKRGDSEAIAYAFFHLAHWKRVEGALNLLHCTWEGT - UNI28112 - TFRMIPYPLEKGHLFYPYPICTETAD

RELLPS SFHEVSVYPKKELPFFILFTAGLCSFTAMLALLTHQFPELMGVFAKA FLSTLFAPLNFVMEKVESILPSSLWHQLTRI
Transcript ENSMUST00000053148
Sequence
GAGGACTGCAGTCTCTGCTGCTGCTCGCAGACCTGCCCTGCGCTAGCTACCTAGCCCTGCCTCACTGCATCCCTCAAGAGCCGCGGCAGCCTTTCCTTGC

CTGCTGGATTTTGAGAAGCAGCTCTTCGATTTGGGCTGGTGTAGGAGCCCTGGCTTTCCATTCTCGAGAGAAAGCTGAAGCGCTCAGAGGAGAATCTGGC

AGCTGGACATAGCTCGGACTGCATTGTCTGGCTTCATGACCCCTGCTGTGTAGCCGGCTCATCTCTTTGCTCTCAGGAGCACATGCACATCTTACATTTT

CCTACTTCCTTTTTCTTTTTCTTTCCCTTCTTCTAATTTTTTTTTAAAGCACCTTCTGGAGCCAGCCATGTTTGGTACTGAATCTTCAT TGAGCATGTT

TTTGAACACGTTAACCCCAAAGTTCTACGTGGCCCTGACAGGCACTTCCTCGCTAATATCGGGACTTATTTTG - UNI32194 - ATATTTGAATGGT

GGTATTTTCGCAAGTATGGAACATCTTTCATTGAACAAGTCTCCGTAAGCCACTTGCGCCCCCTTCTGGGAGGGGTTGACAACAACTCTTCCAATAATTC

TAATTCCAGTAATGGAGACTCAGATTCCAACAGACAAAGTGTCTCAG - UNI33542 - AATGCAAAGTATGGCGAAATCCACTGAATCTGTTTAGGG

GTGCGGAATATAATCG GTACACTTGGGTCACAGGACGAGAGCCTCTGACCTACTATGACATGAACCTCTCTGCCCAGGACCACCAGACATTCTTTACTT

GTGATTCAGATCATCTTCGCCCTGCAGATGCAA TAATGCAAAAAGCTTGGAGAGAAAGGAACCCTCAAGCCAGGATTTCTGCAGCTCATGAAGCCTTGG

AGATAAACGA AATTAGGTCCAGAGTTGAAGTTCCCCTAATTGCTTCCTCTACCATCTGGGAGATAAAATTGTTACCAAA GTGTGCAACTGCGTACATT

CTCTTGGCGGAAGAAGAAGCGACAACTATTGCTGAAGCAGAAAAACTCTTTAAGCAGGCCCTGAAGGCTGGAGATGGTTGTTACCGGCGCTCTCAGCAGC

TACAACATCATGGGTCCCAGTATGAAGCTCAACACA GACGAGACACCAATGTCTTAGTCTATATCAAAAGAAGGCTGGCGATGTGTGCCCGGAGACTTG

GAAGGACCAGAGAAGCAGTGAAGATGATGAGAGAT - UNI2153 - TTAATGAAGGAGTTTCCCCTCCTAAGCATGTTCAATATCCATGAGAACCTTC

TAGAAGCTCTTCTGGAACTCCAAGCTTATGCTGATGTTCAGGCAGTCTTAGCAAAGTATGATG ATATAAGCTTACCAAAGTCGGCGACAATATGCTACA

CAGCCGCCCTGCTCAAAGCAAGAGCTGTCTCTGACAA ATTCTCTCCAGAGGCTGCGTCTCGGAGGGGGCTGAGCACAGCAGAGATGAATGCAGTAGAAG

CCATCCACAGAGCTGTGGAATTTAATCCACACGTGCCAAAA TATCTACTAGAAATGAAAAGCTTAATCCTCCCACCAGAACACATCCTGAAGAGAGGAG

ACAGTGAAGCGATAGCATATGCATTCTTTCATCTTGCACACTGGAAGAGGGTGGAAGGGGCTTTGAATCTCTTGCATTGTACGTGGGAAGGCA - UNI2

8112 - CTTTCCGGATGATCCCGTATCCCCTGGAGAAGGGACACCTATTTTATCCATACCCAATCTGTACAGAAACAGCTGACCGGGAGCTGCTTCCCT

 CTTTCCATGAAGTCTCAGTTTACCCAAAGAAGGAACTTCCCTTCTTCATCCTCTTCACTGCTGGACTGTGCTCCTTCACAGCCATGCTGGCCCTCCTGA

CACATCAGTTTCCGGAACTTATGGGAGTCTTCGCAAAAGCT TTCCTCAGCACTTTGTTTGCCCCCTTGAACTTTGTTATGGAGAAAGTGGAAAGCATCC

TCCCCTCCAGTTTGTGGCATCAGCTGACACGGATCTGAGGGAGCCTCCCATCCTTCACTTTCCACACCATCCACCATCTCTTCTGTGCCAACCTCTCATG

GACCGCAAGAAAGCATGACTTTGAAAAAGGGAAACCATTCTGAGATTTTAAACTGCTCATGGACTATCAGTTCCTTATTAAAGGCTGGTTTTGTTGTACA

AAATTTATTGATGTTCAGTTCTATTTTATTTTGCCTTCAAAACTGACTGATCAAAAAGTAAAAAAAATAAATAAATAAACTTTTGTGTATTGC
Translation
MFGTESSL LSMFLNTLTPKFYVALTGTSSLISGLIL - UNI32194 - IFEWWYFRKYGTSFIEQVSVSHLRPLLGGVDNNSSNNSNSSNGDSDSNR

QSVSE - UNI33542 - ECKVWRNPLNLFRGAEYNR RYTWVTGREPLTYYDMNLSAQDHQTFFTCDSDHLRPADAI IMQKAWRERNPQARISAAHE

ALEINE EIRSRVEVPLIASSTIWEIKLLPK KCATAYILLAEEEATTIAEAEKLFKQALKAGDGCYRRSQQLQHHGSQYEAQHR RRDTNVLVYIKRRL

AMCARRLGRTREAVKMMRD - UNI2153 - LMKEFPLLSMFNIHENLLEALLELQAYADVQAVLAKYDD DISLPKSATICYTAALLKARAVSDK KF

SPEAASRRGLSTAEMNAVEAIHRAVEFNPHVPK YLLEMKSLILPPEHILKRGDSEAIAYAFFHLAHWKRVEGALNLLHCTWEGT - UNI28112 - T

FRMIPYPLEKGHLFYPYPICTETADRELLPS SFHEVSVYPKKELPFFILFTAGLCSFTAMLALLTHQFPELMGVFAKA FLSTLFAPLNFVMEKVESIL

PSSLWHQLTRI
Transcript ENSMUST00000000674
Sequence
GGCCTGCTGCCTATTCTGGGAGCTGCTTGGTGCTATGGCTGATAGAGTTGTGCTTTGAGAAATGCCCAGTTTCCTGCTTCCTGCTTCACTATGAAATATG

CAG TGAGCATGTTTTTGAACACGTTAACCCCAAAGTTCTACGTGGCCCTGACAGGCACTTCCTCGCTAATATCGGGACTTATTTTG - UNI32194 -

 ATATTTGAATGGTGGTATTTTCGCAAGTATGGAACATCTTTCATTGAACAAGTCTCCGTAAGCCACTTGCGCCCCCTTCTGGGAGGGGTTGACAACAAC

TCTTCCAATAATTCTAATTCCAGTAATGGAGACTCAGATTCCAACAGACAAAGTGTCTCAG - UNI33542 - AATGCAAAGTATGGCGAAATCCACT

GAATCTGTTTAGGGGTGCGGAATATAATCG GTACACTTGGGTCACAGGACGAGAGCCTCTGACCTACTATGACATGAACCTCTCTGCCCAGGACCACCA

GACATTCTTTACTTGTGATTCAGATCATCTTCGCCCTGCAGATGCAA TAATGCAAAAAGCTTGGAGAGAAAGGAACCCTCAAGCCAGGATTTCTGCAGC

TCATGAAGCCTTGGAGATAAACGA GTGTGCAACTGCGTACATTCTCTTGGCGGAAGAAGAAGCGACAACTATTGCTGAAGCAGAAAAACTCTTTAAGCA

GGCCCTGAAGGCTGGAGATGGTTGTTACCGGCGCTCTCAGCAGCTACAACATCATGGGTCCCAGTATGAAGCTCAACACA GACGAGACACCAATGTCTT

AGTCTATATCAAAAGAAGGCTGGCGATGTGTGCCCGGAGACTTGGAAGGACCAGAGAAGCAGTGAAGATGATGAGAGAT - UNI2153 - TTAATGAA

GGAGTTTCCCCTCCTAAGCATGTTCAATATCCATGAGAACCTTCTAGAAGCTCTTCTGGAACTCCAAGCTTATGCTGATGTTCAGGCAGTCTTAGCAAAG

TATGATG ATATAAGCTTACCAAAGTCGGCGACAATATGCTACACAGCCGCCCTGCTCAAAGCAAGAGCTGTCTCTGACAA ATTCTCTCCAGAGGCTGC

GTCTCGGAGGGGGCTGAGCACAGCAGAGATGAATGCAGTAGAAGCCATCCACAGAGCTGTGGAATTTAATCCACACGTGCCAAAA TATCTACTAGAAAT

GAAAAGCTTAATCCTCCCACCAGAACACATCCTGAAGAGAGGAGACAGTGAAGCGATAGCATATGCATTCTTTCATCTTGCACACTGGAAGAGGGTGGAA

GGGGCTTTGAATCTCTTGCATTGTACGTGGGAAGGCA - UNI28112 - CTTTCCGGATGATCCCGTATCCCCTGGAGAAGGGACACCTATTTTATCC

ATACCCAATCTGTACAGAAACAGCTGACCGGGAGCTGCTTCCCT CTTTCCATGAAGTCTCAGTTTACCCAAAGAAGGAACTTCCCTTCTTCATCCTCTT

CACTGCTGGACTGTGCTCCTTCACAGCCATGCTGGCCCTCCTGACACATCAGTTTCCGGAACTTATGGGAGTCTTCGCAAAAGCT TTCCTCAGCACTTT

GTTTGCCCCCTTGAACTTTGTTATGGAGAAAGTGGAAAGCATCCTCCCCTCCAGTTTGTGGCATCAGCTGACACGGATCTGAGGGAGCCTCCCATCCTTC

ACTTTCCACACCATCCACCATCTCTTCTGTGCCAACCTCTCATGGACCGCAAGAAAGCATGACTTTGAAAAAGGGAAACCATTCTGAGATTTTAAACTGC

TCATGGACTATCAGTTCCTTATTAAAGGCTGGTTTTGTTGTACAAAATTTATTGATGTTCAGTTCTATTTTATTTTGCCTTCA
Translation
MKYAV VSMFLNTLTPKFYVALTGTSSLISGLIL - UNI32194 - IFEWWYFRKYGTSFIEQVSVSHLRPLLGGVDNNSSNNSNSSNGDSDSNRQSV

SE - UNI33542 - ECKVWRNPLNLFRGAEYNR RYTWVTGREPLTYYDMNLSAQDHQTFFTCDSDHLRPADAI IMQKAWRERNPQARISAAHEALE

INE ECATAYILLAEEEATTIAEAEKLFKQALKAGDGCYRRSQQLQHHGSQYEAQHR RRDTNVLVYIKRRLAMCARRLGRTREAVKMMRD - UNI215

3 - LMKEFPLLSMFNIHENLLEALLELQAYADVQAVLAKYDD DISLPKSATICYTAALLKARAVSDK KFSPEAASRRGLSTAEMNAVEAIHRAVEFN

PHVPK YLLEMKSLILPPEHILKRGDSEAIAYAFFHLAHWKRVEGALNLLHCTWEGT - UNI28112 - TFRMIPYPLEKGHLFYPYPICTETADREL

LPS SFHEVSVYPKKELPFFILFTAGLCSFTAMLALLTHQFPELMGVFAKA FLSTLFAPLNFVMEKVESILPSSLWHQLTRI
Transcript ENSMUST00000077080
Sequence
GGCCTGCTGCCTATTCTGGGAGCTGCTTGGTGCTATGGCTGATAGAGTTGTGCTTTGAGAAATGCCCAGTTTCCTGCTTCCTGCTTCACTATGAAATATG

CAG TGAGCATGTTTTTGAACACGTTAACCCCAAAGTTCTACGTGGCCCTGACAGGCACTTCCTCGCTAATATCGGGACTTATTTTG - UNI32194 -

 ATATTTGAATGGTGGTATTTTCGCAAGTATGGAACATCTTTCATTGAACAAGTCTCCGTAAGCCACTTGCGCCCCCTTCTGGGAGGGGTTGACAACAAC

TCTTCCAATAATTCTAATTCCAGTAATGGAGACTCAGATTCCAACAGACAAAGTGTCTCAG - UNI33542 - AATGCAAAGTATGGCGAAATCCACT

GAATCTGTTTAGGGGTGCGGAATATAATCG GTACACTTGGGTCACAGGACGAGAGCCTCTGACCTACTATGACATGAACCTCTCTGCCCAGGACCACCA

GACATTCTTTACTTGTGATTCAGATCATCTTCGCCCTGCAGATGCAA TAATGCAAAAAGCTTGGAGAGAAAGGAACCCTCAAGCCAGGATTTCTGCAGC

TCATGAAGCCTTGGAGATAAACGA AATTAGGTCCAGAGTTGAAGTTCCCCTAATTGCTTCCTCTACCATCTGGGAGATAAAATTGTTACCAAA GTGTG

CAACTGCGTACATTCTCTTGGCGGAAGAAGAAGCGACAACTATTGCTGAAGCAGAAAAACTCTTTAAGCAGGCCCTGAAGGCTGGAGATGGTTGTTACCG

GCGCTCTCAGCAGCTACAACATCATGGGTCCCAGTATGAAGCTCAACACA GACGAGACACCAATGTCTTAGTCTATATCAAAAGAAGGCTGGCGATGTG

TGCCCGGAGACTTGGAAGGACCAGAGAAGCAGTGAAGATGATGAGAGAT - UNI2153 - TTAATGAAGGAGTTTCCCCTCCTAAGCATGTTCAATAT

CCATGAGAACCTTCTAGAAGCTCTTCTGGAACTCCAAGCTTATGCTGATGTTCAGGCAGTCTTAGCAAAGTATGATG ATATAAGCTTACCAAAGTCGGC

GACAATATGCTACACAGCCGCCCTGCTCAAAGCAAGAGCTGTCTCTGACAA ATTCTCTCCAGAGGCTGCGTCTCGGAGGGGGCTGAGCACAGCAGAGAT

GAATGCAGTAGAAGCCATCCACAGAGCTGTGGAATTTAATCCACACGTGCCAAAA TATCTACTAGAAATGAAAAGCTTAATCCTCCCACCAGAACACAT

CCTGAAGAGAGGAGACAGTGAAGCGATAGCATATGCATTCTTTCATCTTGCACACTGGAAGAGGGTGGAAGGGGCTTTGAATCTCTTGCATTGTACGTGG

GAAGGCA - UNI28112 - CTTTCCGGATGATCCCGTATCCCCTGGAGAAGGGACACCTATTTTATCCATACCCAATCTGTACAGAAACAGCTGACCG

GGAGCTGCTTCCCT CTTTCCATGAAGTCTCAGTTTACCCAAAGAAGGAACTTCCCTTCTTCATCCTCTTCACTGCTGGACTGTGCTCCTTCACAGCCAT

GCTGGCCCTCCTGACACATCAGTTTCCGGAACTTATGGGAGTCTTCGCAAAAGCT TTCCTCAGCACTTTGTTTGCCCCCTTGAACTTTGTTATGGAGAA

AGTGGAAAGCATCCTCCCCTCCAGTTTGTGGCATCAGCTGACACGGATCTGAGGGAGCCTCCCATCCTTCACTTTCCACACCATCCACCATCTCTTCTGT

GCCAACCTCTCATGGACCGCAAGAAAGCATGACTTTGAAAAAGGGAAACCATTCTGAGATTTTAAACTGCTCATGGACTATCAGTTCCTTATTAAAGGCT

GGTTTTGTTGTACAAAATTTATTG
Translation
MKYAV VSMFLNTLTPKFYVALTGTSSLISGLIL - UNI32194 - IFEWWYFRKYGTSFIEQVSVSHLRPLLGGVDNNSSNNSNSSNGDSDSNRQSV

SE - UNI33542 - ECKVWRNPLNLFRGAEYNR RYTWVTGREPLTYYDMNLSAQDHQTFFTCDSDHLRPADAI IMQKAWRERNPQARISAAHEALE

INE EIRSRVEVPLIASSTIWEIKLLPK KCATAYILLAEEEATTIAEAEKLFKQALKAGDGCYRRSQQLQHHGSQYEAQHR RRDTNVLVYIKRRLAMC

ARRLGRTREAVKMMRD - UNI2153 - LMKEFPLLSMFNIHENLLEALLELQAYADVQAVLAKYDD DISLPKSATICYTAALLKARAVSDK KFSPE

AASRRGLSTAEMNAVEAIHRAVEFNPHVPK YLLEMKSLILPPEHILKRGDSEAIAYAFFHLAHWKRVEGALNLLHCTWEGT - UNI28112 - TFRM

IPYPLEKGHLFYPYPICTETADRELLPS SFHEVSVYPKKELPFFILFTAGLCSFTAMLALLTHQFPELMGVFAKA FLSTLFAPLNFVMEKVESILPSS

LWHQLTRI
Transcript ENSMUST00000052113
Sequence
ACGAAGGCCACCGGCGGGGGCTCGGAGCGCAGGCCGCGCGCTTTCCCGCCGCATCCGGGCGCCGGGCGAGCTCCGGGGACGCCGGGCCCTGGCGGCGGCG

GCGGCTCGAGCCGTGCCTCGGGCGGGTGAATCATCCCGGCCGACAGCGAGCGCCGCGGCGGCCCGTAGCAGCGCCGGAAGATGGCCGAGGCGGGCGCGGG

CTTCCTGGAGCAGCTCAAGTCCTGCATCGTGTGGTCGTGGACCTATCTGTGGACCGTGTGGTTCTTCCTCGTGCTCTTCCTGGTCTACATCCTGAGGGTG

CCCCTGAGGATCAACGACAACCTGAGCACAG TGAGCATGTTTTTGAACACGTTAACCCCAAAGTTCTACGTGGCCCTGACAGGCACTTCCTCGCTAATA

TCGGGACTTATTTTG - UNI32194 - ATATTTGAATGGTGGTATTTTCGCAAGTATGGAACATCTTTCATTGAACAAGTCTCCGTAAGCCACTTGCG

CCCCCTTCTGGGAGGGGTTGACAACAACTCTTCCAATAATTCTAATTCCAGTAATGGAGACTCAGATTCCAACAGACAAAGTGTCTCAG - UNI33542

 - AATGCAAAGTATGGCGAAATCCACTGAATCTGTTTAGGGGTGCGGAATATAATCG GTACACTTGGGTCACAGGACGAGAGCCTCTGACCTACTATG

ACATGAACCTCTCTGCCCAGGACCACCAGACATTCTTTACTTGTGATTCAGATCATCTTCGCCCTGCAGATGCAA TAATGCAAAAAGCTTGGAGAGAAA

GGAACCCTCAAGCCAGGATTTCTGCAGCTCATGAAGCCTTGGAGATAAACGA GTGTGCAACTGCGTACATTCTCTTGGCGGAAGAAGAAGCGACAACTA

TTGCTGAAGCAGAAAAACTCTTTAAGCAGGCCCTGAAGGCTGGAGATGGTTGTTACCGGCGCTCTCAGCAGCTACAACATCATGGGTCCCAGTATGAAGC

TCAACACA GACGAGACACCAATGTCTTAGTCTATATCAAAAGAAGGCTGGCGATGTGTGCCCGGAGACTTGGAAGGACCAGAGAAGCAGTGAAGATGAT

GAGAGAT - UNI2153 - TTAATGAAGGAGTTTCCCCTCCTAAGCATGTTCAATATCCATGAGAACCTTCTAGAAGCTCTTCTGGAACTCCAAGCTTA

TGCTGATGTTCAGGCAGTCTTAGCAAAGTATGATG ATATAAGCTTACCAAAGTCGGCGACAATATGCTACACAGCCGCCCTGCTCAAAGCAAGAGCTGT

CTCTGACAA ATTCTCTCCAGAGGCTGCGTCTCGGAGGGGGCTGAGCACAGCAGAGATGAATGCAGTAGAAGCCATCCACAGAGCTGTGGAATTTAATCC

ACACGTGCCAAAA TATCTACTAGAAATGAAAAGCTTAATCCTCCCACCAGAACACATCCTGAAGAGAGGAGACAGTGAAGCGATAGCATATGCATTCTT

TCATCTTGCACACTGGAAGAGGGTGGAAGGGGCTTTGAATCTCTTGCATTGTACGTGGGAAGGCA - UNI28112 - CTTTCCGGATGATCCCGTATC

CCCTGGAGAAGGGACACCTATTTTATCCATACCCAATCTGTACAGAAACAGCTGACCGGGAGCTGCTTCCCT CTTTCCATGAAGTCTCAGTTTACCCAA

AGAAGGAACTTCCCTTCTTCATCCTCTTCACTGCTGGACTGTGCTCCTTCACAGCCATGCTGGCCCTCCTGACACATCAGTTTCCGGAACTTATGGGAGT

CTTCGCAAAAGCT TTCCTCAGCACTTTGTTTGCCCCCTTGAACTTTGTTATGGAGAAAGTGGAAAGCATCCTCCCCTCCAGTTTGTGGCATCAGCTGAC

ACGGATCTGAGGGAGCCTCCCATCCTTCACTTTCCACACCATCCACCATCTCTTCTGTGCCAACCTCTCATGGACCGCAAGAAAGCATGACTTTGAAAAA

GGGAAACCATTCTGAGATTTTAAACTGCTCATGGACTATCAGTTCCTTATTAAAGGCTGGTTTTGTTGTACAAAATTTATTGATGTTCAGTTCTATTTTA

TTTTGCCTTCA
Translation
MAEAGAGFLEQLKSCIVWSWTYLWTVWFFLVLFLVYILRVPLRINDNLSTV VSMFLNTLTPKFYVALTGTSSLISGLIL - UNI32194 - IFEWWY

FRKYGTSFIEQVSVSHLRPLLGGVDNNSSNNSNSSNGDSDSNRQSVSE - UNI33542 - ECKVWRNPLNLFRGAEYNR RYTWVTGREPLTYYDMNL

SAQDHQTFFTCDSDHLRPADAI IMQKAWRERNPQARISAAHEALEINE ECATAYILLAEEEATTIAEAEKLFKQALKAGDGCYRRSQQLQHHGSQYEA

QHR RRDTNVLVYIKRRLAMCARRLGRTREAVKMMRD - UNI2153 - LMKEFPLLSMFNIHENLLEALLELQAYADVQAVLAKYDD DISLPKSATI

CYTAALLKARAVSDK KFSPEAASRRGLSTAEMNAVEAIHRAVEFNPHVPK YLLEMKSLILPPEHILKRGDSEAIAYAFFHLAHWKRVEGALNLLHCTW

EGT - UNI28112 - TFRMIPYPLEKGHLFYPYPICTETADRELLPS SFHEVSVYPKKELPFFILFTAGLCSFTAMLALLTHQFPELMGVFAKA FL

STLFAPLNFVMEKVESILPSSLWHQLTRI
Transcript ENSMUST00000115419
Sequence
CCGGGAGAGTGCAGGGACCGGGCCCACGTGACCGCTCCACGAAGGCCACCGGCGGGGGCTCGGAGCGCAGGCCGCGCGCTTTCCCGCCGCATCCGGGCGC

CGGGCGAGCTCCGGGGACGCCGGGCCCTGGCGGCGGCGGCGGCTCGAGCCGTGCCTCGGGCGGGTGAATCATCCCGGCCGACAGCGAGCGCCGCGGCGGC

CCGTAGCAGCGCCGGAAGATGGCCGAGGCGGGCGCGGGCTTCCTGGAGCAGCTCAAGTCCTGCATCGTGTGGTCGTGGACCTATCTGTGGACCGTGTGGT

TCTTCCTCGTGCTCTTCCTGGTCTACATCCTGAGGGTGCCCCTGAGGATCAACGACAACCTGAGCACAG TGAGCATGTTTTTGAACACGTTAACCCCAA

AGTTCTACGTGGCCCTGACAGGCACTTCCTCGCTAATATCGGGACTTATTTTG - UNI32194 - ATATTTGAATGGTGGTATTTTCGCAAGTATGGA

ACATCTTTCATTGAACAAGTCTCCGTAAGCCACTTGCGCCCCCTTCTGGGAGGGGTTGACAACAACTCTTCCAATAATTCTAATTCCAGTAATGGAGACT

CAGATTCCAACAGACAAAGTGTCTCAG - UNI33542 - AATGCAAAGTATGGCGAAATCCACTGAATCTGTTTAGGGGTGCGGAATATAATCG GTA

CACTTGGGTCACAGGACGAGAGCCTCTGACCTACTATGACATGAACCTCTCTGCCCAGGACCACCAGACATTCTTTACTTGTGATTCAGATCATCTTCGC

CCTGCAGATGCAA TAATGCAAAAAGCTTGGAGAGAAAGGAACCCTCAAGCCAGGATTTCTGCAGCTCATGAAGCCTTGGAGATAAACGA AATTAGGTC

CAGAGTTGAAGTTCCCCTAATTGCTTCCTCTACCATCTGGGAGATAAAATTGTTACCAAA GTGTGCAACTGCGTACATTCTCTTGGCGGAAGAAGAAGC

GACAACTATTGCTGAAGCAGAAAAACTCTTTAAGCAGGCCCTGAAGGCTGGAGATGGTTGTTACCGGCGCTCTCAGCAGCTACAACATCATGGGTCCCAG

TATGAAGCTCAACACA GACGAGACACCAATGTCTTAGTCTATATCAAAAGAAGGCTGGCGATGTGTGCCCGGAGACTTGGAAGGACCAGAGAAGCAGTG

AAGATGATGAGAGAT - UNI2153 - TTAATGAAGGAGTTTCCCCTCCTAAGCATGTTCAATATCCATGAGAACCTTCTAGAAGCTCTTCTGGAACTC

CAAGCTTATGCTGATGTTCAGGCAGTCTTAGCAAAGTATGATG ATATAAGCTTACCAAAGTCGGCGACAATATGCTACACAGCCGCCCTGCTCAAAGCA

AGAGCTGTCTCTGACAA ATTCTCTCCAGAGGCTGCGTCTCGGAGGGGGCTGAGCACAGCAGAGATGAATGCAGTAGAAGCCATCCACAGAGCTGTGGAA

TTTAATCCACACGTGCCAAAA TATCTACTAGAAATGAAAAGCTTAATCCTCCCACCAGAACACATCCTGAAGAGAGGAGACAGTGAAGCGATAGCATAT

GCATTCTTTCATCTTGCACACTGGAAGAGGGTGGAAGGGGCTTTGAATCTCTTGCATT - UNI28112 - CTTTCCGGATGATCCCGTATCCCCTGGA

GAAGGGACACCTATTTTATCCATACCCAATCTGTACAGAAACAGCTGACCGGGAGCTGCTTCCCT CTTTCCATGAAGTCTCAGTTTACCCAAAGAAGGA

ACTTCCCTTCTTCATCCTCTTCACTGCTGGACTGTGCTCCTTCACAGCCATGCTGGCCCTCCTGACACATCAGTTTCCGGAACTTATGGGAGTCTTCGCA

AAAGCT TTCCTCAGCACTTTGTTTGCCCCCTTGAACTTTGTTATGGAGAAAGTGGAAAGCATCCTCCCCTCCAGTTTGTGGCATCAGCTGACACGGATC

TGAGGGAGCCTCCCATCCTTCACTTTCCACACCATCCACCATCTCTTCTGTGCCAACCTCTCATGGACCGCAAGAAAGCATGACTTTGAAAAAGGGAAAC

CATTCTGAGATTTTAAACTGCTCATGGACTATCAGTTCCTTATTAAAGGCTGGTTTTGTTGTACAAAATTTATTGATGTTCAGTTCTATTTTATTTTGCC

TTCAAAACTGACTGATCAAAAAGTAAAAAAAATAAATAAATAAACTTTTGTGTATTGCAA
Translation
MAEAGAGFLEQLKSCIVWSWTYLWTVWFFLVLFLVYILRVPLRINDNLSTV VSMFLNTLTPKFYVALTGTSSLISGLIL - UNI32194 - IFEWWY

FRKYGTSFIEQVSVSHLRPLLGGVDNNSSNNSNSSNGDSDSNRQSVSE - UNI33542 - ECKVWRNPLNLFRGAEYNR RYTWVTGREPLTYYDMNL

SAQDHQTFFTCDSDHLRPADAI IMQKAWRERNPQARISAAHEALEINE EIRSRVEVPLIASSTIWEIKLLPK KCATAYILLAEEEATTIAEAEKLFK

QALKAGDGCYRRSQQLQHHGSQYEAQHR RRDTNVLVYIKRRLAMCARRLGRTREAVKMMRD - UNI2153 - LMKEFPLLSMFNIHENLLEALLELQ

AYADVQAVLAKYDD DISLPKSATICYTAALLKARAVSDK KFSPEAASRRGLSTAEMNAVEAIHRAVEFNPHVPK YLLEMKSLILPPEHILKRGDSEA

IAYAFFHLAHWKRVEGALNLLHS - UNI28112 - SFRMIPYPLEKGHLFYPYPICTETADRELLPS SFHEVSVYPKKELPFFILFTAGLCSFTAML

ALLTHQFPELMGVFAKA FLSTLFAPLNFVMEKVESILPSSLWHQLTRI
Transcript ENSMUST00000115420
Sequence
CGCCCGGGCTGTCCTCCTAAAATACTAGTACAAGAAGTATAAATGGCCCGGGAGAGTGCAGGGACCGGGCCCACGTGACCGCTCCACGAAGGCCACCGGC

GGGGGCTCGGAGCGCAGGCCGCGCGCTTTCCCGCCGCATCCGGGCGCCGGGCGAGCTCCGGGGACGCCGGGCCCTGGCGGCGGCGGCGGCTCGAGCCGTG

CCTCGGGCGGGTGAATCATCCCGGCCGACAGCGAGCGCCGCGGCGGCCCGTAGCAGCGCCGGAAGATGGCCGAGGCGGGCGCGGGCTTCCTGGAGCAGCT

CAAGTCCTGCATCGTGTGGTCGTGGACCTATCTGTGGACCGTGTGGTTCTTCCTCGTGCTCTTCCTGGTCTACATCCTGAGGGTGCCCCTGAGGATCAAC

GACAACCTGAGCACAG TGAGCATGTTTTTGAACACGTTAACCCCAAAGTTCTACGTGGCCCTGACAGGCACTTCCTCGCTAATATCGGGACTTATTTTG

 - UNI32194 - ATATTTGAATGGTGGTATTTTCGCAAGTATGGAACATCTTTCATTGAACAAGTCTCCGTAAGCCACTTGCGCCCCCTTCTGGGAGG

GGTTGACAACAACTCTTCCAATAATTCTAATTCCAGTAATGGAGACTCAGATTCCAACAGACAAAGTGTCTCAG - UNI33542 - AATGCAAAGTAT

GGCGAAATCCACTGAATCTGTTTAGGGGTGCGGAATATAATCG GTACACTTGGGTCACAGGACGAGAGCCTCTGACCTACTATGACATGAACCTCTCTG

CCCAGGACCACCAGACATTCTTTACTTGTGATTCAGATCATCTTCGCCCTGCAGATGCAA TAATGCAAAAAGCTTGGAGAGAAAGGAACCCTCAAGCCA

GGATTTCTGCAGCTCATGAAGCCTTGGAGATAAACGA GTGTGCAACTGCGTACATTCTCTTGGCGGAAGAAGAAGCGACAACTATTGCTGAAGCAGAAA

AACTCTTTAAGCAGGCCCTGAAGGCTGGAGATGGTTGTTACCGGCGCTCTCAGCAGCTACAACATCATGGGTCCCAGTATGAAGCTCAACACA GACGAG

ACACCAATGTCTTAGTCTATATCAAAAGAAGGCTGGCGATGTGTGCCCGGAGACTTGGAAGGACCAGAGAAGCAGTGAAGATGATGAGAGAT - UNI21

53 - TTAATGAAGGAGTTTCCCCTCCTAAGCATGTTCAATATCCATGAGAACCTTCTAGAAGCTCTTCTGGAACTCCAAGCTTATGCTGATGTTCAGGC

AGTCTTAGCAAAGTATGATG ATATAAGCTTACCAAAGTCGGCGACAATATGCTACACAGCCGCCCTGCTCAAAGCAAGAGCTGTCTCTGACAA ATTCT

CTCCAGAGGCTGCGTCTCGGAGGGGGCTGAGCACAGCAGAGATGAATGCAGTAGAAGCCATCCACAGAGCTGTGGAATTTAATCCACACGTGCCAAAA T

ATCTACTAGAAATGAAAAGCTTAATCCTCCCACCAGAACACATCCTGAAGAGAGGAGACAGTGAAGCGATAGCATATGCATTCTTTCATCTTGCACACTG

GAAGAGGGTGGAAGGGGCTTTGAATCTCTTGCATTGTACGTGGGAAGGCA - UNI28112 - CTTTCCATGAAGTCTCAGTTTACCCAAAGAAGGAAC

TTCCCTTCTTCATCCTCTTCACTGCTGGACTGTGCTCCTTCACAGCCATGCTGGCCCTCCTGACACATCAGTTTCCGGAACTTATGGGAGTCTTCGCAAA

AGCT TTCCTCAGCACTTTGTTTGCCCCCTTGAACTTTGTTATGGAGAAAGTGGAAAGCATCCTCCCCTCCAGTTTGTGGCATCAGCTGACACGGATCTG

AGGGAGCCTCCCATCCTTCACTTTCCACACCATCCACCATCTCTTCTGTGCCAACCTCTCATGGACCGCAAGAAAGCATGACTTTGAAAAAGGGAAACCA

TTCTGAGATTTTAAACTGCTCATGGACTATCAGTTCCTTATTAAAGGCTGGTTTTGTTGTACAAAATTTATTGATGTTCAGTTCTATTTTATTTTGCCTT

CAAAACTGACTGATCAAAAAGTAAAAAAAATAAATAAATAAACTTTTGTGTATTGCAA
Translation
MAEAGAGFLEQLKSCIVWSWTYLWTVWFFLVLFLVYILRVPLRINDNLSTV VSMFLNTLTPKFYVALTGTSSLISGLIL - UNI32194 - IFEWWY

FRKYGTSFIEQVSVSHLRPLLGGVDNNSSNNSNSSNGDSDSNRQSVSE - UNI33542 - ECKVWRNPLNLFRGAEYNR RYTWVTGREPLTYYDMNL

SAQDHQTFFTCDSDHLRPADAI IMQKAWRERNPQARISAAHEALEINE ECATAYILLAEEEATTIAEAEKLFKQALKAGDGCYRRSQQLQHHGSQYEA

QHR RRDTNVLVYIKRRLAMCARRLGRTREAVKMMRD - UNI2153 - LMKEFPLLSMFNIHENLLEALLELQAYADVQAVLAKYDD DISLPKSATI

CYTAALLKARAVSDK KFSPEAASRRGLSTAEMNAVEAIHRAVEFNPHVPK YLLEMKSLILPPEHILKRGDSEAIAYAFFHLAHWKRVEGALNLLHCTW

EGT - UNI28112 - TFHEVSVYPKKELPFFILFTAGLCSFTAMLALLTHQFPELMGVFAKA FLSTLFAPLNFVMEKVESILPSSLWHQLTRI
Transcript ENSMUST00000081635
Sequence
ATGGCCGAGGCGGGCGCGGGCTTCCTGGAGCAGCTCAAGTCCTGCATCGTGTGGTCGTGGACCTATCTGTGGACCGTGTGGTTCTTCCTCGTGCTCTTCC

TGGTCTACATCCTGAGGGTGCCCCTGAGGATCAACGACAACCTGAGCACAG TGAGCATGTTTTTGAACACGTTAACCCCAAAGTTCTACGTGGCCCTGA

CAGGCACTTCCTCGCTAATATCGGGACTTATTTTG - UNI32194 - ATATTTGAATGGTGGTATTTTCGCAAGTATGGAACATCTTTCATTGAACAA

GTCTCCGTAAGCCACTTGCGCCCCCTTCTGGGAGGGGTTGACAACAACTCTTCCAATAATTCTAATTCCAGTAATGGAGACTCAGATTCCAACAGACAAA

GTGTCTCAG - UNI33542 - AATGCAAAGTATGGCGAAATCCACTGAATCTGTTTAGGGGTGCGGAATATAATCG GTACACTTGGGTCACAGGACG

AGAGCCTCTGACCTACTATGACATGAACCTCTCTGCCCAGGACCACCAGACATTCTTTACTTGTGATTCAGATCATCTTCGCCCTGCAGATGCAA TAAT

GCAAAAAGCTTGGAGAGAAAGGAACCCTCAAGCCAGGATTTCTGCAGCTCATGAAGCCTTGGAGATAAACGA AATTAGGTCCAGAGTTGAAGTTCCCCT

AATTGCTTCCTCTACCATCTGGGAGATAAAATTGTTACCAAA GTGTGCAACTGCGTACATTCTCTTGGCGGAAGAAGAAGCGACAACTATTGCTGAAGC

AGAAAAACTCTTTAAGCAGGCCCTGAAGGCTGGAGATGGTTGTTACCGGCGCTCTCAGCAGCTACAACATCATGGGTCCCAGTATGAAGCTCAACACA G

ACGAGACACCAATGTCTTAGTCTATATCAAAAGAAGGCTGGCGATGTGTGCCCGGAGACTTGGAAGGACCAGAGAAGCAGTGAAGATGATGAGAGAT - 

UNI2153 - TTAATGAAGGAGTTTCCCCTCCTAAGCATGTTCAATATCCATGAGAACCTTCTAGAAGCTCTTCTGGAACTCCAAGCTTATGCTGATGTT

CAGGCAGTCTTAGCAAAGTATGATG ATATAAGCTTACCAAAGTCGGCGACAATATGCTACACAGCCGCCCTGCTCAAAGCAAGAGCTGTCTCTGACAA 

ATTCTCTCCAGAGGCTGCGTCTCGGAGGGGGCTGAGCACAGCAGAGATGAATGCAGTAGAAGCCATCCACAGAGCTGTGGAATTTAATCCACACGTGCCA

AAA TATCTACTAGAAATGAAAAGCTTAATCCTCCCACCAGAACACATCCTGAAGAGAGGAGACAGTGAAGCGATAGCATATGCATTCTTTCATCTTGCA

CACTGGAAGAGGGTGGAAGGGGCTTTGAATCTCTTGCATTGTACGTGGGAAGGCA - UNI28112 - CTTTCCGGATGATCCCGTATCCCCTGGAGAA

GGGACACCTATTTTATCCATACCCAATCTGTACAGAAACAGCTGACCGGGAGCTGCTTCCCT CTTTCCATGAAGTCTCAGTTTACCCAAAGAAGGAACT

TCCCTTCTTCATCCTCTTCACTGCTGGACTGTGCTCCTTCACAGCCATGCTGGCCCTCCTGACACATCAGTTTCCGGAACTTATGGGAGTCTTCGCAAAA

GCT TTCCTCAGCACTTTGTTTGCCCCCTTGAACTTTGTTATGGAGAAAGTGGAAAGCATCCTCCCCTCCAGTTTGTGGCATCAGCTGACACGGATCTGA

GGGAGCCTCCCATCCTTCACTTTCCACACCATCCACCATCTCTTCTGTGCCAACCTCTCATGGACCGCAAGAAAGCATGACTTTGAAAAAGGGAAACCAT

TCTGAGATTTTAAACTGCTCATGGACTATCAGTTCCTTATTAAAGGCTGGTTTTGTTGTACAAAATTTATTGATGTTCAGTTCTATTTTATTTTGCCTTC

AAAACTGACTGATCAAAAAGTAAAAAAAATAAATAAATAAACTTTTGTGTATTGC
Translation
MAEAGAGFLEQLKSCIVWSWTYLWTVWFFLVLFLVYILRVPLRINDNLSTV VSMFLNTLTPKFYVALTGTSSLISGLIL - UNI32194 - IFEWWY

FRKYGTSFIEQVSVSHLRPLLGGVDNNSSNNSNSSNGDSDSNRQSVSE - UNI33542 - ECKVWRNPLNLFRGAEYNR RYTWVTGREPLTYYDMNL

SAQDHQTFFTCDSDHLRPADAI IMQKAWRERNPQARISAAHEALEINE EIRSRVEVPLIASSTIWEIKLLPK KCATAYILLAEEEATTIAEAEKLFK

QALKAGDGCYRRSQQLQHHGSQYEAQHR RRDTNVLVYIKRRLAMCARRLGRTREAVKMMRD - UNI2153 - LMKEFPLLSMFNIHENLLEALLELQ

AYADVQAVLAKYDD DISLPKSATICYTAALLKARAVSDK KFSPEAASRRGLSTAEMNAVEAIHRAVEFNPHVPK YLLEMKSLILPPEHILKRGDSEA

IAYAFFHLAHWKRVEGALNLLHCTWEGT - UNI28112 - TFRMIPYPLEKGHLFYPYPICTETADRELLPS SFHEVSVYPKKELPFFILFTAGLCS

FTAMLALLTHQFPELMGVFAKA FLSTLFAPLNFVMEKVESILPSSLWHQLTRI
Transcript ENSMUST00000115418
Sequence
CCGGCCGACAGCGAGCGCCGCGGCGGCCCGTAGCAGCGCCGGAAGATGGCCGAGGCGGGCGCGGGCTTCCTGGAGCAGCTCAAGTCCTGCATCGTGTGGT

CGTGGACCTATCTGTGGACCGTGTGGTTCTTCCTCGTGCTCTTCCTGGTCTACATCCTGAGGGTGCCCCTGAGGATCAACGACAACCTGAGCACAG TGA

GCATGTTTTTGAACACGTTAACCCCAAAGTTCTACGTGGCCCTGACAGGCACTTCCTCGCTAATATCGGGACTTATTTTG - UNI32194 - ATATTT

GAATGGTGGTATTTTCGCAAGTATGGAACATCTTTCATTGAACAAGTCTCCGTAAGCCACTTGCGCCCCCTTCTGGGAGGGGTTGACAACAACTCTTCCA

ATAATTCTAATTCCAGTAATGGAGACTCAGATTCCAACAGACAAAGTGTCTCAG - UNI33542 - AATGCAAAGTATGGCGAAATCCACTGAATCTG

TTTAGGGGTGCGGAATATAATCG GTACACTTGGGTCACAGGACGAGAGCCTCTGACCTACTATGACATGAACCTCTCTGCCCAGGACCACCAGACATTC

TTTACTTGTGATTCAGATCATCTTCGCCCTGCAGATGCAA TAATGCAAAAAGCTTGGAGAGAAAGGAACCCTCAAGCCAGGATTTCTGCAGCTCATGAA

GCCTTGGAGATAAACGA GTGTGCAACTGCGTACATTCTCTTGGCGGAAGAAGAAGCGACAACTATTGCTGAAGCAGAAAAACTCTTTAAGCAGGCCCTG

AAGGCTGGAGATGGTTGTTACCGGCGCTCTCAGCAGCTACAACATCATGGGTCCCAGTATGAAGCTCAACACA GACGAGACACCAATGTCTTAGTCTAT

ATCAAAAGAAGGCTGGCGATGTGTGCCCGGAGACTTGGAAGGACCAGAGAAGCAGTGAAGATGATGAGAGAT - UNI2153 - TTAATGAAGGAGTTT

CCCCTCCTAAGCATGTTCAATATCCATGAGAACCTTCTAGAAGCTCTTCTGGAACTCCAAGCTTATGCTGATGTTCAGGCAGTCTTAGCAAAGTATGATG

 ATATAAGCTTACCAAAGTCGGCGACAATATGCTACACAGCCGCCCTGCTCAAAGCAAGAGCTGTCTCTGACAA ATTCTCTCCAGAGGCTGCGTCTCGG

AGGGGGCTGAGCACAGCAGAGATGAATGCAGTAGAAGCCATCCACAGAGCTGTGGAATTTAATCCACACGTGCCAAAA TATCTACTAGAAATGAAAAGC

TTAATCCTCCCACCAGAACACATCCTGAAGAGAGGAGACAGTGAAGCGATAGCATATGCATTCTTTCATCTTGCACACTGGAAGAGGGTGGAAGGGGCTT

TGAATCTCTTGCATTGTACGTGGGAAGGCA - UNI28112 - TTCCTCAGCACTTTGTTTGCCCCCTTGAACTTTGTTATGGAGAAAGTGGAAAGCAT

CCTCCCCTCCAGTTTGTGGCATCAGCTGACACGGATCTGAGGGAGCCTCCCATCCTTCACTTTCCACACCATCCACCATCTCTTCTGTGCCAACCTCTCA

TGGACCGCAAGAAAGCATGACTTTGAAAAAGGGAAACCATTCTGAGATTTTAAACTGCTCATGGACTATCAGTTCCTTATTAAAGGCTGGTTTTGTTGTA

CAAAATTTATTGATGTTCAGTTCTATTTTATTTTGCCTTCA
Translation
MAEAGAGFLEQLKSCIVWSWTYLWTVWFFLVLFLVYILRVPLRINDNLSTV VSMFLNTLTPKFYVALTGTSSLISGLIL - UNI32194 - IFEWWY

FRKYGTSFIEQVSVSHLRPLLGGVDNNSSNNSNSSNGDSDSNRQSVSE - UNI33542 - ECKVWRNPLNLFRGAEYNR RYTWVTGREPLTYYDMNL

SAQDHQTFFTCDSDHLRPADAI IMQKAWRERNPQARISAAHEALEINE ECATAYILLAEEEATTIAEAEKLFKQALKAGDGCYRRSQQLQHHGSQYEA

QHR RRDTNVLVYIKRRLAMCARRLGRTREAVKMMRD - UNI2153 - LMKEFPLLSMFNIHENLLEALLELQAYADVQAVLAKYDD DISLPKSATI

CYTAALLKARAVSDK KFSPEAASRRGLSTAEMNAVEAIHRAVEFNPHVPK YLLEMKSLILPPEHILKRGDSEAIAYAFFHLAHWKRVEGALNLLHCTW

EGI - UNI28112 - IPQHFVCPLELCYGESGKHPPLQFVASADTDLREPPILHFPHHPPSLLCQPLMDRKKA

For any suggestions or comments, please send an email to unitrap@crg.es