Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000029560 (Snx8)
Chromosomal location
Chr 5: 140816258 - 140865216 (-)
Description
sorting nexin 8 Gene [Source:MGI Symbol;Acc:MGI:2443816]
RefSeq_dna
NM_172277 
RefSeq_peptide
NP_758481.1 
UniGene
Mm.27098 
MGI
MGI:2443816 
Uniprot/SWISSPROT
Q8CFD4 
Uniprot/SPTREMBL
Q3TT02 Q3U0I9 
Human Ortholog
ENSG00000106266 (SNX8)
Omim not available
UniTrap UNI9642
Vector Insertion
Chr 5: 140836337 - 140865101
Public Clones (sanger) XG226 (baygenomics) E118D01 (ggtc) W055D01 (ggtc) D144B06 (ggtc)
W183B03 (ggtc) IST11632D12 (tigm) IST14112D3 (tigm) IST10099B6 (tigm)
IST11711C7 (tigm) IST10394F4 (tigm) IST12016H1 (tigm) IST14224E1 (tigm)
IST14120D3 (tigm) IST14116D3 (tigm)
Private Clones OST383003 (lexicon) OST276969 (lexicon) OST274696 (lexicon) OST179367 (lexicon)
OST168862 (lexicon)
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1796
Vector Insertion
Chr 5: 140829468 - 140831913
Public Clones CC0395 (sanger) RRU061 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 38% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2364
Vector Insertion
Chr 5: 140822300 - 140828086
Public Clones AD0417 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 66% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8861
Vector Insertion
Chr 5: 140820810 - 140822230
Public Clones XL179 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 71% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000031539
Sequence
CACGTGGGCGAGCGGGCTCACATGACTGGCCGCGCGATGGACCCGCTGCCCTCGCCGGCAGTCGCTGCAGCTGCTGAGGCGGAGGCTGACGAGGAGGCGG

ATCCGCCGGCGACAG - UNI9642 - GCCCACGAACATCCCAGGTCACTGAGTGGAGGGCCCTGGACCCCGGGCGAATGCAGATGCCGCAGGGGAACC

CACTGCTGCTGTCCTACACCCTGCAGGAGCTGCTGGCCAAGGACACGGTGCAGGTGGAGCTCATCCCTGAGAAGAAGGGCCTCTTCCTTAAGCATGTGGA

GTACGAGGTTTCCAGCCAG CGCTTCAAGTCCTCCGTGTACAGACGCTACAATGACTTCGTGGTCTTCCATGAAGTGCTGCTTCACAAGTTCCCGTACCG

CATGGTTCCAGCTCTTCCGCCCAAGAGAGTGCTGGGAG CCGACAGGGAGTTCATCGAGGGCCGCCGGAGGGCCCTGAAGCGCTTCATCAACCTGGTGGC

CCGGCACCCACCCTTCTCTGAGGACGTGCTCCTTAAACTCTTCCTCTCCTTCAGTGGCTCG - UNI1796 - GATGTTCAGCACAAGCTCAAGGAGGC

GGCCCAGTGCGTGGGAGATGAGTTCATGAACTGTAAGCTGGCTGCTAGGGCCAAG GACTTCCTCCCAGCTGACATCCAGACTCAATTTGCCATGAGCCG

GGAGCTGATTCGAAATGTCTACAACAGCTTCTACAAGCTTCGAGACAGAGCCGAGCGGATTGCGTCCCGGGCCATTGACAACGCTGCTGATCTTCTCATA

TTTGGAAAGGAGCTTAG TGCTTTGGGCTCCGACACCACCCCTCTGCCCTCCTGGGCTGCTCTGCACCTCAGCACATGGGGCTCCCTGAAGCAAGCGCTC

AAGGGCCTCTCCGTGGAGTTTGCACTGCTGGCGGACAGAGCTGCACAGCAG - UNI2364 - GGCAAGAAGGAGGAGAATGATGTAGTGGAGAAGCTG

AACCTCTTCTTGGATTTGTTGCAGTCCTACAAA - UNI8861 - GACCTGTGTGAGCGGCACGAGAAGGGCGTGCTTCACAAACACCAGCGGGCACTG

CACAAGTACGGCCTGATGAAGAGGCAGATGATGAGTGCAGCGCACGGCCGAGAACCTGAGTCTGTGGAGCAGCTGGAGTCACGAATCGTGGAG CAGGAG

AACGTGATCCAGACTATGGAACTCCGAAACTACTTCTCCCTCTACTGCCTGCACCAGGAGACGCAGCTCGTCCACGTCTACCTGCCTCTCACCTCGCACA

TCCTGGGGGCCTTCGTGAACTCCCAGATCCAAGGGCACAAGGAG ATGAGCAAGGTGTGGAATGACCTGAAGCCGAAGCTGAGCTGCCTCTTCGCTGGAC

CTCACAGTGTGTTGACGCCACCGCGCTCCCCGCAGGAGGATGGCGTGTGTCCCCACTAGTGGCAAGACCCACGACAGAGCTCCCGGTGGCCTCACTAAAA

CCTCTTTTCAAACAGTGTGTTCCTGGCTGATTCCCTCCAGGCAGCAGCCGTTCCCCTGAGCTGCCTGTGGGCTGCCGGCGGTCTTTGTGTCTCCCTGTTC

TTGTTGTAGGAGGTCTTTGTGCCCCCAGTCTGCCCCTTGGCCTGTTGATCAGGTCGGTAGTGGGAAGTTAGGGTGCTTTGGACTGGATTGTGCCCGGTGC

CCGCAGTGTTAAGGGCCTTTTGTACCCAGTAAGTGGTTTCTAGGGGAGCCTAGGGGTTCACCTAGCAGCAAAGGGATGGGAGGACTGGCCTGTCCTGTGG

CCTGGCAAAGAGCTGGTCAATCTCTCAGAGTGGGCAGTGACTCTAGCCTTGGGCCTACAGACATTCTGGGAGGAGCATTTGAAGCCAGGCGGAGGTCTGA

TGCAAGGGGGAGGTGAGTGTGCAGTGCTTGGAGCTTTGGAGGACATCTTTCACTTCAGTGCGATCCTTGGAGCTCTGGTCCAGGGCCTGTCAAGGTCCAC

AGTGGATGAAGGCTCAGGGTCTTTTTGTGTTGGGTTTGGAGGGTGGGAGTGAGGAGGGGTTGTGGGGAAGCACTGGAGGTGGGCATCCCTGTTGGGTGCC

CAGGCCTCAGGCTGTCAGGCCGCAGGCTCCACCTGGATGTGAGCCGTTTCCTTTACCAGCCCGCTCACCAGCCTCTGTGCTCTAGTGCTCTGGGTCCCCC

ACGCCTGCAATAGAGCCTGCCTTTTCTCACATAGTCTTTCCCTGACTGGACTGTGGGTGCCTGACTCCAAACTTGAGGTTCCACTCCTAGGGTTCAGAGG

AACCAAGGGTCCCCCTACCCTTCTGGGTATCGTGCTGTCTGAGCCTGTGTTGTGCCCCAGCCACGCTTGGGGCTGCCAGAAAGACAGAGAAGCACAAGAG

GCACCGGATCTCCCGCCTGCTTGTCCCTTTCCCTGGCCTGAGTGGGGCCCAGCGGTAGCCTTAACTGGACAGTCCTGGGGCCATCAGAGTGGGAGTGAAG

GGAAGGGGTTTTTTTTGGTGCTCCCTACTTGGTGTTAGCCACCCTGGTTGAAGAAGCTAGACAGGGCAGTGGGTCTCTGGGCTAAGGGAGTCAAGCTGGT

GCTATGGGATTCGGCTCGATGAATGAAGCACTTTATGGACTGCGGGGATCAGTTACTGCCACACCCAATAAACTGGAAGTGTTT
Translation
MTGRAMDPLPSPAVAAAAEAEADEEADPPATG - UNI9642 - GPRTSQVTEWRALDPGRMQMPQGNPLLLSYTLQELLAKDTVQVELIPEKKGLFLK

HVEYEVSSQ RFKSSVYRRYNDFVVFHEVLLHKFPYRMVPALPPKRVLGA ADREFIEGRRRALKRFINLVARHPPFSEDVLLKLFLSFSGS - UNI17

96 - DVQHKLKEAAQCVGDEFMNCKLAARAK DFLPADIQTQFAMSRELIRNVYNSFYKLRDRAERIASRAIDNAADLLIFGKELS SALGSDTTPLPS

WAALHLSTWGSLKQALKGLSVEFALLADRAAQQ - UNI2364 - GKKEENDVVEKLNLFLDLLQSYK - UNI8861 - DLCERHEKGVLHKHQRAL

HKYGLMKRQMMSAAHGREPESVEQLESRIVE QENVIQTMELRNYFSLYCLHQETQLVHVYLPLTSHILGAFVNSQIQGHKE MSKVWNDLKPKLSCLFA

GPHSVLTPPRSPQEDGVCPH

For any suggestions or comments, please send an email to unitrap@crg.es