Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000029550 (Sppl3)
Chromosomal location
Chr 5: 115461533 - 115548799 (+)
Description
signal peptide peptidase 3 Gene [Source:MGI (curated);Acc:Sppl3-001]
RefSeq_dna
NM_029012 
RefSeq_peptide
NP_083288.2 
UniGene
Mm.355894 
MGI
MGI:1891433 
Uniprot/SWISSPROT
Q9CUS9 
Uniprot/SPTREMBL
Q5RJH9 
Human Ortholog
ENSG00000157837 (AC069234.35-201)
Omim not available
UniTrap UNI29650
Vector Insertion
Chr 5: 115461625 - 115511187
Public Clones (sanger) E042D07 (ggtc) D099G02 (ggtc) E127A03 (ggtc) D017E07 (ggtc)
IST14373G1 (tigm) IST14365H10 (tigm) IST15094E1 (tigm) IST14469C3 (tigm)
IST14149B11 (tigm) IST14159C8 (tigm) IST11191B11 (tigm) IST14325D11 (tigm)
IST14771C11 (tigm) IST12182G3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16396
Vector Insertion
Chr 5: 115511571 - 115511649
Public Clones not available
Private Clones OST461759 (lexicon) OST461186 (lexicon) OST436070 (lexicon) OST432141 (lexicon)
OST430317 (lexicon) OST416979 (lexicon) OST413829 (lexicon) OST401041 (lexicon)
OST384662 (lexicon) OST382302 (lexicon) OST374718 (lexicon) OST345794 (lexicon)
OST267726 (lexicon) OST160543 (lexicon) OST147828 (lexicon) OST135801 (lexicon)
OST114054 (lexicon) OST113258 (lexicon) OST97544 (lexicon) OST66914 (lexicon)
OST60923 (lexicon) OST56680 (lexicon) OST48953 (lexicon) OST43557 (lexicon)
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15803
Vector Insertion
Chr 5: 115511649 - 115524823
Public Clones IST14673D1 (tigm)
Private Clones OST472789 (lexicon) OST408669 (lexicon) OST360322 (lexicon) OST308894 (lexicon)
OST279815 (lexicon)
Severity of mutation (?) Insertion after 9% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI35113
Vector Insertion
Chr 5: 115532350 - 115533433
Public Clones IST13802H7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 27% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17281
Vector Insertion
Chr 5: 115534975 - 115538298
Public Clones CMHD-GT_539H1-3S (cmhd) CMHD-GT_539H1-5S (cmhd)
Private Clones OST445980 (lexicon)
Severity of mutation (?) Insertion after 44% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11248
Vector Insertion
Chr 5: 115538996 - 115545059
Public Clones G086D09 (ggtc) IST14803A6 (tigm)
Private Clones OST335548 (lexicon)
Severity of mutation (?) Insertion after 67% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000031530
Sequence
CGCCGGGGCCCCCGGCCGCGCCCTCTGCCGCCGGCCGAGCGAGCCGCGGAGCCCCCGAGAGGCAGCACCATGGCGGAACAGACCTATTCGTG - UNI29

650 - GGCCTATTCCCTGGTGGACTCCAGTCAAGTGTCGACATTTCTGATATCCATTCTTCTTATAGTCTATGGTAGTTTCAG - UNI15803 - - 

UNI16396 - GTCTCTTAATATGGACTTTGAAAACCAAGATAAGGAGAAAGACAGCAACAGTTCTTCTGGCTCTTTCAATGGCAACAGCACCAATAACA

 GCATCCAGACCATTGATTCCACCCAAGCACTGTTCCTCCCGATTGGAGCGTCTGTCTCTCTCCTCGTCATGTTCTTCTTCTTTGATTCAGTTCAAGTCG

TTTTCACAATATGTACAGCAG - UNI35113 - TTCTTGCAACAATAGCTTTTGCTTTTCTTCTTCTCCCGATGTGCCAGTATTTAACAAGGCCCTGC

TCACCTCAGAACAA GATTTCCTTCGGTTGCTGTGGGCGTTTCACTGCTGCCGAGCTGCTGTCGTTCTCCCTGTCTGTCATGCTCGTCCTCATCTGGGTT

CTCACTGGCCACTGGCTTCTCATGGATG - UNI17281 - CTCTGGCCATGGGTCTCTGTGTTGCCATGATCGCCTTCGTCCGCCTGCCAAGCCTCAA

GGTTTCCTGCCTGCTTCTCTCAGGGCTTCTCATCTACGATGTCTTCTGG GTGTTCTTCTCAGCCTACATCTTCAACAGTAATGTCATGGTGAAAGTGGC

CACACAGCCAGCTGACAATCCCCTCGACGTTCTGTCCAGGAAGCTCCACCTGGGACCCAATGTGGGGCGTGATGTTCCTCGCCTGTCTTTGCCTGGAAAA

TTGGTCTTCCCAAG - UNI11248 - CTCCACTGGCAGTCACTTCTCTATGCTGGGCATCGGGGACATTGTGATGCCCGGCCTCCTGTTATGCTTTGT

TCTTCGCTATGACAACTACAAGAAACAAGCCAGTGGTGACTCGTGTGGGGCCCCTGGCCCAGCCAATATCTCTGGGCGCATGCAGAAGGTCTCCTACTTC

CACTGCACCCTCATCGGGTACTTTGTAG GTCTGCTCACTGCGACTGTGGCGTCTCGCATCCACCGAGCTGCCCAGCCAGCTCTCCTCTACTTGGTGCCA

TTTACCCTATTGCCACTCCTCACCATGGCCTACCTAAAG GGTGACTTACGGAGGATGTGGTCTGAGCCCTTCCACTCCAAGTCCAGCAGCTCCCGGTTC

CTGGAAGTATGATGACGCGGGAGAGGTGACCAGAGCGCTGTCCTCACCTTCCTCTCTCACCGCGCGGTTTTGTTCCCTCTACAAGCTGGCCTGACTCAGG

CATGCCTGCTCACGGAACTGCAGTGTGACTGGAGTGTGTGTCTGAGGGGAGCGTTTGCAGAGGGCACTGGAGCCCTGCACAGCCCTTCTCTTCTCCGCTC

TGGGAGAGTGGACCCTTCCAGAAGGGGCAGGCCGGCCCTTCGCCCGGTGCTCCTCCTTCCTCGTGTTTTTATGGATCTGCACCAGACTGTTAACTTGTGG

GGAGATGGCGAAGTTGACTTATTTAAAAACTACAAACAGCAAGTTGTTGTTCTAGAACTTTGAACACTAAATGGAAGAAAATCCATTAGCAGACCGAAGT

CTCTTCAGTGAACCCTCCGAAACTCTGGGACCAGTTTCCTCTGGGGGCTCCATACAGAGACCCAGGGCAGAACTTCTGCCCTATTTTTTTTCTTTTTTCT

TTTGGATTTATTAAATATTTTCTGTGGTGTGAAGTGACTTATTACATCCACAGACATTGAATGACTTCTTACAACATACACATAAGAATTTGTTGTAATG

ACTGTGTCCAGCCGTGTTGGCAGTGAGCAGGACGCGGTTGGTTTATACATACGTACATATATATATATATATACACACACGTGCACATAGATATCTGTGA

GTAAACAGCGACTAAGCCTGCTAAGGTCACGCCATGCAGCTGCCGGGGGCTTGCTGTCATGGGAGCATGTAGAACAGTTTACCTGGCTTCCTCGCACACG

CTGCTGTCTCCCTTGAGAGTCGCGTGCGGTTGTAAGCTGTGGATGCGCTGAACTGATAGACTTGTGGGCTGTGGGGACTCCTCCTTTTGATCAGTGTAGC

AAATTAGGGATGAAAAGTTTGAACTTTTTGACCCTTTTCTTTTTACAGGCTTTTCCCTCGCAGTTTTTAGTAACCGCCTCTTGAACCAGTGCATGTATTA

TAGCAGCCGGTGTCTTTGTGCTTTCTGATCATAGTTATGTACTACCTGTAAATACATTTTTCTATTTTATATTTTTTTGTATTTTTTTTGACATTTCGTT

TCATTGGTGCGCTGTATTTTCCATGCCCTCAGTCCCTTAGAAAAGACAAAACAGAAAAAAGCAACGCAACTCTGTCCTTGCTGTGATGATCACAGCCTCA

GTTTACCTGTGGTGACAGCAGGCTGTGGGGACAAATGTCAGTTGCCTCTGCAAATGGAGCTGAAGTCCAGGAGCTGGAGACAGAGCAGGCTGCTGCTGTG

ACTTCAAAACCTGGCCCCGCGCTGTTGCTGTCCGTGGGCTGCACAGAGCCTGGCATCACCATCACCTCACACTTGGTTAGCTGCTGCCTGGGTGCGAGGC

GGCAGGCCCTAGAGTCTGTTCCTTCCCGGGGCCGCTGGCATCGTGGCCTGCCTGTCCCTATTCCTGCAGACATTGTGCAGAGTGCACAGCCCATCGTGTC

CATGGAGCAGCGTGCCACCAAGTTGTTGGTTCCTCTGTCGTCTTCAGACTCTGTTGAGGGGTTTGAAGGGTTGGTTTTGTCTCTAATAAATGACTCCTTT

TTCTA
Translation
MAEQTYSW - UNI29650 - WAYSLVDSSQVSTFLISILLIVYGSFR - UNI15803 - - UNI16396 - RSLNMDFENQDKEKDSNSSSGSFN

GNSTNNS SIQTIDSTQALFLPIGASVSLLVMFFFFDSVQVVFTICTAV - UNI35113 - VLATIAFAFLLLPMCQYLTRPCSPQNK KISFGCCGR

FTAAELLSFSLSVMLVLIWVLTGHWLLMDA - UNI17281 - ALAMGLCVAMIAFVRLPSLKVSCLLLSGLLIYDVFW VFFSAYIFNSNVMVKVATQ

PADNPLDVLSRKLHLGPNVGRDVPRLSLPGKLVFPS - UNI11248 - SSTGSHFSMLGIGDIVMPGLLLCFVLRYDNYKKQASGDSCGAPGPANISG

RMQKVSYFHCTLIGYFVG GLLTATVASRIHRAAQPALLYLVPFTLLPLLTMAYLK GDLRRMWSEPFHSKSSSSRFLEV
Transcript ENSMUST00000112134
Sequence
ATTAAGAAACAAGAAAAGGAGTGG - UNI16396 - GCCTATTCCCTGGTGGACTCCAGTCAAGTGTCGACATTTCTGATATCCATTCTTCTTATAGT

CTATGGTAGTTTCAG - UNI15803 - - UNI16396 - GTCTCTTAATATGGACTTTGAAAACCAAGATAAGGAGAAAGACAGCAACAGTTCTTCT

GGCTCTTTCAATGGCAACAGCACCAATAACA GCATCCAGACCATTGATTCCACCCAAGCACTGTTCCTCCCGATTGGAGCGTCTGTCTCTCTCCTCGTC

ATGTTCTTCTTCTTTGATTCAGTTCAAGTCGTTTTCACAATATGTACAGCAG - UNI35113 - TTCTTGCAACAATAGCTTTTGCTTTTCTTCTTCT

CCCGATGTGCCAGTATTTAACAAGGCCCTGCTCACCTCAGAACAA GATTTCCTTCGGTTGCTGTGGGCGTTTCACTGCTGCCGAGCTGCTGTCGTTCTC

CCTGTCTGTCATGCTCGTCCTCATCTGGGTTCTCACTGGCCACTGGCTTCTCATGGATG - UNI17281 - CTCTGGCCATGGGTCTCTGTGTTGCCA

TGATCGCCTTCGTCCGCCTGCCAAGCCTCAAGGTTTCCTGCCTGCTTCTCTCAGGGCTTCTCATCTACGATGTCTTCTGG GTGTTCTTCTCAGCCTACA

TCTTCAACAGTAATGTCATGGTGAAAGTGGCCACACAGCCAGCTGACAATCCCCTCGACGTTCTGTCCAGGAAGCTCCACCTGGGACCCAATGTGGGGCG

TGATGTTCCTCGCCTGTCTTTGCCTGGAAAATTGGTCTTCCCAAG - UNI11248 - CTCCACTGGCAGTCACTTCTCTATGCTGGGCATCGGGGACA

TTGTGATGCCCGGCCTCCTGTTATGCTTTGTTCTTCGCTATGACAACTACAAGAAACAAGCCAGTGGTGACTCGTGTGGGGCCCCTGGCCCAGCCAATAT

CTCTGGGCGCATGCAGAAGGTCTCCTACTTCCACTGCACCCTCATCGGGTACTTTGTAG GTCTGCTCACTGCGACTGTGGCGTCTCGCATCCACCGAGC

TGCCCAGCCAGCTCTCCTCTACTTGGTGCCATTTACCCTATTGCCACTCCTCACCATGGCCTACCTAAAG GGTGACTTACGGAGGATGTGGTCTGAGCC

CTTCCACTCCAAGTCCAGCAGCTCCCGGTTCCTGGAAGTATGATGACGCGGGAGAGGTGACCAGAGCGCTGTCCTCACCTTCCTCTCTCACCGCGCGGTT

TTGTTCCCTCTACAAGCTGGCCTGACTCAGGCATGCCTGCTCACGGAACTGCAGTGTGACTGGAGTGTGTGTCTGAGGGGAGCGTTTGCAGAGGGCACTG

GAGCCCTGCACAGCCCTTCTCTTCTCCGCTCTGGGAGAGTGGACCCTTCCAGAAGGGGCAGGCCGGCCCTTCGCCCGGTGCTCCTCCTTCCTCGTGTTTT

TATGGATCTGCACCAGACTGTTAACTTGTGGGGAGATGGCGAAGTTGACTTATTTAAAAACTACAAACAGCAAGTTGTTGTTCTAGAACTTTGAACACTA

AATGGAAGAAAATCCATTAGCAGACCGAAGTCTCTTCAGTGAACCCTCCGAAACTCTGGGACCAGTTTCCTCTGGGGGCTCCATACAGAGACCCAGGGCA

GAACTTCTGCCCTATTTTTTTTCTTTTTTCTTTTGGATTTATTAAATATTTTCTGTGGTGTGAAGTGACTTATTACATCCACAGACATTGAATGACTTCT

TACAACATACACATAAGAATTTGTTGTAATGACTGTGTCCAGCCGTGTTGGCAGTGAGCAGGACGCGGTTGGTTTATACATACGTACATATATATATATA

TATACACACACGTGCACATAGATATCTGTGAGTAAACAGCGACTAAGCCTGCTAAGGTCACGCCATGCAGCTGCCGGGGGCTTGCTGTCATGGGAGCATG

TAGAACAGTTTACCTGGCTTCCTCGCACACGCTGCTGTCTCCCTTGAGAGTCGCGTGCGGTTGTAAGCTGTGGATGCGCTGAACTGATAGACTTGTGGGC

TGTGGGGACTCCTCCTTTTGATCAGTGTAGCAAATTAGGGATGAAAAGTTTGAACTTTTTGACCCTTTTCTTTTTACAGGCTTTTCCCTCGCAGTTTTTA

GTAACCGCCTCTTGAACCAGTGCATGTATTATAGCAGCCGGTGTCTTTGTGCTTTCTGATCATAGTTATGTACTACCTGTAAATACATTTTTCTATTTT
Translation
IKKQEKEW - UNI16396 - AYSLVDSSQVSTFLISILLIVYGSFR - UNI15803 - - UNI16396 - RSLNMDFENQDKEKDSNSSSGSFNG

NSTNNS SIQTIDSTQALFLPIGASVSLLVMFFFFDSVQVVFTICTAV - UNI35113 - VLATIAFAFLLLPMCQYLTRPCSPQNK KISFGCCGRF

TAAELLSFSLSVMLVLIWVLTGHWLLMDA - UNI17281 - ALAMGLCVAMIAFVRLPSLKVSCLLLSGLLIYDVFW VFFSAYIFNSNVMVKVATQP

ADNPLDVLSRKLHLGPNVGRDVPRLSLPGKLVFPS - UNI11248 - SSTGSHFSMLGIGDIVMPGLLLCFVLRYDNYKKQASGDSCGAPGPANISGR

MQKVSYFHCTLIGYFVG GLLTATVASRIHRAAQPALLYLVPFTLLPLLTMAYLK GDLRRMWSEPFHSKSSSSRFLEV

For any suggestions or comments, please send an email to unitrap@crg.es