Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000029554 (Mad1l1)
Chromosomal location
Chr 5: 140484643 - 140797506 (-)
Description
mitotic arrest deficient 1-like 1 Gene [Source:MGI (curated);Acc:Mad1l1-001]
RefSeq_dna
NM_010752 
RefSeq_peptide
NP_034882.2 
UniGene
Mm.27250 
MGI
MGI:1341857 
Uniprot/SWISSPROT
Q9WTX8 
Uniprot/SPTREMBL
Q3TDV6 
Human Ortholog
ENSG00000002822 (MAD1L1)
Omim not available
UniTrap UNI2971
Vector Insertion
Chr 5: 140786690 - 140790943
Public Clones AB0086 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10386
Vector Insertion
Chr 5: 140776519 - 140778868
Public Clones PT175 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8736
Vector Insertion
Chr 5: 140771803 - 140776168
Public Clones XN734 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14666
Vector Insertion
Chr 5: 140737451 - 140771803
Public Clones E002C05 (ggtc) D103B06 (ggtc) FHCRC-GT-S2-2C1 (fhcrc)
Private Clones OST79667 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36008
Vector Insertion
Chr 5: 140669867 - 140737539
Public Clones IST11694D12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3581
Vector Insertion
Chr 5: 140650577 - 140669867
Public Clones AW0362 (sanger) AN0566 (sanger) AQ0598 (sanger) RRO016 (baygenomics)
RRM065 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26178
Vector Insertion
Chr 5: 140620015 - 140650486
Public Clones (sanger) IST13146B7 (tigm)
Private Clones OST132394 (lexicon) OST61480 (lexicon)
Severity of mutation (?) Insertion after 10% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2702
Vector Insertion
Chr 5: 140608780 - 140619873
Public Clones AL0166 (sanger)
Private Clones OST173272 (lexicon)
Severity of mutation (?) Insertion after 10% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2663
Vector Insertion
Chr 5: 140593280 - 140608722
Public Clones AQ0524 (sanger) (sanger) AL0568 (sanger) RRR053 (baygenomics) D162B06 (ggtc)
Private Clones OST170410 (lexicon)
Severity of mutation (?) Insertion after 66% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8445
Vector Insertion
Chr 5: 140564792 - 140581468
Public Clones RRQ011 (baygenomics) A037E01 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 74% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6035
Vector Insertion
Chr 5: 140564583 - 140564792
Public Clones XE538 (baygenomics) XG199 (baygenomics) YHD022 (baygenomics) W085E07 (ggtc)
W086B02 (ggtc) A062E01 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 74% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13723
Vector Insertion
Chr 5: 140541767 - 140541959
Public Clones CMHD-GT_269E9-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 84% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34291
Vector Insertion
Chr 5: 140541767 - 140564792
Public Clones (ggtc) IST12839E3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 84% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27101
Vector Insertion
Chr 5: 140485229 - 140541767
Public Clones CMHD-GT_459E6-3 (cmhd)
Private Clones OST70872 (lexicon)
Severity of mutation (?) Insertion after 93% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1169
Vector Insertion
Chr 5: 140485229 - 140541767
Public Clones AL0234 (sanger) AG0252 (sanger) AY0136 (sanger) XL074 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 93% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000031534
Sequence
GAGGGAGATCTGAGCGGCTGCTGCAGCACCGGGCTCCTCAACTGAG AAGGAGGCTGACCATGGAAGACCTCGGGGAGAACACCACAGTCCTCTCCTCCC

TGAGATCTCTGAACAACTTCATTTCTCAGCGAATGGAGGGAACATCAGGCCTGGATGTGTCCACGTCTGCCTCAGGGTCCCTACAGAAGCAGTATGAGTA

TCACATGCAG - UNI2971 - CTGGAGGAAAGAGCAGAGCAGATCCGCTCAAAGTCCTACCTCATCCAAGTGGAGCGGGAGAAGATGCAGATGGAGCT

GAGCCACAAGAGAGCCCGAGTGGAGCTGGAGAGAGCAGCCAGCACCAATGCCAGGAACTACGAG CGCGAGGTAGATCGCAACCAGGAGCTCCTGGCACG

CATTCGACAGCTCCAGGAGTGTGAGGCCACAGCAGAAGAGAAGATGCGGGAGCAGCTGGAGCGCCACAGGCTGTGCAAGCAAAACCTGGATGCTGTCAGT

CAGCAGCTGCGGGAACAGGAGGACAGCCTGGCTTCGGCCAGGGAG ATGATTAGTTCATTGAAGGGGCGTGTCTCGGAGCTGCAGTTGAGTGCCATGGAC

CAGAAGGTACAGGTCAAGCGGCTGGAGTCTGAAAAGCAGGAGCTGAAGGAGCAGCTGGAGCTGCAGCAGCG GAAATGGCAAGAGGCAAATCAGAAGATC

CAGGAGCTGCAGGCCAGTCAAGATGAGAGAGCTGAGCATGAGCAGAAGATTAAG - UNI10386 - GACCTGGAGCAGAAGCTGTGTCTACAAGAGCA

GGATGCAGCTGTGGTGAAGAGCATGAAGTCTGAGCTGATGCGGATGCCCAGGATGGAGCGTGAGCTGAAGAGGCTGCATGAAGAGAACACTCATCTAAG 

GGAGATGAAGGAGACCAATGGGCTGCTCACAGAGGAGCTGGAAGGTCTGCAGAGGAAACTGAGCCGGCAGGAGAAGATGCAGGAGGCTCTGGTTGACCTG

GAGTTGGAAAAGGAG - UNI8736 - - UNI14666 - AAGCTACTTGCAAAGCTGCAGAGCTGGGAGAACCTGGACCAGACCATGGGCTTGAATCT

CAG - UNI14666 - - UNI36008 - GACTCCAGAGGACCTTTCTAGGTTCGTGGTTGAGCTACAGCAGCGAGAGCTCACCCTGAAGGAGAAGAAT

AACAGCATCACCAGCAG - UNI14666 - - UNI36008 - TGCCCGGGGTCTGGAGAAGGTCCAGCAGCAGCTCCAGGATGAGGTCCGGCAGGCCA

ATGCACAGCTGCTGGAGGAGCGGAAAAAGAGGGAGACACATGAGGCACTTGCCCGAAGGCTCCAGAAGCGCAATGCATTGCTGACCAAG - UNI3581 

- - UNI26178 - - UNI36008 - GAGAGAGATGGCATGCGTGCCATCCTGGGATCCTACGACAGTGAGCTGACCCAAACTGAGTACTCAACCCAG

CTGACACAGCGCCTGTGGGAGGCCGAGGACATGGTTCAGAAGGTACATGCCCACAGCTCGGAGATGGAG - UNI2702 - GCTCAGCTGTCTCAGGCC

CTGGAGGAGCTTGGGGTTCAGAAGCAGAGAGCTGACACG - UNI2663 - CTGGAGATGGAGTTGAAGATGCTGAAGGCCCAGACAAGCTCAGCTGAA

TCTAGCTTCTCATTCTGCAAAGAGGAGGTGGATGCACTCAG GTTGAAGGTGGAGGAGCTGGAGGGTGAGCGGAGCCGTCTGGAACAGGAAAAGCAGGTG

CTGGAGATGCAGATGGAGAAACTAACCCTACAG - UNI6035 - - UNI8445 - - UNI34291 - GGTGACTACAACCAGAGTCGAACCAAAGT

GCTACACATGAGCCTTAACCCAATCAGCATGGCCAGGCAACGCCAGCATGAGGACCATGACCGGCTGCAGGAGGAATGTGAGCGCTTACGGGGACTTGTG

CATGCCCTGGAGAGAGGGGGCCCCATCCCTGCTGACCTGGAGGCTGCCTCCAGTCTGCCCTCATCAAAGGAGGTGGCAG - UNI6035 - - UNI137

23 - - UNI34291 - AGCTGCGGAAGCAGGTGGAAAGTGCTGAGCTGAAGAACCAGCGGCTGAAGGAGGTTTTCCAGACCAAGATCCAGGAGTTCCG

CAAAGTTTGCTACACGCTGACCGGCTACCAGATTGACGTGACCACGGAGAGCCAATACCGCCTCACCTCCCGATACGCTGAGCACCAGACGGACTGCCTC

ATCTTCAAG - UNI1169 - - UNI13723 - - UNI27101 - - UNI34291 - GCCACAGGACCCTCGGGCTCCAAGATGCAGCTGCTGGAG

ACAGAGTTCTCACGGTCTGTGCCTGAGCTCATTGAACTGCACTTGCTGCAGCAGGACAGCATCCCTGCCTTCCTCAGTGCGCTCACCATAGAGCTGTTCA

GCCGCCAGACCTCTATCTAGCCTCTTCCCATGAGCATCTTCACTACAGCCGCTGGACCTCGGCCTAGCCTGTACCTGCAGCTTCTCACATGCAGCCCCCA

GACCTTGAGCTAGCTCTTGGTCTACAGTTGCCCACATCATCCCCAGATCCCTTTGCCACCCATAGCTGCATCATGTCACAAACACTAGCCGTGGCCTCTG

CTCAAGCAGCCACTGTCTCTTGTCCCTGGCTAGGAGCAAGCTACTGGGGATGACCAAGCCAGATCATACCCCACTACTCTCCTCCCCACCCCACCCCATT

CTAGAGCCGCTCCACGTACTGTCCCAAGGTGTACCCCAGCCTCCAGTCCCATGCGCTGGTTGCTTAGGCTTCAGTGGCCAGACTGTAGCCTGTGTCCACA

GTCTCAGACTAATGAAATAAAGTGCTACCTTTATCTTCCTTCCCGGA
Translation
 MEDLGENTTVLSSLRSLNNFISQRMEGTSGLDVSTSASGSLQKQYEYHMQ - UNI2971 - LEERAEQIRSKSYLIQVEREKMQMELSHKRARVELE

RAASTNARNYE REVDRNQELLARIRQLQECEATAEEKMREQLERHRLCKQNLDAVSQQLREQEDSLASARE MISSLKGRVSELQLSAMDQKVQVKRLE

SEKQELKEQLELQQR RKWQEANQKIQELQASQDERAEHEQKIK - UNI10386 - DLEQKLCLQEQDAAVVKSMKSELMRMPRMERELKRLHEENTH

LR REMKETNGLLTEELEGLQRKLSRQEKMQEALVDLELEKE - UNI8736 - - UNI14666 - KLLAKLQSWENLDQTMGLNLR - UNI14666

 - - UNI36008 - RTPEDLSRFVVELQQRELTLKEKNNSITSS - UNI14666 - - UNI36008 - SARGLEKVQQQLQDEVRQANAQLLEER

KKRETHEALARRLQKRNALLTK - UNI3581 - - UNI26178 - - UNI36008 - ERDGMRAILGSYDSELTQTEYSTQLTQRLWEAEDMVQKV

HAHSSEME - UNI2702 - AQLSQALEELGVQKQRADT - UNI2663 - LEMELKMLKAQTSSAESSFSFCKEEVDALR RLKVEELEGERSRLEQ

EKQVLEMQMEKLTLQ - UNI6035 - - UNI8445 - - UNI34291 - GDYNQSRTKVLHMSLNPISMARQRQHEDHDRLQEECERLRGLVHALE

RGGPIPADLEAASSLPSSKEVAE - UNI6035 - - UNI13723 - - UNI34291 - ELRKQVESAELKNQRLKEVFQTKIQEFRKVCYTLTGYQ

IDVTTESQYRLTSRYAEHQTDCLIFK - UNI1169 - - UNI13723 - - UNI27101 - - UNI34291 - ATGPSGSKMQLLETEFSRSVPE

LIELHLLQQDSIPAFLSALTIELFSRQTSI
Transcript ENSMUST00000100508
Sequence
ATGAGTGGGCAGCAATCCTCCCAAGAGTTCAGTGGTCCCGGTCACTTAGTCCTCTCTCCGGCAGTGTCATGGATGAAGAGTGTGAGCCAG - UNI2702

 - - UNI26178 - GCTCAGCTGTCTCAGGCCCTGGAGGAGCTTGGGGTTCAGAAGCAGAGAGCTGACACG - UNI2663 - CTGGAGATGGAGTT

GAAGATGCTGAAGGCCCAGACAAGCTCAGCTGAATCTAGCTTCTCATTCTGCAAAGAGGAGGTGGATGCACTCAG GTTGAAGGTGGAGGAGCTGGAGGG

TGAGCGGAGCCGTCTGGAACAGGAAAAGCAGGTGCTGGAGATGCAGATGGAGAAACTAACCCTACAG - UNI6035 - - UNI8445 - - UNI342

91 - GGTGACTACAACCAGAGTCGAACCAAAGTGCTACACATGAGCCTTAACCCAATCAGCATGGCCAGGCAACGCCAGCATGAGGACCATGACCGGCT

GCAGGAGGAATGTGAGCGCTTACGGGGACTTGTGCATGCCCTGGAGAGAGGGGGCCCCATCCCTGCTGACCTGGAGGCTGCCTCCAGTCTGCCCTCATCA

AAGGAGGTGGCAG - UNI6035 - - UNI13723 - - UNI34291 - AGCTGCGGAAGCAGGTGGAAAGTGCTGAGCTGAAGAACCAGCGGCTGA

AGGAGGTTTTCCAGACCAAGATCCAGGAGTTCCGCAAAGTTTGCTACACGCTGACCGGCTACCAGATTGACGTGACCACGGAGAGCCAATACCGCCTCAC

CTCCCGATACGCTGAGCACCAGACGGACTGCCTCATCTTCAAG - UNI1169 - - UNI13723 - - UNI27101 - - UNI34291 - GCCAC

AGGACCCTCGGGCTCCAAGATGCAGCTGCTGGAGACAGAGTTCTCACGGTCTGTGCCTGAGCTCATTGAACTGCACTTGCTGCAGCAGGACAGCATCCCT

GCCTTCCTCAGTGCGCTCACCATAGAGCTGTTCAGCCGCCAGACCTCTATCTAGCCTCTTCCCATGAGCATCTTCACTACAGCCGCTGGACCTCGGCCTA

GCCTGTACCTGCAGCTTCTCACATGCAGCCCCCAGACCTTGAGCTAGCTCTTGGTCTACAGTTGCCCACATCATCCCCAGATCCCTTTGCCACCCATAGC

TGCATCATGTCACAAACACTAGCCGTGGCCTCTGCTCAAGCAGCCACTGTCTCTTGTCCCTGGCTAGGAGCAAGCTACTGGGGATGACCAAGCCAGATCA

TACCCCACTACTCTCCTCCCCACCCCACCCCATTCTAGAGCCGCTCCACGTACTGTCCCAAGGTGTACCCCAGCCTCCAGTCCCATGCGCTGGTTGCTTA

GGCTTCAGTGGCCAGACTGTAGCCTGTGTCCACAGTCTCAGACTAATGAAATAAAGTGCTACCTTTATCTTCCTTCCCGGA
Translation
MSGQQSSQEFSGPGHLVLSPAVSWMKSVSQ - UNI2702 - - UNI26178 - AQLSQALEELGVQKQRADT - UNI2663 - LEMELKMLKAQT

SSAESSFSFCKEEVDALR RLKVEELEGERSRLEQEKQVLEMQMEKLTLQ - UNI6035 - - UNI8445 - - UNI34291 - GDYNQSRTKVLH

MSLNPISMARQRQHEDHDRLQEECERLRGLVHALERGGPIPADLEAASSLPSSKEVAE - UNI6035 - - UNI13723 - - UNI34291 - ELR

KQVESAELKNQRLKEVFQTKIQEFRKVCYTLTGYQIDVTTESQYRLTSRYAEHQTDCLIFK - UNI1169 - - UNI13723 - - UNI27101 - 

- UNI34291 - ATGPSGSKMQLLETEFSRSVPELIELHLLQQDSIPAFLSALTIELFSRQTSI
Transcript ENSMUST00000110829
Sequence
GAGGGAGATCTGAGCGGCTGCTGCAGCACCGGGCTCCTCAACTGAG AAGGAGGCTGACCATGGAAGACCTCGGGGAGAACACCACAGTCCTCTCCTCCC

TGAGATCTCTGAACAACTTCATTTCTCAGCGAATGGAGGGAACATCAGGCCTGGATGTGTCCACGTCTGCCTCAGGGTCCCTACAGAAGCAGTATGAGTA

TCACATGCAG - UNI2971 - CTGGAGGAAAGAGCAGAGCAGATCCGCTCAAAGTCCTACCTCATCCAAGTGGAGCGGGAGAAGATGCAGATGGAGCT

GAGCCACAAGAGAGCCCGAGTGGAGCTGGAGAGAGCAGCCAGCACCAATGCCAGGAACTACGAG CGCGAGGTAGATCGCAACCAGGAGCTCCTGGCACG

CATTCGACAGCTCCAGGAGTGTGAGGCCACAGCAGAAGAGAAGATGCGGGAGCAGCTGGAGCGCCACAGGCTGTGCAAGCAAAACCTGGATGCTGTCAGT

CAGCAGCTGCGGGAACAGGAGGACAGCCTGGCTTCGGCCAGGGAG ATGATTAGTTCATTGAAGGGGCGTGTCTCGGAGCTGCAGTTGAGTGCCATGGAC

CAGAAGGTACAGGTCAAGCGGCTGGAGTCTGAAAAGCAGGAGCTGAAGGAGCAGCTGGAGCTGCAGCAGCG GAAATGGCAAGAGGCAAATCAGAAGATC

CAGGAGCTGCAGGCCAGTCAAGATGAGAGAGCTGAGCATGAGCAGAAGATTAAG - UNI10386 - GACCTGGAGCAGAAGCTGTGTCTACAAGAGCA

GGATGCAGCTGTGGTGAAGAGCATGAAGTCTGAGCTGATGCGGATGCCCAGGATGGAGCGTGAGCTGAAGAGGCTGCATGAAGAGAACACTCATCTAAG 

GGAGATGAAGGAGACCAATGGGCTGCTCACAGAGGAGCTGGAAGGTCTGCAGAGGAAACTGAGCCGGCAGGAGAAGATGCAGGAGGCTCTGGTTGACCTG

GAGTTGGAAAAGGAG - UNI8736 - - UNI14666 - AAGCTACTTGCAAAGCTGCAGAGCTGGGAGAACCTGGACCAGACCATGGGCTTGAATCT

CAG - UNI14666 - - UNI36008 - GACTCCAGAGGACCTTTCTAGGTTCGTGGTTGAGCTACAGCAGCGAGAGCTCACCCTGAAGGAGAAGAAT

AACAGCATCACCAGCAG - UNI14666 - - UNI36008 - TGCCCGGGGTCTGGAGAAGGTCCAGCAGCAGCTCCAGGATGAGGTCCGGCAGGCCA

ATGCACAGCTGCTGGAGGAGCGGAAAAAGAGGGAGACACATGAGGCACTTGCCCGAAGGCTCCAGAAGCGCAATGCATTGCTGACCAAG - UNI3581 

- - UNI26178 - - UNI36008 - GAGAGAGATGGCATGCGTGCCATCCTGGGATCCTACGACAGTGAGCTGACCCAAACTGAGTACTCAACCCAG

CTGACACAGCGCCTGTGGGAGGCCGAGGACATGGTTCAGAAGGTACATGCCCACAGCTCGGAGATGGAG - UNI2702 - GCTCAGCTGTCTCAGGCC

CTGGAGGAGCTTGGGGTTCAGAAGCAGAGAGCTGACACG - UNI2663 - CTGGAGATGGAGTTGAAGATGCTGAAGGCCCAGACAAGCTCAGCTGAA

TCTAGCTTCTCATTCTGCAAAGAGGAGGTGGATGCACTCAG - UNI6035 - - UNI8445 - - UNI34291 - GGTGACTACAACCAGAGTCGA

ACCAAAGTGCTACACATGAGCCTTAACCCAATCAGCATGGCCAGGCAACGCCAGCATGAGGACCATGACCGGCTGCAGGAGGAATGTGAGCGCTTACGGG

GACTTGTGCATGCCCTGGAGAGAGGGGGCCCCATCCCTGCTGACCTGGAGGCTGCCTCCAGTCTGCCCTCATCAAAGGAGGTGGCAG - UNI6035 - 

- UNI13723 - - UNI34291 - AGCTGCGGAAGCAGGTGGAAAGTGCTGAGCTGAAGAACCAGCGGCTGAAGGAGGTTTTCCAGACCAAGATCCAG

GAGTTCCGCAAAGTTTGCTACACGCTGACCGGCTACCAGATTGACGTGACCACGGAGAGCCAATACCGCCTCACCTCCCGATACGCTGAGCACCAGACGG

ACTGCCTCATCTTCAAG - UNI1169 - - UNI13723 - - UNI27101 - - UNI34291 - GCCACAGGACCCTCGGGCTCCAAGATGCAGC

TGCTGGAGACAGAGTTCTCACGGTCTGTGCCTGAGCTCATTGAACTGCACTTGCTGCAGCAGGACAGCATCCCTGCCTTCCTCAGTGCGCTCACCATAGA

GCTGTTCAGCCGCCAGACCTCTATCTAGCCTCTTCCCATGAGCATCTTCACTACAGCCGCTGGACCTCGGCCTAGCCTGTACCTGCAGCTTCTCACATGC

AGCCCCCAGACCTTGAGCTAGCTCTTGGTCTACAGTTGCCCACATCATCCCCAGATCCCTTTGCCACCCATAGCTGCATCATGTCACAAACACTAGCCGT

GGCCTCTGCTCAAGCAGCCACTGTCTCTTGTCCCTGGCTAGGAGCAAGCTACTGGGGATGACCAAGCCAGATCATACCCCACTACTCTCCTCCCCACCCC

ACCCCATTCTAGAGCCGCTCCACGTACTGTCCCAAGGTGTACCCCAGCCTCCAGTCCCATGCGCTGGTTGCTTAGGCTTCAGTGGCCAGACTGTAGCCTG

TGTCCACAGTCTCAGACTAATGAAATAAAGTGCTACCTTTATCTTCCTTCCCGGA
Translation
 MEDLGENTTVLSSLRSLNNFISQRMEGTSGLDVSTSASGSLQKQYEYHMQ - UNI2971 - LEERAEQIRSKSYLIQVEREKMQMELSHKRARVELE

RAASTNARNYE REVDRNQELLARIRQLQECEATAEEKMREQLERHRLCKQNLDAVSQQLREQEDSLASARE MISSLKGRVSELQLSAMDQKVQVKRLE

SEKQELKEQLELQQR RKWQEANQKIQELQASQDERAEHEQKIK - UNI10386 - DLEQKLCLQEQDAAVVKSMKSELMRMPRMERELKRLHEENTH

LR REMKETNGLLTEELEGLQRKLSRQEKMQEALVDLELEKE - UNI8736 - - UNI14666 - KLLAKLQSWENLDQTMGLNLR - UNI14666

 - - UNI36008 - RTPEDLSRFVVELQQRELTLKEKNNSITSS - UNI14666 - - UNI36008 - SARGLEKVQQQLQDEVRQANAQLLEER

KKRETHEALARRLQKRNALLTK - UNI3581 - - UNI26178 - - UNI36008 - ERDGMRAILGSYDSELTQTEYSTQLTQRLWEAEDMVQKV

HAHSSEME - UNI2702 - AQLSQALEELGVQKQRADT - UNI2663 - LEMELKMLKAQTSSAESSFSFCKEEVDALR - UNI6035 - - UN

I8445 - - UNI34291 - RVTTTRVEPKCYT - UNI6035 - - UNI13723 - - UNI34291 -  - UNI1169 - - UNI13723 - -

 UNI27101 - - UNI34291 - 

For any suggestions or comments, please send an email to unitrap@crg.es